Psyllid ID: psy6038

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-
MEEIEENSNGTISSVAKTEGDVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANYRMPGGKT
cHHHHHccccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccHHHHHHHHHHHHcccEEEEEccccccccEEEEEEcccccccccccEEEcccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcHHHHHHHccccccccccccccccccccccccccccccEEEEcccccHHHHHHccccccccccEEEEEEcccccEEEEccccccccccEEEEcEEEEEEEccccccccccccccEEcccccHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccccccccEEEccccccEEEEEEcHHHHHHHHHcccccccccccccEEEEcccccccccccccccccccccHHHHHHHcccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccc
ccHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEcHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEEEccEHHHHHHHHHHHHccccEEEEccccccEccccEEccccEEEEEccEEEEcccccHHHHHHHHHcccEEEEccccccEEccccccccccccccccHHHHHcccHHHcHHHHHHHcccHcHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccEEEccccHHHHHHHHccccEEEccEEEEEEEccccEEEEEEEEEEccccEEEEEcEEEEEEcHHHccccccccccEEEcccccHHHHHHHHHcccccEEEEEEEEccccccccccEEEEEccccccccEEEEEcccccccEEEEEEcHHHHHHHHHccccccccccccEEEEEEcccccccccccEEEccccccccHHHHHcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccc
meeieensngtissvaktegdvydedieyhipeglegaafqsrlpydkmttnevqyfpdisnnpihshKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLerhgyinfgifqritpipvkksgkvIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVtglggnpinILARQINMELLKighqcplyqssaensdnlqvpkdkddLVEREFNRLLECTSYLshtldfnylegkPLSLVIELQEELKPVLSRMNEILVQLDTLdqtlqnvpidnttavefqkrstrrdmNHLCTEYDQLNEKKTQLQAKLHAmesnppadvylsvkdrQLLDWHFANlefanatplaslslkhwdqdddfeftgshltvkkgyacvptalaegldvhfnssvteihynskgvtvktvdpktgqnetvytgdrvlctlplgilkaciqppkdvlfnpplpdwkvkSIRRLGYGLLNKVVLCFDKifwdpaenlfghvgsttasrGELFLFWNLYQAPVLLALVAGEAASIledvsifptntvpqpketvvtrwkadpfakgsySFVAvgasgsdydtlglpvkddkdiprlffagehtirnypatvHGAFLSglkegghiVDQILGanyrmpggkt
meeieensngtissvaktegdVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGrivtfkksnyvaDLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSsaensdnlqvpkdKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLdqtlqnvpidnttavefqkrstrrdMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHynskgvtvktvdpktgqnetvytGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDvsifptntvpqpketVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILganyrmpggkt
MEEIEENSNGTISSVAKTEGDVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVqldtldqtlqNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANYRMPGGKT
*********************VYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLY******************LVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEF**********HLCTE************************DVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANY*******
*********************************GLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPI*VKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQIL***********
************SSVAKTEGDVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANYRMPGGKT
***************************EYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANY*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEIEENSNGTISSVAKTEGDVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANYRMPGGKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query661 2.2.26 [Sep-21-2011]
Q6ZQ88853 Lysine-specific histone d yes N/A 0.930 0.720 0.574 0.0
O60341852 Lysine-specific histone d yes N/A 0.930 0.721 0.574 0.0
Q9VW97890 Possible lysine-specific yes N/A 0.966 0.717 0.530 0.0
Q9CAE3 789 Lysine-specific histone d no N/A 0.762 0.638 0.361 3e-91
Q6YYZ1 763 Lysine-specific histone d no N/A 0.409 0.355 0.431 3e-64
Q6Z690 849 Lysine-specific histone d no N/A 0.405 0.315 0.440 5e-63
Q8VXV7 844 Lysine-specific histone d no N/A 0.403 0.316 0.437 3e-61
Q9LID0 746 Lysine-specific histone d no N/A 0.422 0.373 0.422 6e-60
Q7XUR2 811 Lysine-specific histone d no N/A 0.459 0.374 0.410 2e-57
Q01H90 811 Lysine-specific histone d N/A N/A 0.459 0.374 0.410 9e-57
>sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 Back     alignment and function desciption
 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/674 (57%), Positives = 500/674 (74%), Gaps = 59/674 (8%)

Query: 34  GLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLE 93
           G+EGAAFQSRLP+D+MT+ E   FPDI + P  + K FL IRNR LQ+WL+NPK+QLT E
Sbjct: 174 GVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFE 233

Query: 94  FVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLA 153
             +Q++E+P+NS+  LV R+H YLERHG INFGI++RI P+P+KK+GKVI+IG+G+SGLA
Sbjct: 234 ATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGKVIIIGSGVSGLA 293

Query: 154 AARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINME 213
           AAR ++ FG++V +LEAR+RVGGR+ TF+K NYVADLGAMVVTGLGGNP+ ++++Q+NME
Sbjct: 294 AARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNME 353

Query: 214 LLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLS 273
           L KI  +CPLY+++ +      VPK+KD++VE+EFNRLLE TSYLSH LDFN L  KP+S
Sbjct: 354 LAKIKQKCPLYEANGQ-----AVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVS 408

Query: 274 L-------------------------VIELQEELKPVLSRMNEILVQLDTLDQTLQNV-- 306
           L                         +++ QEELK +L++M  +  ++  L Q  +    
Sbjct: 409 LGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASE 468

Query: 307 --PIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDR 364
             P  + TA EF  +S  RD+  LC EYD+L E + +L+ KL  +E+NPP+DVYLS +DR
Sbjct: 469 VKPPRDITA-EFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDR 527

Query: 365 QLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHF 424
           Q+LDWHFANLEFANATPL++LSLKHWDQDDDFEFTGSHLTV+ GY+CVP ALAEGLD+  
Sbjct: 528 QILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKL 587

Query: 425 NSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPL 484
           N++V ++ Y + G  V  V+ ++     +Y  D VLCTLPLG+LK   Q P  V F PPL
Sbjct: 588 NTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLK---QQPPAVQFVPPL 644

Query: 485 PDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVL 544
           P+WK  +++R+G+G LNKVVLCFD++FWDP+ NLFGHVGSTTASRGELFLFWNLY+AP+L
Sbjct: 645 PEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPIL 704

Query: 545 LALVAGEAASILEDVS--------------IFPTNTVPQPKETVVTRWKADPFAKGSYSF 590
           LALVAGEAA I+E++S              IF ++ VPQPKETVV+RW+ADP+A+GSYS+
Sbjct: 705 LALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSY 764

Query: 591 VAVGASGSDYDTLGLPVKDD-------KDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGG 643
           VA G+SG+DYD +  P+          + IPRLFFAGEHTIRNYPATVHGA LSGL+E G
Sbjct: 765 VAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAG 824

Query: 644 HIVDQILGANYRMP 657
            I DQ LGA Y +P
Sbjct: 825 RIADQFLGAMYTLP 838
Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me. May play a role in the repression of neuronal genes. Alone, it is unable to demethylate H3K4me on nucleosomes and requires the presence of RCOR1/CoREST to achieve such activity. Also acts as a coactivator of androgen receptor (ANDR)-dependent transcription, by being recruited to ANDR target genes and mediating demethylation of H3K9me, a specific tag for epigenetic transcriptional repression. The presence of PRKCB in ANDR-containing complexes, which mediates phosphorylation of 'Thr-6' of histone H3 (H3T6ph), a specific tag that prevents demethylation H3K4me, prevents H3K4me demethylase activity of KDM1A. Demethylates di-methylated 'Lys-370' of p53/TP53 which prevents interaction of p53/TP53 with TP53BP1 and represses p53/TP53-mediated transcriptional activation (By similarity). Demethylates and stabilizes the DNA methylase DNMT1. Required for gastrulation during embryogenesis. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 Back     alignment and function description
>sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 Back     alignment and function description
>sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 Back     alignment and function description
>sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 Back     alignment and function description
>sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
327280528 896 PREDICTED: lysine-specific histone demet 0.936 0.690 0.578 0.0
116487644 848 Aof2 protein [Danio rerio] 0.944 0.735 0.575 0.0
339715214 833 lysine-specific histone demethylase 1A [ 0.937 0.744 0.577 0.0
71052047 876 AOF2 protein [Homo sapiens] 0.936 0.706 0.575 0.0
388454136 876 lysine (K)-specific demethylase 1A [Maca 0.936 0.706 0.575 0.0
348544265 827 PREDICTED: lysine-specific histone demet 0.945 0.755 0.570 0.0
397485786 876 PREDICTED: lysine-specific histone demet 0.936 0.706 0.575 0.0
58761544 876 lysine-specific histone demethylase 1A i 0.936 0.706 0.575 0.0
296206994 876 PREDICTED: lysine-specific histone demet 0.936 0.706 0.575 0.0
395821039 877 PREDICTED: lysine-specific histone demet 0.936 0.705 0.575 0.0
>gi|327280528|ref|XP_003225004.1| PREDICTED: lysine-specific histone demethylase 1A-like [Anolis carolinensis] Back     alignment and taxonomy information
 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/674 (57%), Positives = 505/674 (74%), Gaps = 55/674 (8%)

Query: 34  GLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLE 93
           G+EGAAFQSRLP+D+MT+ E   FPDI + P  + K FL+IRNR LQ+WL+NPK+QLT E
Sbjct: 213 GVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLYIRNRTLQLWLDNPKIQLTFE 272

Query: 94  FVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLA 153
             +Q++ESP+NS+  LV R+H YLERHG INFGI++R+ P+P KK+GKVI+IG+G+SGLA
Sbjct: 273 ATLQQLESPYNSDTVLVHRVHSYLERHGLINFGIYKRVKPLPTKKTGKVIIIGSGVSGLA 332

Query: 154 AARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINME 213
           AAR ++ FG++V +LEAR+RVGGR+ TF+K NYVADLGAMVVTGLGGNP+ ++++Q+NME
Sbjct: 333 AARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNME 392

Query: 214 LLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLS 273
           L KI  +CPLY+++ + +DN+QVPK+KD++VE+EFNRLLE TSYLSH LDFN L  KP+S
Sbjct: 393 LAKIKQKCPLYEANGQ-ADNVQVPKEKDEMVEQEFNRLLEATSYLSHQLDFNILNNKPVS 451

Query: 274 L-------------------------VIELQEELKPVLSRMNEILVQLDTLDQTLQNV-- 306
           L                         +++ QEELK +L++M  +  ++  L Q  +    
Sbjct: 452 LGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKDLLNKMVNLKEKIKELHQQYKEASE 511

Query: 307 --PIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDR 364
             P  + TA EF  +S  RD+  LC EYD+L E + +L+ KL  +E+NPP+DVYLS +DR
Sbjct: 512 VKPPRDITA-EFLVKSKHRDLTALCKEYDELAETQAKLEEKLQELEANPPSDVYLSSRDR 570

Query: 365 QLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHF 424
           Q+LDWHFANLEFANATPL++LSLKHWDQDDDFEFTGSHLTV+ GY+CVP ALAEGLD+  
Sbjct: 571 QILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKL 630

Query: 425 NSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPL 484
           N++V ++ Y + G  V  V+ ++     +Y  D VLCTLPLG+LK   Q P  V F PPL
Sbjct: 631 NTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLK---QQPPAVQFVPPL 687

Query: 485 PDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVL 544
           P+WK  +++R+G+G LNKVVLCFD++FWDP+ NLFGHVGSTTASRGELFLFWNLY+AP+L
Sbjct: 688 PEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPIL 747

Query: 545 LALVAGEAASILEDVS--------------IFPTNTVPQPKETVVTRWKADPFAKGSYSF 590
           LALVAGEAA I+E++S              IF ++ VPQPKETVV+RW+ADP+A+GSYS+
Sbjct: 748 LALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSY 807

Query: 591 VAVGASGSDYDTLGLPVKDD-------KDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGG 643
           VA G+SG+DYD +  P+          + IPRLFFAGEHTIRNYPATVHGA LSGL+E G
Sbjct: 808 VAAGSSGNDYDLMAQPITPGPAIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAG 867

Query: 644 HIVDQILGANYRMP 657
            I DQ LGA Y +P
Sbjct: 868 RIADQFLGAMYTLP 881

Source: Anolis carolinensis

Species: Anolis carolinensis

Genus: Anolis

Family: Iguanidae

Order: Squamata

Class:

Phylum: Chordata

Superkingdom: Eukaryota
>gi|116487644|gb|AAI25966.1| Aof2 protein [Danio rerio] Back     alignment and taxonomy information
>gi|339715214|ref|NP_001229924.1| lysine-specific histone demethylase 1A [Danio rerio] Back     alignment and taxonomy information
>gi|71052047|gb|AAH40194.3| AOF2 protein [Homo sapiens] Back     alignment and taxonomy information
>gi|388454136|ref|NP_001252568.1| lysine (K)-specific demethylase 1A [Macaca mulatta] gi|402853327|ref|XP_003891348.1| PREDICTED: lysine-specific histone demethylase 1A isoform 2 [Papio anubis] gi|387539882|gb|AFJ70568.1| lysine-specific histone demethylase 1A isoform a [Macaca mulatta] Back     alignment and taxonomy information
>gi|348544265|ref|XP_003459602.1| PREDICTED: lysine-specific histone demethylase 1A-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|397485786|ref|XP_003814021.1| PREDICTED: lysine-specific histone demethylase 1A isoform 2 [Pan paniscus] gi|426328265|ref|XP_004024919.1| PREDICTED: lysine-specific histone demethylase 1A isoform 2 [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|58761544|ref|NP_001009999.1| lysine-specific histone demethylase 1A isoform a [Homo sapiens] Back     alignment and taxonomy information
>gi|296206994|ref|XP_002750454.1| PREDICTED: lysine-specific histone demethylase 1A isoform 1 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|395821039|ref|XP_003783857.1| PREDICTED: lysine-specific histone demethylase 1A isoform 2 [Otolemur garnettii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
ZFIN|ZDB-GENE-030131-7828848 kdm1a "lysine (K)-specific dem 0.509 0.397 0.557 5.4e-195
UNIPROTKB|E2RNL9876 KDM1A "Uncharacterized protein 0.509 0.384 0.560 1e-193
UNIPROTKB|F6S0T5876 KDM1A "Lysine-specific histone 0.509 0.384 0.560 3.4e-193
MGI|MGI:1196256853 Kdm1a "lysine (K)-specific dem 0.509 0.395 0.560 3.4e-193
UNIPROTKB|F1LVQ3735 Kdm1 "Protein Kdm1" [Rattus no 0.509 0.458 0.560 3.4e-193
UNIPROTKB|J9P3A3853 KDM1A "Uncharacterized protein 0.509 0.395 0.560 7e-193
UNIPROTKB|O60341852 KDM1A "Lysine-specific histone 0.509 0.395 0.560 7e-193
UNIPROTKB|F1STX7853 KDM1A "Uncharacterized protein 0.509 0.395 0.560 9e-193
RGD|1562975755 Kdm1a "lysine (K)-specific dem 0.509 0.446 0.560 2.4e-192
UNIPROTKB|F1NDF4755 KDM1A "Uncharacterized protein 0.509 0.446 0.560 3e-192
ZFIN|ZDB-GENE-030131-7828 kdm1a "lysine (K)-specific demethylase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1039 (370.8 bits), Expect = 5.4e-195, Sum P(2) = 5.4e-195
 Identities = 199/357 (55%), Positives = 258/357 (72%)

Query:   275 VIELQEELKPVLSRM---NEILVXXXXXXXXXXNVPIDNTTAVEFQKRSTRRDMNHLCTE 331
             +++ QEELK +L++M    E +            V        EF  +S  RD+  LC E
Sbjct:   429 IVKTQEELKDLLNKMVTTKEKVKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKE 488

Query:   332 YDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWD 391
             YD+L E + +L+ +L  +E+NPP+DVYLS +DRQ+LDWHFANLEFANATPL++LSLKHWD
Sbjct:   489 YDELVEMQVKLEERLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWD 548

Query:   392 QDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNE 451
             QDDDFEFTGSHLTV+ GY+CVP ALAEGLD+  N++V ++ Y S G  V  V+ ++    
Sbjct:   549 QDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTSSGCEVIAVNTRSTTQT 608

Query:   452 TVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIF 511
              +Y  D VLCTLPLG++K   QPP  V F PPLP+WK  +I+R+G+G LNKVVLCFD++F
Sbjct:   609 FIYKCDAVLCTLPLGVMKQ--QPPA-VQFVPPLPEWKTAAIQRMGFGNLNKVVLCFDRVF 665

Query:   512 WDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVS----------- 560
             WDP+ NLFGHVGSTTASRGELFLFWNLY+AP+LLAL+AGEAA I+E++S           
Sbjct:   666 WDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALMAGEAAGIMENISDDVIVGRCLAI 725

Query:   561 ---IFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIP 614
                IF ++ VPQPKETVV+RW+ADP+A+GSYS+VA G+SG+DYD +  P+     IP
Sbjct:   726 LKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPAIP 782
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0034720 "histone H3-K4 demethylation" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:1900052 "regulation of retinoic acid biosynthetic process" evidence=IGI
UNIPROTKB|E2RNL9 KDM1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6S0T5 KDM1A "Lysine-specific histone demethylase 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1196256 Kdm1a "lysine (K)-specific demethylase 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LVQ3 Kdm1 "Protein Kdm1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3A3 KDM1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O60341 KDM1A "Lysine-specific histone demethylase 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1STX7 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1562975 Kdm1a "lysine (K)-specific demethylase 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDF4 KDM1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZQ88KDM1A_MOUSE1, ., -, ., -, ., -0.57410.93040.7209yesN/A
O60341KDM1A_HUMAN1, ., -, ., -, ., -0.57410.93040.7218yesN/A
Q9VW97LSDA_DROME1, ., -, ., -, ., -0.53010.96670.7179yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3.2LOW CONFIDENCE prediction!
3rd Layer1.5.3.17LOW CONFIDENCE prediction!
3rd Layer1.4.3.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
PLN02976 1713 PLN02976, PLN02976, amine oxidase 1e-109
PLN03000 881 PLN03000, PLN03000, amine oxidase 1e-106
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 3e-89
PLN02529 738 PLN02529, PLN02529, lysine-specific histone demeth 1e-74
PLN02268435 PLN02268, PLN02268, probable polyamine oxidase 9e-74
PLN02328 808 PLN02328, PLN02328, lysine-specific histone demeth 1e-73
PLN02529738 PLN02529, PLN02529, lysine-specific histone demeth 3e-33
PLN02568539 PLN02568, PLN02568, polyamine oxidase 6e-31
PLN02676487 PLN02676, PLN02676, polyamine oxidase 3e-24
pfam0443380 pfam04433, SWIRM, SWIRM domain 5e-18
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 2e-16
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 9e-15
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 9e-13
PLN02676487 PLN02676, PLN02676, polyamine oxidase 2e-12
COG1231450 COG1231, COG1231, Monoamine oxidase [Amino acid tr 8e-12
PLN02568539 PLN02568, PLN02568, polyamine oxidase 9e-11
PRK11883451 PRK11883, PRK11883, protoporphyrinogen oxidase; Re 1e-10
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 4e-09
TIGR02734502 TIGR02734, crtI_fam, phytoene desaturase 6e-09
TIGR02733492 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD 7e-09
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 3e-08
PLN02576496 PLN02576, PLN02576, protoporphyrinogen oxidase 3e-08
TIGR00562462 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase 6e-08
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 1e-07
PRK07233434 PRK07233, PRK07233, hypothetical protein; Provisio 9e-07
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 1e-06
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 2e-06
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 2e-06
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 3e-06
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 3e-06
TIGR02730493 TIGR02730, carot_isom, carotene isomerase 7e-06
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 9e-06
COG3380331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 1e-05
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-05
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit 1e-05
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 4e-05
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydroge 5e-05
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 8e-05
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 8e-05
TIGR03997645 TIGR03997, mycofact_OYE_2, mycofactocin system Fad 8e-05
PRK07208479 PRK07208, PRK07208, hypothetical protein; Provisio 1e-04
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 1e-04
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provi 2e-04
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent gluta 2e-04
PRK08132547 PRK08132, PRK08132, FAD-dependent oxidoreductase; 3e-04
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH 3e-04
PRK127751006 PRK12775, PRK12775, putative trifunctional 2-polyp 4e-04
PLN02612567 PLN02612, PLN02612, phytoene desaturase 4e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 4e-04
smart01002149 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT 5e-04
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 6e-04
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 7e-04
PRK08163396 PRK08163, PRK08163, salicylate hydroxylase; Provis 8e-04
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 0.001
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 0.001
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 0.002
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 0.002
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 0.002
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 0.002
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 0.003
PRK02705459 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl 0.003
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 0.003
PRK14106450 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl 0.003
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 0.003
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 0.004
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.004
pfam01946229 pfam01946, Thi4, Thi4 family 0.004
>gnl|CDD|215527 PLN02976, PLN02976, amine oxidase Back     alignment and domain information 
 Score =  363 bits (932), Expect = e-109
 Identities = 202/548 (36%), Positives = 290/548 (52%), Gaps = 99/548 (18%)

Query: 141  KVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYV-ADLGAMVVTGLG 199
            K+IV+GAG +GL AARH+++ G  V VLEAR R+GGR+ T + S  V  DLGA ++TG+ 
Sbjct: 695  KIIVVGAGPAGLTAARHLQRQGFSVTVLEARSRIGGRVYTDRSSLSVPVDLGASIITGVE 754

Query: 200  GN--------PINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRL 251
             +        P +++  Q+ +EL  +   CPLY          +VP D D+ +E E+N L
Sbjct: 755  ADVATERRPDPSSLICAQLGLELTVLNSDCPLYDVVTGE----KVPADLDEALEAEYNSL 810

Query: 252  LECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNT 311
            L+                  + L++  + E    +S         D L+  L+       
Sbjct: 811  LD-----------------DMVLLVAQKGEHAMKMSLE-------DGLEYALK------- 839

Query: 312  TAVEFQKRSTRRDMNHLCTEYDQ----------LNEKKTQLQAKLHAMESNPPADVYLSV 361
                      RR M     + D+           +   T +       E     DV LS 
Sbjct: 840  ----------RRRMPRPGVDIDETELGNAADDLYDSASTGVDGG--HCEKESKEDV-LSP 886

Query: 362  KDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFE-FTGSHLTVKKGYACVPTALAEGL 420
             +R++++WHFA+LE+  A  L  +SL +W+QDD +  F G+H  +K GY+ V  +LAEGL
Sbjct: 887  LERRVMNWHFAHLEYGCAALLKEVSLPYWNQDDVYGGFGGAHCMIKGGYSNVVESLAEGL 946

Query: 421  DVHFNSSVTEIHYNSKGVTVKTVDPK----TGQNETVYTGDRVLCTLPLGILKACIQPPK 476
            D+H N  VT++ Y SK         K    +  N + + GD VL T+PLG LKA     +
Sbjct: 947  DIHLNHVVTDVSYGSKDAGASGSSRKKVKVSTSNGSEFLGDAVLITVPLGCLKA-----E 1001

Query: 477  DVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFW 536
             + F+PPLPDWK  SI+RLG+G+LNKVVL F ++FWD + + FG     T  RG+ F+FW
Sbjct: 1002 TIKFSPPLPDWKYSSIQRLGFGVLNKVVLEFPEVFWDDSVDYFGATAEETDLRGQCFMFW 1061

Query: 537  NLYQ---APVLLALVAGEAASILEDVS--------------IFPTNTVPQPKETVVTRWK 579
            N+ +   APVL+ALV G+AA   + +S              +F    VP P  +VVT W 
Sbjct: 1062 NVKKTVGAPVLIALVVGKAAIDGQSMSSSDHVNHALMVLRKLFGEALVPDPVASVVTDWG 1121

Query: 580  ADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGL 639
             DPF+ G+YS+VA+GASG DYD LG PV++      LFFAGE T + +P TV GA +SGL
Sbjct: 1122 RDPFSYGAYSYVAIGASGEDYDILGRPVENC-----LFFAGEATCKEHPDTVGGAMMSGL 1176

Query: 640  KEGGHIVD 647
            +E   I+D
Sbjct: 1177 REAVRIID 1184

Length = 1713
>gnl|CDD|178578 PLN03000, PLN03000, amine oxidase Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase Back     alignment and domain information
>gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|203011 pfam04433, SWIRM, SWIRM domain Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase Back     alignment and domain information
>gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase Back     alignment and domain information
>gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase Back     alignment and domain information
>gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|131777 TIGR02730, carot_isom, carotene isomerase Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237225 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 Back     alignment and domain information
>gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|236158 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235059 PRK02705, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184511 PRK14106, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 661
PLN03000 881 amine oxidase 100.0
PLN02328 808 lysine-specific histone demethylase 1 homolog 100.0
PLN02529 738 lysine-specific histone demethylase 1 100.0
PLN02976 1713 amine oxidase 100.0
KOG0029|consensus501 100.0
KOG0685|consensus498 100.0
PLN02568539 polyamine oxidase 100.0
PLN02268435 probable polyamine oxidase 100.0
PLN02676487 polyamine oxidase 100.0
COG1231450 Monoamine oxidase [Amino acid transport and metabo 100.0
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 100.0
PRK12416463 protoporphyrinogen oxidase; Provisional 100.0
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 100.0
PRK11883451 protoporphyrinogen oxidase; Reviewed 100.0
PLN02576496 protoporphyrinogen oxidase 100.0
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.97
PLN02612567 phytoene desaturase 99.97
PRK07233434 hypothetical protein; Provisional 99.97
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.96
PRK07208479 hypothetical protein; Provisional 99.95
PLN02487569 zeta-carotene desaturase 99.93
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 99.93
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 99.93
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.92
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.91
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.9
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.87
KOG1276|consensus491 99.79
COG2907447 Predicted NAD/FAD-binding protein [General functio 99.79
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.77
COG3349485 Uncharacterized conserved protein [Function unknow 99.74
KOG0399|consensus2142 99.52
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 99.47
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.46
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 99.4
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.37
KOG4254|consensus561 99.34
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.34
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 99.33
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.32
PRK12831464 putative oxidoreductase; Provisional 99.28
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.28
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.23
PRK13977576 myosin-cross-reactive antigen; Provisional 99.22
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.17
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.16
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.16
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.14
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.14
PF0443386 SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM 99.12
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.09
COG2081408 Predicted flavoproteins [General function predicti 99.08
PRK12814652 putative NADPH-dependent glutamate synthase small 99.01
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.0
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.98
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.93
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.91
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.9
PRK10015429 oxidoreductase; Provisional 98.86
PRK13984604 putative oxidoreductase; Provisional 98.85
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.79
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.79
COG0579429 Predicted dehydrogenase [General function predicti 98.78
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.73
PRK10157428 putative oxidoreductase FixC; Provisional 98.61
PRK07588391 hypothetical protein; Provisional 98.58
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.55
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.54
PRK07236386 hypothetical protein; Provisional 98.53
PRK11728393 hydroxyglutarate oxidase; Provisional 98.52
PRK05868372 hypothetical protein; Validated 98.5
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.48
PRK06753373 hypothetical protein; Provisional 98.45
PRK06847375 hypothetical protein; Provisional 98.44
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.43
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.43
PRK08013400 oxidoreductase; Provisional 98.41
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.39
PRK06184502 hypothetical protein; Provisional 98.39
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.38
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.38
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.37
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.37
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.32
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.32
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.31
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.3
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.29
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.29
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.29
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.28
PLN02852491 ferredoxin-NADP+ reductase 98.27
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.27
PRK06834488 hypothetical protein; Provisional 98.25
PRK09897534 hypothetical protein; Provisional 98.25
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.25
KOG1399|consensus448 98.22
PLN02661357 Putative thiazole synthesis 98.19
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.18
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.18
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.14
PTZ00188506 adrenodoxin reductase; Provisional 98.14
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.14
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.1
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 98.04
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.04
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.02
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.99
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.99
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.99
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.99
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.97
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.96
KOG2404|consensus477 97.96
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.95
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.94
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.93
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 97.92
PRK10262321 thioredoxin reductase; Provisional 97.91
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.91
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.9
PRK06116450 glutathione reductase; Validated 97.9
KOG2820|consensus399 97.9
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.89
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.89
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.88
PRK07045388 putative monooxygenase; Reviewed 97.88
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.88
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.87
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.87
PRK08163396 salicylate hydroxylase; Provisional 97.87
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.86
PRK14694468 putative mercuric reductase; Provisional 97.86
PLN02985514 squalene monooxygenase 97.85
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.85
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.83
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.83
PRK06370463 mercuric reductase; Validated 97.82
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.82
PRK09126392 hypothetical protein; Provisional 97.82
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.82
KOG2415|consensus621 97.81
PRK06475400 salicylate hydroxylase; Provisional 97.81
KOG2614|consensus420 97.8
TIGR02053463 MerA mercuric reductase. This model represents the 97.79
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.79
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.79
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.79
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.78
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.77
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.77
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.76
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.76
PRK07538413 hypothetical protein; Provisional 97.76
PTZ00058561 glutathione reductase; Provisional 97.75
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.75
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.74
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.74
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.74
PRK14727479 putative mercuric reductase; Provisional 97.72
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.72
PRK13748561 putative mercuric reductase; Provisional 97.71
PRK07121492 hypothetical protein; Validated 97.71
PRK08244493 hypothetical protein; Provisional 97.7
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.69
PRK08274466 tricarballylate dehydrogenase; Validated 97.69
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.69
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.69
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.69
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.68
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.67
PRK06185407 hypothetical protein; Provisional 97.67
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.67
PLN02463447 lycopene beta cyclase 97.67
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.66
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.66
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.66
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.66
PTZ00052499 thioredoxin reductase; Provisional 97.65
KOG2960|consensus328 97.64
PRK07190487 hypothetical protein; Provisional 97.63
PRK06126545 hypothetical protein; Provisional 97.62
PRK11445351 putative oxidoreductase; Provisional 97.62
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.62
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.62
PRK12842574 putative succinate dehydrogenase; Reviewed 97.61
PLN02507499 glutathione reductase 97.61
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.6
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.59
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.58
PTZ00367567 squalene epoxidase; Provisional 97.58
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.58
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.57
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.56
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.56
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.55
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.55
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.54
PRK12839572 hypothetical protein; Provisional 97.54
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.53
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.53
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.5
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.49
PLN02546558 glutathione reductase 97.48
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.47
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.46
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 97.46
PLN02464627 glycerol-3-phosphate dehydrogenase 97.45
PRK08294634 phenol 2-monooxygenase; Provisional 97.41
KOG1800|consensus468 97.41
PLN02697529 lycopene epsilon cyclase 97.41
PRK07804541 L-aspartate oxidase; Provisional 97.4
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.4
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 97.4
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 97.4
PF07156368 Prenylcys_lyase: Prenylcysteine lyase; InterPro: I 97.4
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 97.39
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.39
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.37
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.37
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.35
PRK05257494 malate:quinone oxidoreductase; Validated 97.35
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 97.34
PTZ00153659 lipoamide dehydrogenase; Provisional 97.33
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 97.32
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.32
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 97.31
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.31
PRK06175433 L-aspartate oxidase; Provisional 97.31
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.3
PRK08401466 L-aspartate oxidase; Provisional 97.29
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.29
PLN02815594 L-aspartate oxidase 97.28
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 97.27
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.25
PRK06996398 hypothetical protein; Provisional 97.24
PRK07395553 L-aspartate oxidase; Provisional 97.24
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.23
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.23
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.22
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.22
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 97.21
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.21
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.21
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 97.2
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.16
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 97.16
PRK08071510 L-aspartate oxidase; Provisional 97.13
COG3573552 Predicted oxidoreductase [General function predict 97.12
PRK08275554 putative oxidoreductase; Provisional 97.09
PRK09231582 fumarate reductase flavoprotein subunit; Validated 97.08
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.08
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 97.05
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.04
KOG1335|consensus506 97.02
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.0
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.98
PRK09077536 L-aspartate oxidase; Provisional 96.98
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 96.95
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.89
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 96.89
PRK02106560 choline dehydrogenase; Validated 96.84
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.78
COG4716587 Myosin-crossreactive antigen [Function unknown] 96.78
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 96.76
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.72
KOG1298|consensus509 96.71
KOG2844|consensus 856 96.69
PRK07846451 mycothione reductase; Reviewed 96.67
PRK13512438 coenzyme A disulfide reductase; Provisional 96.64
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 96.64
PRK07512513 L-aspartate oxidase; Provisional 96.61
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 96.55
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.54
KOG2853|consensus509 96.5
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.47
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.43
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 96.41
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.39
KOG2852|consensus380 96.38
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 96.35
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.33
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.09
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.03
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 95.74
PLN02785587 Protein HOTHEAD 95.69
KOG1439|consensus440 95.6
KOG2665|consensus453 95.53
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 95.5
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.49
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 95.48
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.44
COG4529474 Uncharacterized protein conserved in bacteria [Fun 95.4
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.34
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 95.23
KOG4716|consensus503 95.2
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 95.05
KOG1279|consensus506 94.95
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 94.95
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 94.88
KOG0405|consensus478 94.75
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 94.72
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.47
KOG0404|consensus322 94.44
PRK05976472 dihydrolipoamide dehydrogenase; Validated 94.43
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.24
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 94.2
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.18
TIGR02053463 MerA mercuric reductase. This model represents the 93.92
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 93.92
PRK06370463 mercuric reductase; Validated 93.88
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 93.83
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 93.79
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 93.77
PRK06292460 dihydrolipoamide dehydrogenase; Validated 93.76
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 93.73
PRK07846451 mycothione reductase; Reviewed 93.69
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.69
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 93.67
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 93.63
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.63
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 93.62
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 93.6
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 93.57
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 93.53
PRK06327475 dihydrolipoamide dehydrogenase; Validated 93.45
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 93.45
PRK13512438 coenzyme A disulfide reductase; Provisional 93.44
KOG3855|consensus481 93.28
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.25
COG0569225 TrkA K+ transport systems, NAD-binding component [ 93.24
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 93.09
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 93.01
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 93.0
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.94
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 92.8
PRK12831464 putative oxidoreductase; Provisional 92.77
PRK09564444 coenzyme A disulfide reductase; Reviewed 92.67
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 92.67
PRK07845466 flavoprotein disulfide reductase; Reviewed 92.63
PRK04148134 hypothetical protein; Provisional 92.55
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.54
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.5
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.49
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.44
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 92.35
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 92.25
PRK14989 847 nitrite reductase subunit NirD; Provisional 92.23
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.17
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.14
PTZ00058561 glutathione reductase; Provisional 92.1
PRK06719157 precorrin-2 dehydrogenase; Validated 92.09
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.08
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 92.05
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 92.05
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.97
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.97
PRK10262321 thioredoxin reductase; Provisional 91.92
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.91
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.87
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.84
PRK06116450 glutathione reductase; Validated 91.8
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 91.76
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 91.72
PTZ00153659 lipoamide dehydrogenase; Provisional 91.67
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 91.63
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 91.61
PRK12770352 putative glutamate synthase subunit beta; Provisio 91.6
KOG0042|consensus680 91.59
PLN02507499 glutathione reductase 91.56
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.39
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 91.3
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 91.23
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 91.19
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.18
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 91.15
PRK06249313 2-dehydropantoate 2-reductase; Provisional 90.92
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.91
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.89
PLN02546558 glutathione reductase 90.77
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 90.74
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.68
PRK13748561 putative mercuric reductase; Provisional 90.62
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 90.51
PF14691111 Fer4_20: Dihydroprymidine dehydrogenase domain II, 90.38
PRK14694468 putative mercuric reductase; Provisional 90.37
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.3
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.28
PRK12921305 2-dehydropantoate 2-reductase; Provisional 90.15
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 90.12
PRK14727479 putative mercuric reductase; Provisional 90.11
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 89.99
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 89.88
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 89.8
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.78
PRK08229341 2-dehydropantoate 2-reductase; Provisional 89.66
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.61
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 89.58
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 89.57
KOG3923|consensus342 89.49
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 89.47
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.45
PRK12549284 shikimate 5-dehydrogenase; Reviewed 89.39
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 89.27
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 89.25
PTZ00052499 thioredoxin reductase; Provisional 89.2
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 89.19
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.17
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 89.14
KOG1238|consensus623 89.07
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.06
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.02
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 88.98
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 88.93
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 88.93
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 88.93
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 88.84
PRK11730715 fadB multifunctional fatty acid oxidation complex 88.8
PRK12779944 putative bifunctional glutamate synthase subunit b 88.5
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 88.11
KOG2755|consensus334 87.92
KOG2495|consensus491 87.88
KOG2311|consensus 679 87.81
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 87.62
PTZ00318424 NADH dehydrogenase-like protein; Provisional 87.52
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.45
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 87.39
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 87.29
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 87.24
PTZ00082321 L-lactate dehydrogenase; Provisional 87.19
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.16
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 87.08
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 87.02
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 86.94
PLN02494477 adenosylhomocysteinase 86.93
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 86.87
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 86.86
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 86.68
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 86.63
PRK12548289 shikimate 5-dehydrogenase; Provisional 86.62
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 86.47
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 86.42
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 86.25
PRK12814652 putative NADPH-dependent glutamate synthase small 86.16
KOG4405|consensus547 85.98
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 85.84
PRK07417279 arogenate dehydrogenase; Reviewed 85.82
KOG3851|consensus446 85.81
PRK05562223 precorrin-2 dehydrogenase; Provisional 85.79
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 85.73
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 85.69
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 85.68
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.45
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 85.4
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.38
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 85.37
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 85.33
PLN02172461 flavin-containing monooxygenase FMO GS-OX 85.26
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 85.19
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 84.99
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.98
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 84.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 84.97
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 84.94
PRK06223307 malate dehydrogenase; Reviewed 84.9
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 84.82
PRK15116268 sulfur acceptor protein CsdL; Provisional 84.81
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 84.64
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 84.6
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 84.57
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 84.42
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 84.41
PTZ00075476 Adenosylhomocysteinase; Provisional 84.36
KOG2304|consensus298 84.34
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 84.34
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 84.26
PRK11154708 fadJ multifunctional fatty acid oxidation complex 84.25
PTZ00117319 malate dehydrogenase; Provisional 84.07
COG0281432 SfcA Malic enzyme [Energy production and conversio 84.0
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 83.71
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 83.65
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 83.55
PRK10669558 putative cation:proton antiport protein; Provision 83.53
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 83.39
KOG1335|consensus506 83.36
PRK07502307 cyclohexadienyl dehydrogenase; Validated 83.27
PLN02353473 probable UDP-glucose 6-dehydrogenase 83.23
PRK14027283 quinate/shikimate dehydrogenase; Provisional 83.13
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 83.12
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 82.98
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 82.85
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.71
PRK12550272 shikimate 5-dehydrogenase; Reviewed 82.64
PRK09496453 trkA potassium transporter peripheral membrane com 82.62
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 82.61
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 82.42
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 82.37
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 82.34
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 82.24
>PLN03000 amine oxidase Back     alignment and domain information 
Probab=100.00  E-value=1.6e-81  Score=705.62  Aligned_cols=517  Identities=42%  Similarity=0.712  Sum_probs=427.2

Q ss_pred             HHHHHHcCCCCCCCChhHhhh--ccccccCCccchhHHHHHHHHHHHHHhcCCCCCCCHHHHhccccCCCCcchhhHHHH
Q psy6038          36 EGAAFQSRLPYDKMTTNEVQY--FPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRL  113 (661)
Q Consensus        36 ~~~a~~~~l~~~~~~~~e~~~--~p~~~~~~~~~~~~~l~irn~~~~~~~~np~~~~~~~~~~~~~~~~~~~~~~~~~~~  113 (661)
                      .-.|++++||+|.|+++|+++  || ++..  ..+..||+|||+||++|..||+.++|.++|.+|++.++   ..++..+
T Consensus        83 ~~~a~~~~~p~d~l~~~e~~~~~~~-~~~~--~~~~~yl~iRN~il~lW~~np~~~~t~~~a~~~~~~~~---~~l~~~~  156 (881)
T PLN03000         83 ALLALTAGFPADSLTEEEIEFGVVP-IVGG--IEQVNYILIRNHIISKWRENISSWVTKEMFLGSIPKHC---SSLLDSA  156 (881)
T ss_pred             HHHHHHcCCCcccCCHHHHhccccC-cccc--cchhhHHHHHHHHHHHHHHCCceeecHHHHhhhcchhH---HHHHHHH
Confidence            467999999999999999888  89 4444  35789999999999999999999999999999998753   4788999


Q ss_pred             HHHHHHhhHHhcCCccccCC--CCCCCCCcEEEEccChHHHHHHHHHHHCCCcEEEEcCCCCCCCceeccCCC----ccc
Q psy6038         114 HCYLERHGYINFGIFQRITP--IPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKS----NYV  187 (661)
Q Consensus       114 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~v~iiG~G~aGl~aa~~l~~~g~~v~v~e~~~~~GG~i~t~~~~----~~~  187 (661)
                      +.||+++||||||+......  +.....++|+|||||++||+||++|.+.|++|+|+|+++++|||++|.+..    +..
T Consensus       157 ~~~L~r~G~in~g~~~~~~~~~~~~~~~~~VvIIGaG~aGL~aA~~L~~~G~~V~VlE~~~riGGRi~T~~~~g~~~~~~  236 (881)
T PLN03000        157 YNYLVTHGYINFGIAQAIKDKFPAQSSKSSVVIVGAGLSGLAAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEANRVGAA  236 (881)
T ss_pred             HHHHHHcCcccHHHHHHHHhhccccCCCCCEEEECccHHHHHHHHHHHHCCCcEEEEEccCcCCCCcceecccCCCCceE
Confidence            99999999999999765432  223457899999999999999999999999999999999999999999865    467


Q ss_pred             cccccEEEeCCCCChhhHHHHhhChhhhhhcCCCcEEecCCCCCCCCcCCCchhhHHHHHHHHHHHHhhhhhcccccccc
Q psy6038         188 ADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYL  267 (661)
Q Consensus       188 ~d~G~~~i~~~~~~~~~~l~~~lgl~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  267 (661)
                      +|+|++|+++..+|++..|++++|++++.....+++|..+|+     .++.+.+..++..++.+++....+..       
T Consensus       237 ~DlGas~i~g~~~npl~~L~~qlgl~l~~~~~~~~ly~~~Gk-----~v~~~~~~~ve~~fn~lLd~~~~lr~-------  304 (881)
T PLN03000        237 ADLGGSVLTGTLGNPLGIIARQLGSSLYKVRDKCPLYRVDGK-----PVDPDVDLKVEVAFNQLLDKASKLRQ-------  304 (881)
T ss_pred             eecCCeEEeCCCccHHHHHHHHcCCceeecCCCCeEEEeCCc-----CCchhhhhhHHHHHHHHHHHHHHHHH-------
Confidence            999999999999999999999999998888778889999998     55554443334444444332221110       


Q ss_pred             cCCCchhHHHHHHHHHHHHHHHHHHHHHhhhhhhhhccCCCCCchhHHHhhhhhhhhHHHHHHHhHHhhHHHHHHHHHHh
Q psy6038         268 EGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLH  347 (661)
Q Consensus       268 ~~~p~s~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~  347 (661)
                                                 .+.       ....+.++ .+++            ..          +.+.+.
T Consensus       305 ---------------------------l~~-------~~~~D~SL-g~aL------------e~----------~~~~~g  327 (881)
T PLN03000        305 ---------------------------LMG-------DVSMDVSL-GAAL------------ET----------FRQVSG  327 (881)
T ss_pred             ---------------------------Hhc-------ccCcCCcH-HHHH------------HH----------HHHHHc
Confidence                                       000       00000000 0100            00          000100


Q ss_pred             hhhcCCCCccccChhhHHHHHHHHhhhhhhcCCCCccccccCCCCCCCccccCCceeeccchhHHHHHHhccCceeeCce
Q psy6038         348 AMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSS  427 (661)
Q Consensus       348 ~~~~~~~~~~~l~~~~~~ll~~~~~~le~~~~~~l~~lsl~~~~~~~~~~~~g~~~~v~gG~~~L~~aLa~~L~I~lnt~  427 (661)
                               .-+...++++++|+++++++.++..++.+++..|+++..+++.|.+++++|||++|+++|++.|+|++|++
T Consensus       328 ---------~~~t~e~~~Ll~w~lanLE~~~as~ls~LSl~~wdqd~~~e~~G~~~~v~GG~~~LieaLa~~L~I~Ln~~  398 (881)
T PLN03000        328 ---------NDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHCFLPGGNGRLVQALAENVPILYEKT  398 (881)
T ss_pred             ---------ccCCHHHHHHHHHHHHHHhcccccCHHHHHHHHhhhcccccCCCceEEeCCCHHHHHHHHHhhCCcccCCc
Confidence                     01234567788999999999999999999999998877777888999999999999999999999999999


Q ss_pred             EEEEEecCCceEEEEeCCCCCCCCeEEEeCEEEEccChhhhhhcCCCCCccccCCCCCHHHHHHHHHcCCccccEEEEEc
Q psy6038         428 VTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCF  507 (661)
Q Consensus       428 V~~I~~~~~gv~V~~~~~~~~~~g~~i~AD~VV~TvP~~vL~~~~~~~~~i~f~P~Lp~~k~~ai~~l~~g~~~Kv~l~f  507 (661)
                      |++|++++++|.|++.       +++++||+||||+|+++|++     +.|.|.|+||++|++||++++||.++||++.|
T Consensus       399 Vt~I~~~~dgV~V~~~-------~~~~~AD~VIvTVPlgVLk~-----~~I~F~PpLP~~K~~AI~rL~~G~l~KViL~F  466 (881)
T PLN03000        399 VQTIRYGSNGVKVIAG-------NQVYEGDMVLCTVPLGVLKN-----GSIKFVPELPQRKLDCIKRLGFGLLNKVAMLF  466 (881)
T ss_pred             EEEEEECCCeEEEEEC-------CcEEEeceEEEcCCHHHHhh-----CceeeCCCCCHHHHHHHHcCCCcceEEEEEEe
Confidence            9999999999988753       35899999999999999997     66999999999999999999999999999999


Q ss_pred             cccccccCCCceeeeccCCCCCCceEEEEec---CCCcEEEEEeccchhhhhhccc--------------CCCC--CCCC
Q psy6038         508 DKIFWDPAENLFGHVGSTTASRGELFLFWNL---YQAPVLLALVAGEAASILEDVS--------------IFPT--NTVP  568 (661)
Q Consensus       508 ~~~fW~~~~~~~g~~~~~~~~~g~~~~~~~~---~~~~vL~~~~~g~~a~~~~~~~--------------~fg~--~~~~  568 (661)
                      +++||+.+.+.||.+......++..+.|++.   .+.++|++|+.|+.|..++.++              +|+.  ..++
T Consensus       467 d~~FW~~d~~~FG~l~~~~~~rg~~~~f~s~sp~~G~pVLvafv~Gd~A~~le~lSdeE~ve~vl~~Lrkifg~~~~~vp  546 (881)
T PLN03000        467 PYVFWSTDLDTFGHLTEDPNYRGEFFLFYSYAPVAGGPLLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINVP  546 (881)
T ss_pred             CCccccCCCCceeEEecCCCCCceeEEEeCCCCCCCCcEEEEEecCchhHHhhcCCHHHHHHHHHHHHHHHhCccccccC
Confidence            9999998878899887655556777777764   3467999999999998887776              7874  3468


Q ss_pred             CCceEEEecCCCCCCCCcccCccCCCCCCcchhhhcCCCCCCCCCCcEEEecccccCcCCcchhHHHHHHHHHHHHHHHH
Q psy6038         569 QPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQ  648 (661)
Q Consensus       569 ~p~~~~~~~W~~dp~~~Gsys~~~~g~~~~~~~~la~p~~~~~~~~rl~FAGe~t~~~~~gtv~GA~~SG~raA~~i~~~  648 (661)
                      +|..+.+++|.+|||++|||+|+.||+.+.+++.|++|+.    .+|||||||||+..|+||||||++||+|||.+|++.
T Consensus       547 ~Pv~~ivtrW~~DPysrGSYS~~~pG~~~~~~d~LaePv~----~GRIfFAGEaTs~~~~GTVhGAieSGlRAA~eIl~~  622 (881)
T PLN03000        547 DPLQTVCTRWGGDPFSLGSYSNVAVGASGDDYDILAESVG----DGRLFFAGEATTRRYPATMHGAFVTGLREAANMAQS  622 (881)
T ss_pred             CceEEEEccCCCCCCCCccccCCCCCCchHHHHHHhCcCC----CCcEEEeehHHhCCCCeeHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999983    479999999999999999999999999999999999


Q ss_pred             hhcC
Q psy6038         649 ILGA  652 (661)
Q Consensus       649 ~~g~  652 (661)
                      +...
T Consensus       623 l~~~  626 (881)
T PLN03000        623 AKAR  626 (881)
T ss_pred             hhhc
Confidence            8764

>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF04433 SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in eukaryotic chromosomal proteins Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG4716 Myosin-crossreactive antigen [Function unknown] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>KOG1279|consensus Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF14691 Fer4_20: Dihydroprymidine dehydrogenase domain II, 4Fe-4S cluster; PDB: 2VDC_G 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
2x0l_A734 Crystal Structure Of A Neuro-Specific Splicing Vari 0.0
2xaf_A852 Crystal Structure Of Lsd1-Corest In Complex With Pa 0.0
2v1d_A730 Structural Basis Of Lsd1-Corest Selectivity In Hist 0.0
2iw5_A666 Structural Basis For Corest-dependent Demethylation 0.0
2hko_A664 Crystal Structure Of Lsd1 Length = 664 0.0
2h94_A664 Crystal Structure And Mechanism Of Human Lysine-Spe 0.0
2ejr_A662 Lsd1-Tranylcypromine Complex Length = 662 0.0
2dw4_A660 Crystal Structure Of Human Lsd1 At 2.3 A Resolution 0.0
4fwe_A796 Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup 3e-45
4gu1_A784 Crystal Structure Of Lsd2 Length = 784 3e-45
4gur_A776 Crystal Structure Of Lsd2-npac With H3 In Space Gro 3e-45
2com_A124 The Solution Structure Of The Swirm Domain Of Human 9e-36
1b37_A472 A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys 8e-33
2l3d_A102 The Solution Structure Of The Short Form Swirm Doma 1e-32
3kpf_A478 X-Ray Structure Of The Mutant Lys300met Of Polyamin 4e-32
4e0v_A497 Structure Of L-Amino Acid Oxidase From The B. Jarar 8e-12
1reo_A486 L-Amino Acid Oxidase From Agkistrodon Halys Pallas 1e-09
2z5y_A513 Crystal Structure Of Human Monoamine Oxidase A (G11 2e-09
2bxr_A527 Human Monoamine Oxidase A In Complex With Clorgylin 2e-09
2z5x_A513 Crystal Structure Of Human Monoamine Oxidase A With 2e-09
1yy5_A513 Crystal Structure Of Fms1, A Polyamine Oxidase From 4e-09
4ech_A516 Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 4e-09
1z6l_A516 Crystal Structure Of Fms1 In Complex With Its Subst 4e-09
4gdp_A516 Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 4e-09
1o5w_A534 The Structure Basis Of Specific Recognitions For Su 1e-08
3kve_A486 Structure Of Native L-Amino Acid Oxidase From Viper 1e-08
1sez_A504 Crystal Structure Of Protoporphyrinogen Ix Oxidase 9e-08
1f8r_A498 Crystal Structure Of L-Amino Acid Oxidase From Call 2e-07
1rsg_A516 Crystal Structure Of The Polyamine Oxidase Fms1 Fro 2e-07
1rsg_A516 Crystal Structure Of The Polyamine Oxidase Fms1 Fro 8e-06
2bk4_A520 Human Monoamine Oxidase B: I199f Mutant In Complex 8e-07
2xfo_A520 Tranylcypromine-Inhibited Human Monoamine Oxidase B 8e-07
2xfu_A519 Human Monoamine Oxidase B With Tranylcypromine Leng 8e-07
2c76_A520 Functional Role Of The Aromatic Cage In Human Monoa 8e-07
1gos_A520 Human Monoamine Oxidase B Length = 520 8e-07
3zyx_A519 Crystal Structure Of Human Monoamine Oxidase B In C 8e-07
2c72_A520 Functional Role Of The Aromatic Cage In Human Monoa 8e-07
2c75_A520 Functional Role Of The Aromatic Cage In Human Monoa 8e-07
2c73_A520 Functional Role Of The Aromatic Cage In Human Monoa 8e-07
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 9e-07
3rha_A482 The Crystal Structure Of Oxidoreductase From Arthro 8e-04
2yg6_A453 Structure-Based Redesign Of Cofactor Binding In Put 1e-06
3i6d_A470 Crystal Structure Of Ppo From Bacillus Subtilis Wit 6e-06
2yg5_A453 Structure-Based Redesign Of Cofactor Binding In Put 7e-06
2yg7_A453 Structure-Based Redesign Of Cofactor Binding In Put 8e-06
2yg3_A453 Structure-Based Redesign Of Cofactor Binding In Put 8e-06
2jae_A489 The Structure Of L-Amino Acid Oxidase From Rhodococ 2e-05
4dgk_A501 Crystal Structure Of Phytoene Desaturase Crti From 4e-05
3lov_A475 Crystal Structure Of Putative Protoporphyrinogen Ox 7e-05
2vvl_A495 The Structure Of Mao-N-D3, A Variant Of Monoamine O 1e-04
2vvl_G495 The Structure Of Mao-N-D3, A Variant Of Monoamine O 1e-04
2vvm_A495 The Structure Of Mao-N-D5, A Variant Of Monoamine O 1e-04
2ivd_A478 Structure Of Protoporphyrinogen Oxidase From Myxoco 1e-04
>pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 Back     alignment and structure 
Iteration: 1

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/677 (57%), Positives = 497/677 (73%), Gaps = 53/677 (7%)
Query: 34  GLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLE 93
           G+EGAAFQSRLP+D+MT+ E   FPDI + P  + K FL IRNR LQ+WL+NPK+QLT E
Sbjct: 51  GVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFE 110
Query: 94  FVMQKIESPFNSEVQLVSRLHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLA 153
             +Q++E+P+NS+  LV R+H YLERHG INFGI++RI P+P KK+GKVI+IG+G+SGLA
Sbjct: 111 ATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLA 170
Query: 154 AARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINME 213
           AAR ++ FG++V +LEAR+RVGGR+ TF+K NYVADLGAMVVTGLGGNP+ ++++Q+NME
Sbjct: 171 AARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNME 230
Query: 214 LLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLS 273
           L KI  +CPLY+++ + +D ++VPK+KD++VE+EFNRLLE TSYLSH LDFN L  KP+S
Sbjct: 231 LAKIKQKCPLYEANGQ-ADTVKVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVS 289
Query: 274 L-------------------------VIELQEELKPVLSRM---NEILVXXXXXXXXXXN 305
           L                         +++ QEELK +L++M    E +            
Sbjct: 290 LGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASE 349
Query: 306 VPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQ 365
           V        EF  +S  RD+  LC EYD+L E + +L+ KL  +E+NPP+DVYLS +DRQ
Sbjct: 350 VKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQ 409
Query: 366 LLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFN 425
           +LDWHFANLEFANATPL++LSLKHWDQDDDFEFTGSHLTV+ GY+CVP ALAEGLD+  N
Sbjct: 410 ILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLN 469
Query: 426 SSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLP 485
           ++V ++ Y + G  V  V+ ++     +Y  D VLCTLPLG+LK   Q P  V F PPLP
Sbjct: 470 TAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLK---QQPPAVQFVPPLP 526
Query: 486 DWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLL 545
           +WK  +++R+G+G LNKVVLCFD++FWDP+ NLFGHVGSTTASRGELFLFWNLY+AP+LL
Sbjct: 527 EWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILL 586
Query: 546 ALVAGEAASILEDVS--------------IFPTNTVPQPKETVVTRWKADPFAKGSYSFV 591
           ALVAGEAA I+E++S              IF ++ VPQPKETVV+RW+ADP+A+GSYS+V
Sbjct: 587 ALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYV 646
Query: 592 AVGASGSDYDTLGLPVKDD-------KDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGH 644
           A G+SG+DYD +  P+          + IPRLFFAGEHTIRNYPATVHGA LSGL+E G 
Sbjct: 647 AAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGR 706
Query: 645 IVDQILGANYRMPGGKT 661
           I DQ LGA Y +P   T
Sbjct: 707 IADQFLGAMYTLPRQAT 723
>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 Back     alignment and structure
>pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 Back     alignment and structure
>pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 Back     alignment and structure
>pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 Back     alignment and structure
>pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 Back     alignment and structure
>pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 Back     alignment and structure
>pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 Back     alignment and structure
>pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 Back     alignment and structure
>pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 Back     alignment and structure
>pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 Back     alignment and structure
>pdb|2COM|A Chain A, The Solution Structure Of The Swirm Domain Of Human Lsd1 Length = 124 Back     alignment and structure
>pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 Back     alignment and structure
>pdb|2L3D|A Chain A, The Solution Structure Of The Short Form Swirm Domain Of Lsd1 Length = 102 Back     alignment and structure
>pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 Back     alignment and structure
>pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 Back     alignment and structure
>pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 Back     alignment and structure
>pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 Back     alignment and structure
>pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 Back     alignment and structure
>pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 Back     alignment and structure
>pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 Back     alignment and structure
>pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 Back     alignment and structure
>pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 Back     alignment and structure
>pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 Back     alignment and structure
>pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 Back     alignment and structure
>pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 Back     alignment and structure
>pdb|1SEZ|A Chain A, Crystal Structure Of Protoporphyrinogen Ix Oxidase Length = 504 Back     alignment and structure
>pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From Calloselasma Rhodostoma Complexed With Citrate Length = 498 Back     alignment and structure
>pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 Back     alignment and structure
>pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 Back     alignment and structure
>pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 Back     alignment and structure
>pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 Back     alignment and structure
>pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 Back     alignment and structure
>pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 Back     alignment and structure
>pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 Back     alignment and structure
>pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure
>pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 Back     alignment and structure
>pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 Back     alignment and structure
>pdb|3I6D|A Chain A, Crystal Structure Of Ppo From Bacillus Subtilis With Af Length = 470 Back     alignment and structure
>pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 Back     alignment and structure
>pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 Back     alignment and structure
>pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 Back     alignment and structure
>pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus Opacus In The Unbound State Length = 489 Back     alignment and structure
>pdb|4DGK|A Chain A, Crystal Structure Of Phytoene Desaturase Crti From Pantoea Ananatis Length = 501 Back     alignment and structure
>pdb|3LOV|A Chain A, Crystal Structure Of Putative Protoporphyrinogen Oxidase (Yp_001813199.1) From Exiguobacterium Sp. 255-15 At 2.06 A Resolution Length = 475 Back     alignment and structure
>pdb|2VVL|A Chain A, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 Back     alignment and structure
>pdb|2VVL|G Chain G, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger Length = 495 Back     alignment and structure
>pdb|2VVM|A Chain A, The Structure Of Mao-N-D5, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 Back     alignment and structure
>pdb|2IVD|A Chain A, Structure Of Protoporphyrinogen Oxidase From Myxococcus Xanthus With Acifluorfen Length = 478 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 0.0
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 0.0
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 1e-102
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 5e-94
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 5e-90
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 3e-88
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 5e-87
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 4e-27
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 1e-85
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 3e-81
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-67
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 3e-25
2dce_A111 KIAA1915 protein; swirm domain, structural genomic 4e-22
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 7e-21
2fq3_A104 Transcription regulatory protein SWI3; four-helix 1e-20
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 9e-18
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 8e-16
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 1e-15
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 1e-15
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 5e-04
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 2e-15
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 4e-14
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 7e-14
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 9e-14
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 4e-04
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 1e-13
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 2e-13
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 3e-12
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 5e-12
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 8e-10
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 2e-09
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 3e-09
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 3e-08
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 5e-08
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 5e-08
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 7e-08
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 9e-08
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 1e-07
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 3e-07
3dme_A369 Conserved exported protein; structural genomics, P 3e-07
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 3e-07
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 5e-07
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 6e-07
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 7e-07
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 9e-07
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 2e-06
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 2e-06
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 3e-06
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 3e-06
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 3e-06
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 3e-06
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 4e-06
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 4e-06
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 4e-06
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 5e-06
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 6e-06
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 7e-06
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 1e-05
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 1e-05
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 1e-05
3atr_A453 Conserved archaeal protein; saturating double bond 1e-05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 2e-05
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 3e-05
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 3e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 4e-05
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 4e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 4e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 5e-05
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 6e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 6e-05
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 7e-05
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 7e-05
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 9e-05
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 9e-05
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-04
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 1e-04
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 2e-04
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 2e-04
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 2e-04
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 2e-04
2gqf_A401 Hypothetical protein HI0933; structural genomics, 2e-04
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 3e-04
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 3e-04
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 3e-04
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 3e-04
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 3e-04
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 3e-04
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 4e-04
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 5e-04
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 5e-04
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 5e-04
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 9e-04
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 Back     alignment and structure
 Score =  622 bits (1604), Expect = 0.0
 Identities = 379/702 (53%), Positives = 490/702 (69%), Gaps = 57/702 (8%)

Query: 5   EENSNGTISSVAKTEGDVYDEDIEYHIPEGLEGAAFQSRLPYDKMTTNEVQYFPDISNNP 64
           +      +           + + E   P G+EGAAFQSRLP+D+MT+ E   FPDI + P
Sbjct: 144 KAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGP 203

Query: 65  IHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSRLHCYLERHGYIN 124
             + K FL IRNR LQ+WL+NPK+QLT E  +Q++E+P+NS+  LV R+H YLERHG IN
Sbjct: 204 QQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLIN 263

Query: 125 FGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKS 184
           FGI++RI P+P KK+GKVI+IG+G+SGLAAAR ++ FG++V +LEAR+RVGGR+ TF+K 
Sbjct: 264 FGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKG 323

Query: 185 NYVADLGAMVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLV 244
           NYVADLGAMVVTGLGGNP+ ++++Q+NMEL KI  +CPLY      ++   VPK+KD++V
Sbjct: 324 NYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLY-----EANGQAVPKEKDEMV 378

Query: 245 EREFNRLLECTSYLSHTLDFNYLEGKPLSLVIELQEELKPVLSRMNEILVQLDTLDQTLQ 304
           E+EFNRLLE TSYLSH LDFN L  KP+SL   L+  ++     + +  ++        Q
Sbjct: 379 EQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQ 438

Query: 305 NVPIDNTTAV----------------------------EFQKRSTRRDMNHLCTEYDQLN 336
               +    +                            EF  +S  RD+  LC EYD+L 
Sbjct: 439 EELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELA 498

Query: 337 EKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDF 396
           E + +L+ KL  +E+NPP+DVYLS +DRQ+LDWHFANLEFANATPL++LSLKHWDQDDDF
Sbjct: 499 ETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDF 558

Query: 397 EFTGSHLTVKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTG 456
           EFTGSHLTV+ GY+CVP ALAEGLD+  N++V ++ Y + G  V  V+ ++     +Y  
Sbjct: 559 EFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKC 618

Query: 457 DRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAE 516
           D VLCTLPLG+LK   Q P  V F PPLP+WK  +++R+G+G LNKVVLCFD++FWDP+ 
Sbjct: 619 DAVLCTLPLGVLK---QQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSV 675

Query: 517 NLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVS--------------IF 562
           NLFGHVGSTTASRGELFLFWNLY+AP+LLALVAGEAA I+E++S              IF
Sbjct: 676 NLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVIVGRCLAILKGIF 735

Query: 563 PTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKDDKDI-------PR 615
            ++ VPQPKETVV+RW+ADP+A+GSYS+VA G+SG+DYD +  P+     I       PR
Sbjct: 736 GSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPR 795

Query: 616 LFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILGANYRMP 657
           LFFAGEHTIRNYPATVHGA LSGL+E G I DQ LGA Y +P
Sbjct: 796 LFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLP 837
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure
>2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Length = 104 Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Length = 475 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 100.0
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 100.0
4gut_A776 Lysine-specific histone demethylase 1B; histone de 100.0
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 100.0
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 100.0
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 100.0
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 100.0
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 100.0
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 100.0
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 100.0
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 100.0
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 100.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 100.0
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 100.0
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 100.0
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.98
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.95
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.95
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.95
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.94
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 99.94
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 99.93
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.91
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.91
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 99.9
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 99.83
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.73
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 99.72
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 99.71
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.67
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.65
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 99.61
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 99.6
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 99.58
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.49
2e1m_B130 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.4
2fq3_A104 Transcription regulatory protein SWI3; four-helix 99.35
2dce_A111 KIAA1915 protein; swirm domain, structural genomic 99.3
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.19
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.01
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 98.95
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.9
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.86
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.8
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.77
3dme_A369 Conserved exported protein; structural genomics, P 98.76
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.75
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.74
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.64
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.56
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.55
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.55
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.53
2bry_A497 NEDD9 interacting protein with calponin homology a 98.39
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.36
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.36
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.34
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.33
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.32
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.32
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.31
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.28
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.28
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.26
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.24
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.22
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.2
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.15
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.12
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.08
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.08
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.07
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.06
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.06
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.05
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.05
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.05
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.04
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.04
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.04
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.03
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.01
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.01
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.99
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.98
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.98
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.98
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.98
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.98
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.96
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.96
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.96
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.95
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.94
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.94
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.93
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.92
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.92
4dna_A463 Probable glutathione reductase; structural genomic 97.92
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.92
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.92
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.91
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.91
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.9
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.89
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.89
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.89
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.87
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.87
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.84
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.84
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.84
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.84
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.84
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.84
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.83
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.83
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.83
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.83
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.82
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.82
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.82
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.82
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.81
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 97.8
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.8
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.79
2cul_A232 Glucose-inhibited division protein A-related PROT 97.79
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.78
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.78
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.78
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.78
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.77
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.77
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.77
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.77
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.76
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.76
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.75
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.75
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.75
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.74
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.74
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.74
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.73
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.71
3atr_A453 Conserved archaeal protein; saturating double bond 97.71
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.7
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.7
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.7
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.69
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.69
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.67
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.67
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.65
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.64
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.63
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.63
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.62
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.62
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.6
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.6
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.59
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.59
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.59
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 97.58
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.58
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 97.57
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.57
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.57
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.56
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.56
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.55
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 97.54
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.53
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.52
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.52
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.52
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.49
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.49
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.48
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.46
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.46
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.45
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.45
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.44
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.44
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.42
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 97.4
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.37
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.34
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.34
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.33
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.33
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.32
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.31
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.31
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.28
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.27
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.26
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.26
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.25
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.23
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.21
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.2
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.17
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.12
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.91
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.85
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.74
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.64
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.58
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.34
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.33
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.25
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.23
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.15
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.84
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.78
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.67
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.66
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 95.58
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.3
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 95.22
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 95.12
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.09
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 95.07
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 95.01
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 94.97
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 94.93
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 94.9
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 94.86
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.86
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.8
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.73
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 94.56
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.54
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.47
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 94.3
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 94.29
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 94.27
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 94.19
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 94.16
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 94.02
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.02
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.99
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 93.97
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 93.92
1ojt_A482 Surface protein; redox-active center, glycolysis, 93.88
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 93.85
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 93.82
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 93.8
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 93.7
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 93.56
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.46
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.43
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 93.38
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 93.37
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 93.36
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.35
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 93.25
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 93.24
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.14
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 93.13
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 93.12
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 93.09
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 93.02
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 92.94
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 92.91
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 92.87
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 92.86
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 92.85
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 92.84
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 92.83
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 92.82
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 92.73
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 92.62
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 92.6
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 92.59
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 92.53
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 92.48
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 92.47
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.46
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.43
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.42
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 92.41
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 92.32
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 92.27
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 92.12
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 92.06
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.02
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 91.99
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 91.93
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 91.92
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 91.92
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 91.83
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 91.83
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 91.81
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 91.71
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 91.69
1fec_A490 Trypanothione reductase; redox-active center, oxid 91.68
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 91.67
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 91.61
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 91.51
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 91.49
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 91.48
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 91.45
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 91.36
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 91.29
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 91.28
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 91.24
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 91.21
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 91.07
3r9u_A315 Thioredoxin reductase; structural genomics, center 91.04
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.99
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 90.88
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 90.87
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 90.81
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 90.72
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 90.71
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.7
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 90.69
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 90.62
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.61
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 90.56
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 90.51
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 90.46
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 90.44
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.44
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 90.41
4dna_A463 Probable glutathione reductase; structural genomic 90.34
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 90.24
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.22
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.2
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 90.19
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 90.18
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 90.14
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.12
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.06
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.86
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 89.83
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 89.82
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 89.72
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 89.7
3qha_A296 Putative oxidoreductase; seattle structural genomi 89.6
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 89.46
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 89.46
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 89.43
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 89.42
2rir_A300 Dipicolinate synthase, A chain; structural genomic 89.37
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 89.32
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 89.31
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 89.24
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 89.22
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 89.19
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.17
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 89.16
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.11
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 89.07
4g65_A461 TRK system potassium uptake protein TRKA; structur 88.84
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 88.8
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 88.78
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 88.74
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 88.65
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 88.65
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 88.62
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 88.49
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 88.44
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 88.37
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 88.24
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 88.21
3l6d_A306 Putative oxidoreductase; structural genomics, prot 88.19
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 88.19
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 88.15
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 87.98
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 87.97
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 87.91
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.9
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 87.87
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.79
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 87.78
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 87.64
3tl2_A315 Malate dehydrogenase; center for structural genomi 87.63
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 87.61
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 87.49
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 87.48
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 87.43
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 87.42
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 87.38
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 87.25
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 87.21
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.12
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 87.1
4ezb_A317 Uncharacterized conserved protein; structural geno 87.1
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.08
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 87.01
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 86.98
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 86.97
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 86.96
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 86.88
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 86.87
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 86.87
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 86.68
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 86.65
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 86.62
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 86.55
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 86.54
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 86.47
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 86.34
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 86.31
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 86.24
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 86.16
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 86.16
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 86.14
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 86.12
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 86.03
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 86.02
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 86.01
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 85.96
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 85.88
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 85.8
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 85.72
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 85.68
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 85.68
3ius_A286 Uncharacterized conserved protein; APC63810, silic 85.67
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 85.66
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 85.64
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 85.59
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 85.52
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.39
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 85.33
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 85.32
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 85.3
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 85.13
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 85.07
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 85.01
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 84.93
1vpd_A299 Tartronate semialdehyde reductase; structural geno 84.89
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 84.89
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 84.8
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 84.75
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 84.71
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 84.69
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 84.64
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 84.62
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 84.57
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 84.51
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 84.45
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 84.19
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 84.17
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 84.14
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 83.97
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 83.96
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 83.94
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 83.78
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 83.74
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 83.73
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 83.65
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 83.61
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 83.56
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 83.43
1yb4_A295 Tartronic semialdehyde reductase; structural genom 83.42
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 83.41
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 83.33
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 83.22
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 83.21
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 83.19
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 83.18
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 83.15
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 83.14
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 83.06
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 83.04
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 82.99
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 82.8
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 82.59
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 82.54
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 82.45
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 82.39
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 82.21
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 82.11
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 81.97
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 81.95
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 81.89
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 81.77
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 81.72
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 81.38
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 81.35
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 81.29
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 81.25
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 81.17
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 81.16
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 81.14
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 80.98
4fk1_A304 Putative thioredoxin reductase; structural genomic 80.85
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 80.69
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 80.55
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 80.54
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 80.54
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 81.56
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
Probab=100.00  E-value=8.6e-85  Score=747.73  Aligned_cols=613  Identities=62%  Similarity=1.105  Sum_probs=507.9

Q ss_pred             ccHHHHHHHcCCCCCCCChhHhhhccccccCCccchhHHHHHHHHHHHHHhcCCCCCCCHHHHhccccCCCCcchhhHHH
Q psy6038          33 EGLEGAAFQSRLPYDKMTTNEVQYFPDISNNPIHSHKTFLHIRNRILQMWLENPKVQLTLEFVMQKIESPFNSEVQLVSR  112 (661)
Q Consensus        33 ~~~~~~a~~~~l~~~~~~~~e~~~~p~~~~~~~~~~~~~l~irn~~~~~~~~np~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (661)
                      ++|++||++||||||.|+++|..+|||++++++..++.||+|||+|+++|..||+.++|.++|..++..++..+|+.|+.
T Consensus         1 ~~~~~aa~~~~l~~~~l~~~E~~~~~~~~~~~~~~~~~yl~irn~~~~~w~~~~~~~~~~~~~~~~~~r~~~~~~~~i~~   80 (662)
T 2z3y_A            1 SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHR   80 (662)
T ss_dssp             CHHHHHHHHTTCCTTSCCHHHHHHCHHHHTSCHHHHHHHHHHHHHHHHHHHTCTTBCCCHHHHHHHSCTTGGGCHHHHHH
T ss_pred             ChHHHHHHHcCCCCCCCCHHHHHHhHHHHcCchHHHHHHHHHHHHHHHHHHHCCCcccCHHHHHHhcCCCccCChHHHHH
Confidence            47999999999999999999999999999997778889999999999999999999999999999999888889999999


Q ss_pred             HHHHHHHhhHHhcCCccccCCCCCCCCCcEEEEccChHHHHHHHHHHHCCCcEEEEcCCCCCCCceeccCCCcccccccc
Q psy6038         113 LHCYLERHGYINFGIFQRITPIPVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGA  192 (661)
Q Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~iiG~G~aGl~aa~~l~~~g~~v~v~e~~~~~GG~i~t~~~~~~~~d~G~  192 (661)
                      +++|+.+++++|+|+++...+++..+.++|+|||||++||+||++|++.|++|+|+|+++++||++.+++..+..+|+|+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~viG~G~~gl~~a~~l~~~g~~v~~~e~~~~~gg~~~~~~~~~~~~~~G~  160 (662)
T 2z3y_A           81 VHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGA  160 (662)
T ss_dssp             HHHHHHHTTSSSCSSCBCSSCCCSSCCCEEEEECCBHHHHHHHHHHHHTTCEEEEECSSSSSBTTCCEEEETTEEEESSC
T ss_pred             HHHHHHHHHHHhcCCccccCCCcccCCCeEEEECcCHHHHHHHHHHHHCCCeEEEEecCCCCCCccccccccCchhhcCc
Confidence            99999999999998877654545567899999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCChhhHHHHhhChhhhhhcCCCcEEecCCCCCCCCcCCCchhhHHHHHHHHHHHHhhhhhcccccccccCCCc
Q psy6038         193 MVVTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPL  272 (661)
Q Consensus       193 ~~i~~~~~~~~~~l~~~lgl~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~p~  272 (661)
                      +++++..++++..+.+++++++..+...+.++..+|.     .++.+.+......++.++.+..++.+..++....+.+.
T Consensus       161 ~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~G~-----~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  235 (662)
T 2z3y_A          161 MVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQ-----AVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPV  235 (662)
T ss_dssp             CEECCSBTCHHHHHHHHHTCCEEECCSCCCEECTTSC-----BCCHHHHHHHHHHHHHHHHHHHHHHTTSCCCEETTEEC
T ss_pred             EEEeCCCCchHHHHHHHhCcchhcccccceEEeCCCc-----CCCcchhhhhhHHHHHHHHHHHHHHhcccccccCCCCC
Confidence            9999888899999999999988777767778888888     67766666778889999999988877665544444444


Q ss_pred             hh------HHHHHH-----HHHHH-------HHH-------HHHHHHHhhhhhhhhcc---CCCCCchhHHHhhhhhhhh
Q psy6038         273 SL------VIELQE-----ELKPV-------LSR-------MNEILVQLDTLDQTLQN---VPIDNTTAVEFQKRSTRRD  324 (661)
Q Consensus       273 s~------~i~~~~-----~~~~~-------~~~-------~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~  324 (661)
                      ++      ++...+     +..+.       ...       +.....++..+...+..   ...+.+...++..+....+
T Consensus       236 ~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~~~s~~~~~~~  315 (662)
T 2z3y_A          236 SLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRD  315 (662)
T ss_dssp             BHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCC--------CCTHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhcchhhhHHHHhhhhhhhhhcccccccchhhhhhhhhhh
Confidence            43      111110     00000       001       11111111122222111   1112333456666665566


Q ss_pred             HHHHHHHhHHhhHHHHHHHHHHhhhhcCCCCccccChhhHHHHHHHHhhhhhhcCCCCccccccCCCCCCCccccCCcee
Q psy6038         325 MNHLCTEYDQLNEKKTQLQAKLHAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLT  404 (661)
Q Consensus       325 ~~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~ll~~~~~~le~~~~~~l~~lsl~~~~~~~~~~~~g~~~~  404 (661)
                      +...+++|+.+......+...+..+....+..+|+++.++++++|+++++++.++..+..+|+.+|+++..+.+.|.+++
T Consensus       316 l~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~ls~~~~~~~~~~~~~g~~~~  395 (662)
T 2z3y_A          316 LTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLT  395 (662)
T ss_dssp             HTTTHHHHHHHTHHHHHHHHHHHHHTTSCCCSCSSCHHHHHHHHHHHHHHHHHTTSCGGGBBTTTTTTTGGGCCBSCCEE
T ss_pred             HHHHHhhhhhhhhhhhhHHHHHHHhhccCcccccccHHHHHHHHHHHHHHHHhcCCChhhcCHhhcCCCcccccCCceee
Confidence            66667778777666666777777787888888899999999999999999999999999999999998877788899999


Q ss_pred             eccchhHHHHHHhccCceeeCceEEEEEecCCceEEEEeCCCCCCCCeEEEeCEEEEccChhhhhhcCCCCCccccCCCC
Q psy6038         405 VKKGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPL  484 (661)
Q Consensus       405 v~gG~~~L~~aLa~~L~I~lnt~V~~I~~~~~gv~V~~~~~~~~~~g~~i~AD~VV~TvP~~vL~~~~~~~~~i~f~P~L  484 (661)
                      +++||++|+++|+++++|++|++|++|.+++++|.|++.+....+++++++||+||||+|+++|++.   .+.|.|.|+|
T Consensus       396 ~~gG~~~l~~~La~~l~I~l~~~V~~I~~~~~~v~V~~~~~~~~~~~~~~~Ad~VI~tvP~~vL~~l---~~~i~f~P~L  472 (662)
T 2z3y_A          396 VRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQ---PPAVQFVPPL  472 (662)
T ss_dssp             ETTCTTHHHHHHTTTCEEETTEEEEEEEEETTEEEEEEEESSCTTCEEEEEESEEEECCCHHHHHCS---SCSSEEESCC
T ss_pred             ecCcHHHHHHHHHhcCceecCCeEEEEEECCCcEEEEEeecccCCCCeEEEeCEEEECCCHHHHhcc---cCceEEcCCC
Confidence            9999999999999999999999999999999999988765222234678999999999999999971   1247899999


Q ss_pred             CHHHHHHHHHcCCccccEEEEEccccccccCCCceeeeccCCCCCCceEEEEecCCCcEEEEEeccchhhhhhccc----
Q psy6038         485 PDWKVKSIRRLGYGLLNKVVLCFDKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVS----  560 (661)
Q Consensus       485 p~~k~~ai~~l~~g~~~Kv~l~f~~~fW~~~~~~~g~~~~~~~~~g~~~~~~~~~~~~vL~~~~~g~~a~~~~~~~----  560 (661)
                      |++|.+||++++||+++||+|.|+++||+.+...||.+.+....++.++.+|+.++.++|++|+.|..+..++.++    
T Consensus       473 P~~k~~Ai~~l~~g~~~KV~l~f~~~fW~~~~~~~G~l~~~~~~~~~~~~~~~~~~~~vL~~~~~G~~a~~~~~lsdee~  552 (662)
T 2z3y_A          473 PEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISDDVI  552 (662)
T ss_dssp             CHHHHHHHHHSEECCCEEEEEECSSCCSCTTCSEEEECCSSSTTTTEEEEEECCSSSSEEEEEECTHHHHHHTTSCHHHH
T ss_pred             CHHHHHHHHhCCccceeEEEEEcCcccccCCCCceeeecCCCCCCCceeEEEeCCCCCEEEEEeccHhHHHHHhCCHHHH
Confidence            9999999999999999999999999999987788998876666677788888887889999999999988776665    


Q ss_pred             ----------CCCCCCCCCCceEEEecCCCCCCCCcccCccCCCCCCcchhhhcCCCCC-------CCCCCcEEEecccc
Q psy6038         561 ----------IFPTNTVPQPKETVVTRWKADPFAKGSYSFVAVGASGSDYDTLGLPVKD-------DKDIPRLFFAGEHT  623 (661)
Q Consensus       561 ----------~fg~~~~~~p~~~~~~~W~~dp~~~Gsys~~~~g~~~~~~~~la~p~~~-------~~~~~rl~FAGe~t  623 (661)
                                +||....++|..+.+++|.+|||++|||++++||+...+++.|++|+..       ..+.+|||||||||
T Consensus       553 ~~~~l~~L~~~~g~~~~~~p~~~~v~~W~~dp~~~Gsys~~~pg~~~~~~~~l~~p~~~~~~~~~~~~~~grl~FAGe~t  632 (662)
T 2z3y_A          553 VGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHT  632 (662)
T ss_dssp             HHHHHHHHHHHHCTTSSCCCSEEEECCTTTCTTTSSSCEECBTTCCTHHHHHHHCCBCC---------CCCCEEECSGGG
T ss_pred             HHHHHHHHHHHhCCcccCCCceeEEEEECCCCCCCcccccCCCCCchhhHHHHhCcCccccccccccCCCCcEEEEeccc
Confidence                      7887667899999999999999999999999999998899999999842       23458999999999


Q ss_pred             cCcCCcchhHHHHHHHHHHHHHHHHhhcCC
Q psy6038         624 IRNYPATVHGAFLSGLKEGGHIVDQILGAN  653 (661)
Q Consensus       624 ~~~~~gtv~GA~~SG~raA~~i~~~~~g~~  653 (661)
                      +..|+||||||++||+|||.+|++.+.|+|
T Consensus       633 s~~~~g~v~GAi~SG~raA~~i~~~~~g~~  662 (662)
T 2z3y_A          633 IRNYPATVHGALLSGLREAGRIADQFLGAM  662 (662)
T ss_dssp             CTTSTTSHHHHHHHHHHHHHHHHHHHTC--
T ss_pred             cCCCCcCHHHHHHHHHHHHHHHHHHccCCC
Confidence            999999999999999999999999999864
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Back     alignment and structure
>2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 661
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 4e-54
d2dw4a1102 a.4.1.18 (A:172-273) Lysine-specific histone demet 9e-42
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 1e-24
d2dw4a3109 d.16.1.5 (A:655-763) Lysine-specific histone demet 1e-24
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-24
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 5e-22
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 6e-22
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-05
d2fq3a185 a.4.1.18 (A:311-395) Transcription regulatory prot 1e-20
d1b5qa2112 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea 1e-18
d2v5za2112 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H 5e-17
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 9e-15
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 9e-13
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-14
d2iida2113 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan 6e-14
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 4e-13
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-12
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 1e-11
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-10
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 9e-09
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 2e-08
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 3e-08
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-08
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-08
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 7e-08
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 2e-07
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 4e-07
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 7e-07
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 7e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 8e-07
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 9e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 1e-06
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 1e-06
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 3e-06
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 4e-06
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 4e-06
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 8e-06
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 9e-06
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 2e-05
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 2e-05
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 2e-05
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-05
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 3e-05
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 3e-05
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 4e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 6e-05
d1lqta2239 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct 6e-05
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 7e-05
d2jfga193 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D- 8e-05
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 1e-04
d1ps9a3179 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu 1e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 2e-04
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-04
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 5e-04
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 8e-04
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 9e-04
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 0.001
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 0.001
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.001
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 0.001
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 0.001
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 0.002
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 0.002
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 0.003
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 0.003
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 0.003
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  190 bits (481), Expect = 4e-54
 Identities = 200/392 (51%), Positives = 265/392 (67%), Gaps = 36/392 (9%)

Query: 135 PVKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMV 194
           P KK+GKVI+IG+G+SGLAAAR ++ FG++V +LEAR+RVGGR+ TF+K NYVADLGAMV
Sbjct: 1   PTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMV 60

Query: 195 VTGLGGNPINILARQINMELLKIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLEC 254
           VTGLGGNP+ ++++Q+NMEL KI  +CPLY+     ++   VPK+KD++VE+EFNRLLE 
Sbjct: 61  VTGLGGNPMAVVSKQVNMELAKIKQKCPLYE-----ANGQAVPKEKDEMVEQEFNRLLEA 115

Query: 255 TSYLSHTLDFNYLEGKPLSLVIELQ----------------------------EELKPVL 286
           TSYLSH LDFN L  KP+SL   L+                            +EL   +
Sbjct: 116 TSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKM 175

Query: 287 SRMNEILVQLDTLDQTLQNVPIDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKL 346
             + E + +L    +    V        EF  +S  RD+  LC EYD+L E + +L+ KL
Sbjct: 176 VNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKL 235

Query: 347 HAMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVK 406
             +E+NPP+DVYLS +DRQ+LDWHFANLEFANATPL++LSLKHWDQDDDFEFTGSHLTV+
Sbjct: 236 QELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVR 295

Query: 407 KGYACVPTALAEGLDVHFNSSVTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLG 466
            GY+CVP ALAEGLD+  N++V ++ Y + G  V  V+ ++     +Y  D VLCTLPLG
Sbjct: 296 NGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLG 355

Query: 467 ILKACIQPPKDVLFNPPLPDWKVKSIRRLGYG 498
           +LK     P  V F PPLP+WK  +++R+   
Sbjct: 356 VLKQQ---PPAVQFVPPLPEWKTSAVQRMVAA 384
>d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 85 Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Length = 93 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 100.0
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.96
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.96
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.95
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.88
d2dw4a1102 Lysine-specific histone demethylase 1, LSD1 {Human 99.86
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.86
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.75
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.64
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 99.64
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.5
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 99.5
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.48
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 99.35
d2fq3a185 Transcription regulatory protein swi3 {Baker's yea 99.34
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.21
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.13
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.12
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.1
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.98
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.97
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.96
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.86
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.79
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.67
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.67
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.64
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.63
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.6
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.59
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.57
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.56
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.5
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.46
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.44
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.43
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.39
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.36
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.31
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.29
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.25
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.24
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.2
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.18
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.18
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.17
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.17
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.15
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.13
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.12
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.11
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.11
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.1
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.1
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.06
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.98
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.97
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.94
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.93
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.93
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.89
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.88
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.82
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.78
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.77
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.76
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.71
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.71
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.7
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.69
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.65
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.65
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.65
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.61
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.61
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.52
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.51
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 97.5
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.47
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.47
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.45
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.41
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.2
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.2
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.15
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.12
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.08
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.07
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.98
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.95
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.86
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.83
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.81
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.79
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.79
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.66
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.61
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.13
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.13
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 95.97
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.89
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.76
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.64
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.59
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.4
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.28
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.96
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.82
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 94.75
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.67
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.3
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.25
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.18
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.03
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.99
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.95
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.77
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.72
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.67
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.62
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.61
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.51
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.43
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.34
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.06
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.03
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.01
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.0
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 92.99
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.93
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.63
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.62
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.53
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.45
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 92.31
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.13
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.1
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.02
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.02
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.02
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.01
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.99
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 91.95
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.95
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 91.95
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 91.67
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.64
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 91.64
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 91.32
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.31
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.17
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.01
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.81
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.21
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.02
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.99
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.98
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.92
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.53
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.37
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.31
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 89.25
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.03
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 88.7
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.57
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 88.42
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 88.22
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 88.1
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.09
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 88.04
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.89
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.6
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 87.6
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.57
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 87.55
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.52
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.39
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.39
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.23
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 87.14
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 86.7
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 86.57
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 86.54
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 86.51
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.41
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 86.41
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 86.41
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 86.07
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 85.98
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 85.48
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.4
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 84.52
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.49
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 83.53
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 82.21
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 82.04
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.8
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 81.32
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.15
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 80.34
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.7e-33  Score=293.92  Aligned_cols=420  Identities=56%  Similarity=0.988  Sum_probs=249.2

Q ss_pred             CCCCCcEEEEccChHHHHHHHHHHHCCCcEEEEcCCCCCCCceeccCCCccccccccEEEeCCCCChhhHHHHhhChhhh
Q psy6038         136 VKKSGKVIVIGAGISGLAAARHMEQFGIEVVVLEARERVGGRIVTFKKSNYVADLGAMVVTGLGGNPINILARQINMELL  215 (661)
Q Consensus       136 ~~~~~~v~iiG~G~aGl~aa~~l~~~g~~v~v~e~~~~~GG~i~t~~~~~~~~d~G~~~i~~~~~~~~~~l~~~lgl~~~  215 (661)
                      .++..||||||||+|||+||++|+++|++|+|||+++++|||++|++.+|+.+|+|++++++...+++..+++++|+++.
T Consensus         2 ~~~~~kViVIGaG~aGL~aA~~L~~~G~~V~VlEa~~r~GGr~~t~~~~g~~~d~G~~~i~~~~~~~~~~l~~~lgl~~~   81 (449)
T d2dw4a2           2 TKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELA   81 (449)
T ss_dssp             SSCCCEEEEECCBHHHHHHHHHHHHTTCEEEEECSSSSSBTTCCEEEETTEEEESSCCEECCSBTCHHHHHHHHHTCCEE
T ss_pred             CCCCCcEEEECCCHHHHHHHHHHHhCCCCEEEEeCCCCCcccEEEEEeCCEEEECCCEEECCCCCcHHHHHHHHcCCcce
Confidence            45678899999999999999999999999999999999999999999999999999999999888999999999999988


Q ss_pred             hhcCCCcEEecCCCCCCCCcCCCchhhHHHHHHHHHHHHhhhhhcccccccccCCCchh--HHH---------HHHHHHH
Q psy6038         216 KIGHQCPLYQSSAENSDNLQVPKDKDDLVEREFNRLLECTSYLSHTLDFNYLEGKPLSL--VIE---------LQEELKP  284 (661)
Q Consensus       216 ~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~p~s~--~i~---------~~~~~~~  284 (661)
                      .......++..+|.     .++..........+..++.....+............+.++  .+.         ..+....
T Consensus        82 ~~~~~~~~~~~~g~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  156 (449)
T d2dw4a2          82 KIKQKCPLYEANGQ-----AVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIE  156 (449)
T ss_dssp             ECCCCCCEECTTSC-----BCCHHHHHHHHHHHHHHHHHHHHHHHTSCCCEETTEECBHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ecCCCceEEecCCc-----EeeccchhhHHHHHHHHHHHHHHHHHHhhhhcccccchhHHHHHHHHHHHhhhhccHHHHH
Confidence            88888889988888     6665555555566666665544443332222222222222  000         0000000


Q ss_pred             HHHHH-------HHHHHHhhhhhhhhccCC----------CCCchhHHHhhhhhhhhHHHHHHHhHHhhHHHHHHHHHHh
Q psy6038         285 VLSRM-------NEILVQLDTLDQTLQNVP----------IDNTTAVEFQKRSTRRDMNHLCTEYDQLNEKKTQLQAKLH  347 (661)
Q Consensus       285 ~~~~~-------~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~  347 (661)
                      .....       ..................          ........+..+......................+.....
T Consensus       157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  236 (449)
T d2dw4a2         157 HWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQ  236 (449)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTC---------------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhhhhhhhhhhhhhhhhhhHHHHHHhhhhhhhcccccccchhhhhhhcchhhhhhhhhheeEEeccceEEeeeEE
Confidence            00000       000000000000000000          0001111122222222222222333333333333333333


Q ss_pred             hhhcCCCCccccChhhHHHHHHHHhhhhhhcCCCCccccccCCCCCCCccccCCceeeccchhHHHHHHhccCceeeCce
Q psy6038         348 AMESNPPADVYLSVKDRQLLDWHFANLEFANATPLASLSLKHWDQDDDFEFTGSHLTVKKGYACVPTALAEGLDVHFNSS  427 (661)
Q Consensus       348 ~~~~~~~~~~~l~~~~~~ll~~~~~~le~~~~~~l~~lsl~~~~~~~~~~~~g~~~~v~gG~~~L~~aLa~~L~I~lnt~  427 (661)
                      ..........................................+.......+.+.......++..+...+...+.+..+..
T Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (449)
T d2dw4a2         237 ELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTA  316 (449)
T ss_dssp             HHTTSCCCSCSSCHHHHHHHHHHHHHHHHHHTSCGGGBBTTTTTTTGGGCCBSCCEEETTCTTHHHHHHHTTCEEECSEE
T ss_pred             eeeeccCcceEEeccccccccccccccccccccccccccccccchhhcccccccccccccchhhhhhhhccccccccccc
Confidence            33333333333333333333332222222222333333334444444445566677788899999999999999999999


Q ss_pred             EEEEEecCCceEEEEeCCCCCCCCeEEEeCEEEEccChhhhhhcCCCCCccccCCCCCHHHHHHHHHcCCccccEEEEEc
Q psy6038         428 VTEIHYNSKGVTVKTVDPKTGQNETVYTGDRVLCTLPLGILKACIQPPKDVLFNPPLPDWKVKSIRRLGYGLLNKVVLCF  507 (661)
Q Consensus       428 V~~I~~~~~gv~V~~~~~~~~~~g~~i~AD~VV~TvP~~vL~~~~~~~~~i~f~P~Lp~~k~~ai~~l~~g~~~Kv~l~f  507 (661)
                      +....+...+..+...............++.++++.++.+|+..   .....+.++++.+..+.+.+..+...       
T Consensus       317 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~-------  386 (449)
T d2dw4a2         317 VRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQ---PPAVQFVPPLPEWKTSAVQRMVAAGS-------  386 (449)
T ss_dssp             EEEEEEETTEEEEEEEESSSTTCEEEEEESEEEECCCHHHHHCS---SCSSEEESCCCHHHHHHHHHSCBTTC-------
T ss_pred             ccccccCCCCcceeeeccccccccchhhhhhHHHHHHHHHHhcc---ccccccCcccccchhhhhhccccccc-------
Confidence            99999888876654433222234677889999999999999872   34467888999888877655432100       


Q ss_pred             cccccccCCCceeeeccCCCCCCceEEEEecCCCcEEEEEeccchhhhhhcccCCCCCCCCCCceEEEecCCCCCCCCcc
Q psy6038         508 DKIFWDPAENLFGHVGSTTASRGELFLFWNLYQAPVLLALVAGEAASILEDVSIFPTNTVPQPKETVVTRWKADPFAKGS  587 (661)
Q Consensus       508 ~~~fW~~~~~~~g~~~~~~~~~g~~~~~~~~~~~~vL~~~~~g~~a~~~~~~~~fg~~~~~~p~~~~~~~W~~dp~~~Gs  587 (661)
                                 .                              +.....+.           .                  
T Consensus       387 -----------~------------------------------~~~~~~~~-----------~------------------  396 (449)
T d2dw4a2         387 -----------S------------------------------GNDYDLMA-----------Q------------------  396 (449)
T ss_dssp             -----------C------------------------------HHHHHHHH-----------C------------------
T ss_pred             -----------c------------------------------cchhhhhc-----------C------------------
Confidence                       0                              00000000           0                  


Q ss_pred             cCccCCCCCCcchhhhcCCCCCCCCCCcEEEecccccCcCCcchhHHHHHHHHHHHHHHHHhhc
Q psy6038         588 YSFVAVGASGSDYDTLGLPVKDDKDIPRLFFAGEHTIRNYPATVHGAFLSGLKEGGHIVDQILG  651 (661)
Q Consensus       588 ys~~~~g~~~~~~~~la~p~~~~~~~~rl~FAGe~t~~~~~gtv~GA~~SG~raA~~i~~~~~g  651 (661)
                           |+.....++.+.+|+      ++||||||||+..|+||||||++||+|||++|++.+.|
T Consensus       397 -----p~~~~~~~~~~~~~~------~~l~fAGe~t~~~~~g~~~GA~~SG~~aA~~Il~~~~G  449 (449)
T d2dw4a2         397 -----PITPGPSIPGAPQPI------PRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLG  449 (449)
T ss_dssp             -----CBCC---------CC------CCEEECSGGGCTTSCSSHHHHHHHHHHHHHHHHHHHTC
T ss_pred             -----CccccccchhhcCCC------CCEEEEcCCcCCCCceehHHHHHHHHHHHHHHHHHhcC
Confidence                 000111122334454      79999999999999999999999999999999999987
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure