Psyllid ID: psy6031

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
FDGLEAINEEENPLAPWLTLKPPIEPKDSSKESQLTTTNTSETNDQQFFIVGLDGSHCSVDEFFMSVDDGGSVPVPQPEEKTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEEEEcccHHHHHHHcccccccccEEEEccccHHHHHHHHHcHHccEEEEEcccHHHHHHHHHcccccccccc
cccHHHHcHccccccccEccccccccccccHcEEEEccccccccccccEEEEEcccHccccccccccccccccccccccccccHHcccccccccccEEEEEcccHHHHHHHHHHHHcccccEEEEEEEcccEEHHHHEEEccccHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHcccccc
fdgleaineeenplapwltlkppiepkdsskesqltttntsetndqQFFIVGldgshcsvdeffmsvddggsvpvpqpeekTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIilsasspffqeilspiendchpiviladvpanDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
fdgleaineeenplapwltlkppiEPKDSSKESQLTttntsetndqQFFIVGLDGSHCSVDEFFMSVDDGGSVPVPQPEEKTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
FDGLEAINEEENPLAPWLTLKPPIEPKDSSKESQLTTTNTSETNDQQFFIVGLDGSHCSVDEFFMSVDDGGSVPVPQPEEKTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
**********************************************QFFIVGLDGSHCSVDEFFMSVDDG**********KTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKIS*****
**G*EA*NEEENPLAPWLTLKPPI********************DQQFFIVGLDGSHCSVD*************************************MKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALL**
FDGLEAINEEENPLAPWLTLKPPIEP**************SETNDQQFFIVGLDGSHCSVDEFFMSVDDGGSVPVPQPEEKTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
FDGLEAINEEENPLAPWLTLKPPIEPKDSSKESQLTTTNTSETNDQQFFIVGLDGSHCSVDEFFMSVDDGGSVPVP***************TTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FDGLEAINEEENPLAPWLTLKPPIEPKDSSKESQLTTTNTSETNDQQFFIVGLDGSHCSVDEFFMSVDDGGSVPVPQPEEKTILSIRMAAITTGTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query209 2.2.26 [Sep-21-2011]
Q9W0K4 1067 Protein bric-a-brac 2 OS= yes N/A 0.540 0.105 0.465 7e-24
P42282 813 Protein tramtrack, alpha no N/A 0.526 0.135 0.433 1e-21
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.526 0.112 0.460 2e-21
Q24206 880 Broad-complex core protei no N/A 0.531 0.126 0.421 1e-20
Q01295 727 Broad-complex core protei no N/A 0.531 0.152 0.421 1e-20
P17789 643 Protein tramtrack, beta i no N/A 0.531 0.172 0.419 2e-20
Q9V5M6 963 Longitudinals lacking pro no N/A 0.521 0.113 0.390 3e-19
Q867Z4 970 Longitudinals lacking pro no N/A 0.521 0.112 0.390 3e-19
Q9V5M3 878 Longitudinals lacking pro no N/A 0.521 0.124 0.390 3e-19
P42284 549 Longitudinals lacking pro no N/A 0.521 0.198 0.390 3e-19
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 77/116 (66%), Gaps = 3/116 (2%)

Query: 94  GTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSP 153
           G  FC++W N+Q +L     +LL+ ES VDVTL  EG + +AH+++LSA SP+FQ +   
Sbjct: 195 GQQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALF-- 252

Query: 154 IENDC-HPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLE 208
            +N C HPI+I+ DV  +D+KA++EF+Y GEI V    I  +LK A+ LKI  L E
Sbjct: 253 YDNPCQHPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAE 308
Probably acts as a transcriptional regulator. Required for the specification of the tarsal segment. Also involved in antenna development.
Drosophila melanogaster (taxid: 7227)
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description
>sp|Q24206|BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
345494983 492 PREDICTED: hypothetical protein LOC10012 0.540 0.229 0.5 4e-25
380019418 502 PREDICTED: uncharacterized protein LOC10 0.531 0.221 0.491 6e-24
328790900 502 PREDICTED: hypothetical protein LOC40925 0.531 0.221 0.491 7e-24
241701538 448 zinc finger protein, putative [Ixodes sc 0.526 0.245 0.495 1e-23
340716639 503 PREDICTED: hypothetical protein LOC10064 0.535 0.222 0.477 1e-23
350404316 503 PREDICTED: hypothetical protein LOC10074 0.535 0.222 0.477 1e-23
442759685 441 Putative bric a brac 2 [Ixodes ricinus] 0.526 0.249 0.486 2e-23
332027987 494 Protein bric-a-brac 1 [Acromyrmex echina 0.526 0.222 0.495 2e-23
383864386 504 PREDICTED: uncharacterized protein LOC10 0.535 0.222 0.477 2e-23
325303180241 TPA_inf: BTB/POZ and Kelch domain-contai 0.526 0.456 0.486 3e-23
>gi|345494983|ref|XP_001605103.2| PREDICTED: hypothetical protein LOC100121492 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 79/114 (69%), Gaps = 1/114 (0%)

Query: 95  TNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPI 154
           T++C KW N+Q HL+  + QLL+ E MVDVTL A GE  QAHR++L A S  FQEILS +
Sbjct: 15  TSYCFKWSNYQSHLSEVVRQLLEEECMVDVTLYAGGERIQAHRLVLCACSTLFQEILSQV 74

Query: 155 ENDCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLE 208
            ND H  +IL+D+   DV++I+EF Y GE+++   NI ++L  A +LKI  L+E
Sbjct: 75  -NDEHATIILSDISPQDVRSIVEFSYNGEVRIPVENINNLLDAAHSLKICGLME 127

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380019418|ref|XP_003693604.1| PREDICTED: uncharacterized protein LOC100867162 [Apis florea] Back     alignment and taxonomy information
>gi|328790900|ref|XP_397552.4| PREDICTED: hypothetical protein LOC409259 [Apis mellifera] Back     alignment and taxonomy information
>gi|241701538|ref|XP_002402860.1| zinc finger protein, putative [Ixodes scapularis] gi|215504895|gb|EEC14389.1| zinc finger protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|340716639|ref|XP_003396803.1| PREDICTED: hypothetical protein LOC100644020 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404316|ref|XP_003487067.1| PREDICTED: hypothetical protein LOC100740282 [Bombus impatiens] Back     alignment and taxonomy information
>gi|442759685|gb|JAA72001.1| Putative bric a brac 2 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|332027987|gb|EGI68038.1| Protein bric-a-brac 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383864386|ref|XP_003707660.1| PREDICTED: uncharacterized protein LOC100876849 [Megachile rotundata] Back     alignment and taxonomy information
>gi|325303180|tpg|DAA34418.1| TPA_inf: BTB/POZ and Kelch domain-containing protein [Amblyomma variegatum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query209
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.540 0.105 0.465 4.9e-24
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.645 0.138 0.421 9.7e-23
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.531 0.126 0.421 2.4e-20
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.526 0.137 0.460 2.6e-20
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.531 0.136 0.419 1.5e-19
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.555 0.913 0.403 8.3e-19
FB|FBgn0029824 676 CG3726 [Drosophila melanogaste 0.535 0.165 0.419 2.7e-18
FB|FBgn0263102 1085 psq "pipsqueak" [Drosophila me 0.569 0.109 0.414 2.7e-18
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.631 0.138 0.355 7.7e-18
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.521 0.112 0.390 2.1e-17
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 4.9e-24, Sum P(2) = 4.9e-24
 Identities = 54/116 (46%), Positives = 77/116 (66%)

Query:    94 GTNFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSP 153
             G  FC++W N+Q +L     +LL+ ES VDVTL  EG + +AH+++LSA SP+FQ +   
Sbjct:   195 GQQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALF-- 252

Query:   154 IENDC-HPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLE 208
              +N C HPI+I+ DV  +D+KA++EF+Y GEI V    I  +LK A+ LKI  L E
Sbjct:   253 YDNPCQHPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAE 308
GO:0005515 "protein binding" evidence=IPI
GO:0006351 "transcription, DNA-dependent" evidence=IEP
GO:0008585 "female gonad development" evidence=IGI;IMP
GO:0005634 "nucleus" evidence=IDA;TAS
GO:0007455 "eye-antennal disc morphogenesis" evidence=ISS
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IGI;IMP
GO:0003677 "DNA binding" evidence=NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0005700 "polytene chromosome" evidence=IDA
GO:0003680 "AT DNA binding" evidence=IDA
GO:0005701 "polytene chromosome chromocenter" evidence=IDA
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029824 CG3726 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263102 psq "pipsqueak" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
pfam00651101 pfam00651, BTB, BTB/POZ domain 1e-21
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-19
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.001
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 0.003
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information 
 Score = 84.6 bits (210), Expect = 1e-21
 Identities = 32/98 (32%), Positives = 56/98 (57%), Gaps = 3/98 (3%)

Query: 112 LYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPAND 171
           L +L +   + DVTL    + F AH+ +L+A SP+F+ + +    +    + L DV   D
Sbjct: 1   LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFT---GNKEVEITLEDVSPED 57

Query: 172 VKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA 209
            +A+LEFIY G++++   N+  +L  A  L+I AL++ 
Sbjct: 58  FEALLEFIYTGKLEITEENVDDLLALADKLQIPALIDK 95

The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 209
PHA02713 557 hypothetical protein; Provisional 99.83
KOG4441|consensus 571 99.83
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.78
PHA02790 480 Kelch-like protein; Provisional 99.78
KOG4350|consensus 620 99.7
PHA03098 534 kelch-like protein; Provisional 99.7
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.65
KOG2075|consensus 521 99.5
KOG4591|consensus 280 99.32
KOG0783|consensus 1267 98.68
KOG4682|consensus 488 98.6
KOG0783|consensus 1267 98.43
KOG2838|consensus 401 98.18
KOG2838|consensus401 97.47
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.16
KOG2716|consensus 230 97.16
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.8
KOG0511|consensus 516 96.46
KOG3473|consensus112 96.41
KOG0511|consensus 516 96.3
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 95.99
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 95.14
KOG1665|consensus 302 94.85
KOG2714|consensus 465 94.51
KOG1987|consensus 297 94.2
KOG2715|consensus210 91.57
KOG3840|consensus 438 88.97
KOG1724|consensus162 84.36
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 83.78
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.83  E-value=7.2e-22  Score=184.97  Aligned_cols=106  Identities=26%  Similarity=0.433  Sum_probs=97.3

Q ss_pred             ccchhhhHHHHHHHhhhcceeeeeeecc-cccceeeeeeeecCChhhHhhhc-cccCC-CcceEEeecCCcchHHHHHhh
Q psy6031         102 QNFQVHLAFELYQLLKMESMVDVTLKAE-GEAFQAHRIILSASSPFFQEILS-PIEND-CHPIVILADVPANDVKAILEF  178 (209)
Q Consensus       102 ~~~~~~l~~~l~~l~~~~~~~DV~l~v~-~~~f~aHr~VLaa~S~yFr~~f~-~~~e~-~~~~I~l~~v~~~~f~~lL~f  178 (209)
                      ..|...++..|++||+++.+|||+|.++ |++|+|||.|||++|+||++||+ ++++. ...+|.|.++++++|+.+|+|
T Consensus         6 ~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~~e~~~~~~v~l~~v~~~~~~~ll~y   85 (557)
T PHA02713          6 IKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVKNIVQY   85 (557)
T ss_pred             hhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCchhhccCceEEeccCCHHHHHHHHHH
Confidence            4688999999999999999999999997 89999999999999999999994 55655 478899999999999999999


Q ss_pred             hhcceeeeecccchhhhhhcccccccccccC
Q psy6031         179 IYYGEIKVEGANIFSVLKTAQNLKISALLEA  209 (209)
Q Consensus       179 iYtg~i~~~~~~v~~Ll~~A~~l~i~~L~~a  209 (209)
                      +|||+  ++.+++++||.+|++|+++.|+++
T Consensus        86 ~Yt~~--i~~~nv~~ll~aA~~lqi~~l~~~  114 (557)
T PHA02713         86 LYNRH--ISSMNVIDVLKCADYLLIDDLVTD  114 (557)
T ss_pred             hcCCC--CCHHHHHHHHHHHHHHCHHHHHHH
Confidence            99997  678999999999999999998753

>KOG4441|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3ohu_A125 Crystal Structure Of The Human Bach2 Poz Domain, Fo 9e-06
3ga1_A129 Crystal Structure Of The Human Nac1 Poz Domain Leng 3e-05
2if5_A120 Structure Of The Poz Domain Of Human Lrf, A Master 1e-04
2nn2_A133 Crystal Structure Of The Btb Domain From The LrfZBT 1e-04
3e4u_A130 Crystal Structure Of The Wild-Type Human Bcl6 BtbPO 1e-04
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 3e-04
2ihc_A124 Crystal Structure Of The Bric-A-Brac (Btb) Domain O 8e-04
4ap2_A 297 Crystal Structure Of The Human Klhl11-cul3 Complex 9e-04
>pdb|3OHU|A Chain A, Crystal Structure Of The Human Bach2 Poz Domain, Form I Length = 125 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
Query: 117 KMESMVDVTLKAEGEAFQAHRIILSASSPFF-QEILSPIENDCHPIVILADVPANDVKAI 175
           K + + DVTL  E + F+AHR +L+A S +F Q ++   +ND   + +  +V A     +
Sbjct: 28  KKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQTKNDL-VVSLPEEVTARGFGPL 86
Query: 176 LEFIYYGEIKVEGANIFSVLKTAQNLKISAL 206
           L+F Y  ++ +   NI  V++ A+ L++  L
Sbjct: 87  LQFAYTAKLLLSRENIREVIRCAEFLRMHNL 117
>pdb|3GA1|A Chain A, Crystal Structure Of The Human Nac1 Poz Domain Length = 129 Back     alignment and structure
>pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 Back     alignment and structure
>pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 Back     alignment and structure
>pdb|3E4U|A Chain A, Crystal Structure Of The Wild-Type Human Bcl6 BtbPOZ DOMAIN Length = 130 Back     alignment and structure
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|2IHC|A Chain A, Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1 Length = 124 Back     alignment and structure
>pdb|4AP2|A Chain A, Crystal Structure Of The Human Klhl11-cul3 Complex At 2.8a Resolution Length = 297 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query209
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 5e-21
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 2e-20
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-20
3b84_A119 Zinc finger and BTB domain-containing protein 48; 3e-20
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 5e-20
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 5e-20
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 6e-20
2vpk_A116 Myoneurin; transcription regulation, transcription 6e-20
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 6e-20
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 2e-19
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 3e-18
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 5e-18
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 3e-17
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 6e-17
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 7e-17
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 1e-16
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 3e-16
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 6e-15
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 2e-13
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 5e-21
 Identities = 27/113 (23%), Positives = 55/113 (48%)

Query: 97  FCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIEN 156
           +  +      ++   L    K + + DVTL  E + F+AHR +L+A S +F + L     
Sbjct: 8   YVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQTK 67

Query: 157 DCHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA 209
           +   + +  +V A     +L+F Y  ++ +   NI  V++ A+ L++  L ++
Sbjct: 68  NDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDS 120
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.93
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.92
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.92
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.92
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.92
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.92
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.92
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.92
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.92
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.92
2vpk_A116 Myoneurin; transcription regulation, transcription 99.91
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.91
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.91
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.89
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.87
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.87
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.87
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.87
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.87
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.81
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.26
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.22
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.88
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.76
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.52
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.5
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.04
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.0
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.82
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 96.67
3kvt_A115 Potassium channel protein SHAW; tetramerization do 96.15
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 95.83
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 95.42
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.27
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 94.86
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 83.09
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
Probab=99.93  E-value=4.6e-27  Score=176.48  Aligned_cols=111  Identities=24%  Similarity=0.388  Sum_probs=101.2

Q ss_pred             eeeeccchhhhHHHHHHHhhhcceeeeeeecccccceeeeeeeecCChhhHhhh-ccccCCCcceEEeecCCcchHHHHH
Q psy6031          98 CMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEIL-SPIENDCHPIVILADVPANDVKAIL  176 (209)
Q Consensus        98 ~~~~~~~~~~l~~~l~~l~~~~~~~DV~l~v~~~~f~aHr~VLaa~S~yFr~~f-~~~~e~~~~~I~l~~v~~~~f~~lL  176 (209)
                      .++|+.|...+++.++++++++.+|||+|.++|+.|+|||.||+++|+||++|| +++.+.....|.++++++++|+.+|
T Consensus         2 ~~~~~~h~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~~f~~~~~e~~~~~i~l~~~~~~~f~~ll   81 (120)
T 2if5_A            2 GIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALM   81 (120)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHHC-----CCSEEECCSSCHHHHHHHH
T ss_pred             CcCccchHHHHHHHHHHHHhcCCCCCeEEEECCEEEeHHHHHHHHhCHHHHHHhcCCccccCCceEEeCCCCHHHHHHHH
Confidence            456789999999999999999999999999999999999999999999999999 4556677889999999999999999


Q ss_pred             hhhhcceeeeecccchhhhhhccccccccccc
Q psy6031         177 EFIYYGEIKVEGANIFSVLKTAQNLKISALLE  208 (209)
Q Consensus       177 ~fiYtg~i~~~~~~v~~Ll~~A~~l~i~~L~~  208 (209)
                      +|+|||++.++.+++.+++.+|++|+++.|++
T Consensus        82 ~~~Yt~~~~~~~~~~~~ll~~A~~~~i~~L~~  113 (120)
T 2if5_A           82 DFAYTATLTVSTANVGDILSAARLLEIPAVSH  113 (120)
T ss_dssp             HHHHHSCCCCCGGGHHHHHHHHHHTTCHHHHH
T ss_pred             HHHcCCCCccCHHHHHHHHHHHHHhCCHHHHH
Confidence            99999999999999999999999999999875
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 209
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-19
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-18
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.2 bits (192), Expect = 2e-19
 Identities = 23/112 (20%), Positives = 52/112 (46%), Gaps = 1/112 (0%)

Query: 99  MKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEIL-SPIEND 157
           +++      +   L +L   + + DV +    E F+AH+ +L A S  F  I    ++ +
Sbjct: 3   IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62

Query: 158 CHPIVILADVPANDVKAILEFIYYGEIKVEGANIFSVLKTAQNLKISALLEA 209
              I +  ++       +L+F+Y   + +   NI +V+ TA  L++  +++ 
Sbjct: 63  LSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT 114
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query209
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.93
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.92
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.83
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.35
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.96
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.76
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 95.08
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 94.41
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=1.5e-27  Score=179.11  Aligned_cols=109  Identities=20%  Similarity=0.318  Sum_probs=101.9

Q ss_pred             ceeeeeccchhhhHHHHHHHhhhcceeeeeeecccccceeeeeeeecCChhhHhhhccccCCCcceEEeecCCcchHHHH
Q psy6031          96 NFCMKWQNFQVHLAFELYQLLKMESMVDVTLKAEGEAFQAHRIILSASSPFFQEILSPIENDCHPIVILADVPANDVKAI  175 (209)
Q Consensus        96 ~~~~~~~~~~~~l~~~l~~l~~~~~~~DV~l~v~~~~f~aHr~VLaa~S~yFr~~f~~~~e~~~~~I~l~~v~~~~f~~l  175 (209)
                      .+.+..+.|+..++..|+++|++|.+|||+|.|+|++|+|||.|||++|+||+++|.+    ...+|.++++++++|+.+
T Consensus         3 ~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~lf~~----~~~~i~~~~v~~~~f~~l   78 (121)
T d1buoa_           3 MIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHR----NSQHYTLDFLSPKTFQQI   78 (121)
T ss_dssp             CCCCCCTTHHHHHHHHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHHTTS----CCSEEEECSSCHHHHHHH
T ss_pred             eEEEcCCchHHHHHHHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhhccC----ccceeecCCCCHHHHHHH
Confidence            4567788999999999999999999999999999999999999999999999999943    346899999999999999


Q ss_pred             Hhhhhcceeeeecccchhhhhhccccccccccc
Q psy6031         176 LEFIYYGEIKVEGANIFSVLKTAQNLKISALLE  208 (209)
Q Consensus       176 L~fiYtg~i~~~~~~v~~Ll~~A~~l~i~~L~~  208 (209)
                      |+|+|||++.++.+++.+++.+|++|+++.|++
T Consensus        79 l~~~Ytg~i~l~~~~v~~ll~~A~~l~~~~L~~  111 (121)
T d1buoa_          79 LEYAYTATLQAKAEDLDDLLYAAEILEIEYLEE  111 (121)
T ss_dssp             HHHHHHSCCCCCGGGHHHHHHHHHHHTCHHHHH
T ss_pred             HHheEccccCCcHHHHHHHHHHHHHhCCHHHHH
Confidence            999999999999999999999999999999875
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure