Psyllid ID: psy6079


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
ccEEEEcccccEEEccccccccccEEEEEEcccEEEEccccccccccEEEEEEcccccEEEEccccccccccEEEEEcc
cccEEccccccEEEEccccccccccEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEcc
mqssiclhlvFWFPLLLLSYMCLgvgvlepegplyavgghdgwsylntterfdprlrqwsfiapmlsprstagvavlns
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSfiapmlsprstagvavlns
MQSSIClhlvfwfpllllSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
****ICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPML*************
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
iiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSSICLHLVFWFPLLLLSYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
Q9C0H6 718 Kelch-like protein 4 OS=H yes N/A 0.632 0.069 0.660 3e-18
Q96PQ7 755 Kelch-like protein 5 OS=H no N/A 0.683 0.071 0.732 1e-17
Q9NR64 748 Kelch-like protein 1 OS=H no N/A 0.772 0.081 0.597 8e-16
Q9JI74 751 Kelch-like protein 1 OS=M no N/A 0.772 0.081 0.582 2e-15
B4GRJ2 628 Kelch-like protein diablo N/A N/A 0.848 0.106 0.514 5e-11
B4QLQ2 623 Kelch-like protein diablo N/A N/A 0.860 0.109 0.507 5e-11
Q16RL8 589 Kelch-like protein diablo N/A N/A 0.848 0.113 0.514 5e-11
B4J045 624 Kelch-like protein diablo N/A N/A 0.848 0.107 0.514 5e-11
Q2M0J9 628 Kelch-like protein diablo no N/A 0.848 0.106 0.514 5e-11
B4PD06 623 Kelch-like protein diablo N/A N/A 0.848 0.107 0.514 5e-11
>sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 37/56 (66%), Positives = 45/56 (80%)

Query: 24  GVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS 79
           G+GV   EGP+YAVGGHDGWSYLNT ER+DP  RQW+++A M +PRST GV  LN+
Sbjct: 515 GLGVATLEGPMYAVGGHDGWSYLNTVERWDPEGRQWNYVASMSTPRSTVGVVALNN 570





Homo sapiens (taxid: 9606)
>sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KLHL5 PE=2 SV=3 Back     alignment and function description
>sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=1 SV=2 Back     alignment and function description
>sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|B4J045|KLHDB_DROGR Kelch-like protein diablo OS=Drosophila grimshawi GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
326924390 680 PREDICTED: kelch-like protein 4-like, pa 0.632 0.073 0.696 6e-18
118089489 720 PREDICTED: kelch-like protein 4 [Gallus 0.632 0.069 0.696 8e-18
327284153 716 PREDICTED: kelch-like protein 4-like [An 0.632 0.069 0.696 9e-18
355698674 490 kelch-like 5 [Mustela putorius furo] 0.708 0.114 0.754 1e-17
410917478 924 PREDICTED: kelch-like protein 5-like [Ta 0.886 0.075 0.625 3e-17
195129964 655 GI15240 [Drosophila mojavensis] gi|19390 0.873 0.105 0.613 5e-17
195356387 651 GM22425 [Drosophila sechellia] gi|194133 0.873 0.105 0.613 5e-17
28571155 625 CG17754, isoform D [Drosophila melanogas 0.873 0.110 0.613 6e-17
194769420 655 GF19087 [Drosophila ananassae] gi|190618 0.873 0.105 0.613 6e-17
195481650 654 GE17785 [Drosophila yakuba] gi|194189247 0.873 0.105 0.613 6e-17
>gi|326924390|ref|XP_003208411.1| PREDICTED: kelch-like protein 4-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
 Score = 94.7 bits (234), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 39/56 (69%), Positives = 47/56 (83%)

Query: 24  GVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS 79
           G+GV   EGP+YAVGGHDGWSYLNT ER+DP+ RQW+++A M +PRST GVA LNS
Sbjct: 477 GLGVAMLEGPMYAVGGHDGWSYLNTVERWDPQARQWNYVASMSTPRSTVGVAALNS 532




Source: Meleagris gallopavo

Species: Meleagris gallopavo

Genus: Meleagris

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|118089489|ref|XP_420250.2| PREDICTED: kelch-like protein 4 [Gallus gallus] Back     alignment and taxonomy information
>gi|327284153|ref|XP_003226803.1| PREDICTED: kelch-like protein 4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|355698674|gb|AES00876.1| kelch-like 5 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|410917478|ref|XP_003972213.1| PREDICTED: kelch-like protein 5-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|195129964|ref|XP_002009424.1| GI15240 [Drosophila mojavensis] gi|193907874|gb|EDW06741.1| GI15240 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195356387|ref|XP_002044655.1| GM22425 [Drosophila sechellia] gi|194133236|gb|EDW54752.1| GM22425 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|28571155|ref|NP_788894.1| CG17754, isoform D [Drosophila melanogaster] gi|28381596|gb|AAN09249.2| CG17754, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194769420|ref|XP_001966802.1| GF19087 [Drosophila ananassae] gi|190618323|gb|EDV33847.1| GF19087 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195481650|ref|XP_002101723.1| GE17785 [Drosophila yakuba] gi|194189247|gb|EDX02831.1| GE17785 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
UNIPROTKB|F1NIN1 587 KLHL4 "Uncharacterized protein 0.708 0.095 0.696 1.5e-17
UNIPROTKB|Q1EG90 708 Klhl5 "Myocardial ischemic pre 0.696 0.077 0.709 3.4e-17
UNIPROTKB|Q96PQ7 755 KLHL5 "Kelch-like protein 5" [ 0.696 0.072 0.709 3.8e-17
FB|FBgn0030114 654 CG17754 [Drosophila melanogast 0.683 0.082 0.759 6.3e-17
UNIPROTKB|G3X6H8641 KLHL4 "Uncharacterized protein 0.708 0.087 0.660 2.1e-16
UNIPROTKB|D2HZX0 699 KLHL4 "Uncharacterized protein 0.708 0.080 0.660 2.4e-16
UNIPROTKB|F1S1P2 718 KLHL4 "Uncharacterized protein 0.708 0.077 0.660 2.5e-16
UNIPROTKB|Q9C0H6 718 KLHL4 "Kelch-like protein 4" [ 0.708 0.077 0.660 2.5e-16
ZFIN|ZDB-GENE-070410-63567 zgc:162298 "zgc:162298" [Danio 0.670 0.093 0.672 3.5e-16
RGD|1565441 717 Klhl4 "kelch-like family membe 0.708 0.078 0.660 4.2e-16
UNIPROTKB|F1NIN1 KLHL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 223 (83.6 bits), Expect = 1.5e-17, P = 1.5e-17
 Identities = 39/56 (69%), Positives = 47/56 (83%)

Query:    24 GVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS 79
             G+GV   EGP+YAVGGHDGWSYLNT ER+DP+ RQW+++A M +PRST GVA LNS
Sbjct:   384 GLGVAMLEGPMYAVGGHDGWSYLNTVERWDPQARQWNYVASMSTPRSTVGVAALNS 439


GO:0005730 "nucleolus" evidence=IEA
GO:0015630 "microtubule cytoskeleton" evidence=IEA
UNIPROTKB|Q1EG90 Klhl5 "Myocardial ischemic preconditioning associated protein 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PQ7 KLHL5 "Kelch-like protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0030114 CG17754 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6H8 KLHL4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D2HZX0 KLHL4 "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1P2 KLHL4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9C0H6 KLHL4 "Kelch-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-63 zgc:162298 "zgc:162298" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1565441 Klhl4 "kelch-like family member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9C0H6KLHL4_HUMANNo assigned EC number0.66070.63290.0696yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
smart0061247 smart00612, Kelch, Kelch domain 4e-16
pfam0134446 pfam01344, Kelch_1, Kelch motif 6e-10
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-09
pfam1396450 pfam13964, Kelch_6, Kelch motif 7e-04
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 0.003
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.004
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
 Score = 64.5 bits (158), Expect = 4e-16
 Identities = 20/45 (44%), Positives = 28/45 (62%)

Query: 34 LYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLN 78
          +Y VGG DG   L + E +DP   +W+ +  M +PRS  GVAV+N
Sbjct: 2  IYVVGGFDGGQRLKSVEVYDPETNKWTPLPSMPTPRSGHGVAVIN 46


Length = 47

>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
KOG4441|consensus571 99.84
KOG4441|consensus 571 99.83
PHA02713 557 hypothetical protein; Provisional 99.8
PF1396450 Kelch_6: Kelch motif 99.79
PHA02713557 hypothetical protein; Provisional 99.77
PHA02790480 Kelch-like protein; Provisional 99.75
PHA02790 480 Kelch-like protein; Provisional 99.7
PHA03098 534 kelch-like protein; Provisional 99.7
PLN02153 341 epithiospecifier protein 99.69
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.68
PHA03098534 kelch-like protein; Provisional 99.67
PLN02153 341 epithiospecifier protein 99.67
smart0061247 Kelch Kelch domain. 99.66
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.66
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.65
PLN02193 470 nitrile-specifier protein 99.64
PLN02193 470 nitrile-specifier protein 99.63
PF1341549 Kelch_3: Galactose oxidase, central domain 99.63
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.58
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.58
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.56
KOG0379|consensus 482 99.55
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.49
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.49
KOG4693|consensus 392 99.48
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.48
KOG4693|consensus392 99.4
KOG1230|consensus 521 99.33
KOG0379|consensus 482 99.29
PLN02772 398 guanylate kinase 99.13
PF1385442 Kelch_5: Kelch motif 99.12
KOG1230|consensus 521 99.09
KOG4152|consensus 830 99.03
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.82
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.43
KOG4152|consensus 830 98.09
PF07250 243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.0
smart0061247 Kelch Kelch domain. 97.82
KOG2437|consensus 723 97.53
PF1341549 Kelch_3: Galactose oxidase, central domain 97.28
KOG2437|consensus 723 97.12
PF1396450 Kelch_6: Kelch motif 96.97
PLN02772 398 guanylate kinase 96.97
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 96.43
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 96.38
TIGR01640 230 F_box_assoc_1 F-box protein interaction domain. Th 95.92
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 95.83
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 95.37
PF12768 281 Rax2: Cortical protein marker for cell polarity 95.19
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 89.88
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 88.51
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 85.37
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 81.01
>KOG4441|consensus Back     alignment and domain information
Probab=99.84  E-value=2e-20  Score=118.77  Aligned_cols=75  Identities=43%  Similarity=0.641  Sum_probs=69.6

Q ss_pred             ceecCCCCCeeecCCCc--cceeeeEEECCCCeEEEEcCCCCCC-CCCeEEEEeCCCCcEEeccCCCCCCCceeEEEECC
Q psy6079           3 SSICLHLVFWFPLLLLS--YMCLGVGVLEPEGPLYAVGGHDGWS-YLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS   79 (79)
Q Consensus         3 ~~~~~~~~~W~~~~~~~--r~~~~~~~~~~~~~iyv~GG~~~~~-~~~~~~~yd~~~~~W~~~~~~~~~r~~~~~~~~~~   79 (79)
                      .+|||.+++|+.+++|+  |.+++++++  +++||++||.++.. .++++++|||.+++|+.+++|+.+|..++++++++
T Consensus       399 E~YDp~~~~W~~va~m~~~r~~~gv~~~--~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R~~~g~a~~~~  476 (571)
T KOG4441|consen  399 ECYDPVTNKWTPVAPMLTRRSGHGVAVL--GGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRRSGFGVAVLNG  476 (571)
T ss_pred             EEecCCCCcccccCCCCcceeeeEEEEE--CCEEEEEcCcCCCccccceEEEEcCCCCceeecCCcccccccceEEEECC
Confidence            48999999999999885  788999999  99999999988776 79999999999999999999999999999999875



>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-09
3vng_A 309 Crystal Structure Of Keap1 In Complex With Syntheti 7e-09
1u6d_X 308 Crystal Structure Of The Kelch Domain Of Human Keap 7e-09
2dyh_A 318 Crystal Structure Of The Keap1 Protein In Complexed 2e-08
1x2j_A 316 Structural Basis For The Defects Of Human Lung Canc 2e-08
1zgk_A 308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 4e-08
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 2e-05
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 37/56 (66%) Query: 24 GVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS 79 G G++ G +Y +GG+DG + LN+ E++DP W+ + PM + RS AGVA+LN Sbjct: 152 GAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLND 207
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 2e-22
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-19
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 2e-17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-14
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 5e-12
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 8e-22
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-20
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 5e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-16
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 7e-15
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 6e-12
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-21
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-18
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 6e-15
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 9e-15
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 7e-12
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 2e-19
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-18
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 5e-17
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 1e-15
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 8e-14
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 3e-10
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-19
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 6e-19
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-18
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-13
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 6e-11
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 1e-06
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-18
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 5e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-17
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 4e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-10
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-06
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 4e-09
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 7e-08
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-05
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-04
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 9e-05
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 2e-04
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score = 86.6 bits (215), Expect = 2e-22
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 22  CLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLN 78
            LG  VL   G LYAVGG DG + L++ E ++ +  +W  +APM + RS+ GV V+ 
Sbjct: 101 TLGAAVLN--GLLYAVGGFDGSTGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVG 155


>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 99.77
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.76
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.76
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 99.75
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 99.75
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 99.74
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.74
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.74
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.74
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 99.74
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.73
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 99.72
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.65
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.65
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.61
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.52
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.49
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.45
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 85.73
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 82.56
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=4.4e-18  Score=99.93  Aligned_cols=75  Identities=24%  Similarity=0.277  Sum_probs=66.7

Q ss_pred             ceecCCCCCeeecCCCc--cceeeeEEECCCCeEEEEcCC-CCCCCCCeEEEEeCCCCcEEeccCCCCCCCceeEEEECC
Q psy6079           3 SSICLHLVFWFPLLLLS--YMCLGVGVLEPEGPLYAVGGH-DGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAVLNS   79 (79)
Q Consensus         3 ~~~~~~~~~W~~~~~~~--r~~~~~~~~~~~~~iyv~GG~-~~~~~~~~~~~yd~~~~~W~~~~~~~~~r~~~~~~~~~~   79 (79)
                      .+||+.+++|+.++++|  |..++++++  +++||++||. .+....+++++||+.+++|+.+++||.+|..|+++++++
T Consensus       120 ~~~d~~~~~W~~~~~~p~~r~~~~~~~~--~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~  197 (315)
T 4asc_A          120 MCYDRLSFKWGESDPLPYVVYGHTVLSH--MDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTARSLFGATVHDG  197 (315)
T ss_dssp             EEEETTTTEEEECCCCSSCCBSCEEEEE--TTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETT
T ss_pred             EEECCCCCcEeECCCCCCcccceeEEEE--CCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCchhceEEEEECC
Confidence            47999999999998665  788888888  9999999998 445568999999999999999999999999999988764



>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-11
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-07
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-07
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 1e-05
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.7 bits (132), Expect = 1e-11
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 24  GVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAV 76
            +G+   +G +Y +GG+DG ++L++ E +DP    WS +  M S RS  GVAV
Sbjct: 235 ALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV 287


>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.79
d1zgka1 288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.79
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.52
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.32
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=3.8e-19  Score=101.29  Aligned_cols=72  Identities=33%  Similarity=0.587  Sum_probs=65.5

Q ss_pred             ceecCCCCCeeecCCC--ccceeeeEEECCCCeEEEEcCCCCCCCCCeEEEEeCCCCcEEeccCCCCCCCceeEEE
Q psy6079           3 SSICLHLVFWFPLLLL--SYMCLGVGVLEPEGPLYAVGGHDGWSYLNTTERFDPRLRQWSFIAPMLSPRSTAGVAV   76 (79)
Q Consensus         3 ~~~~~~~~~W~~~~~~--~r~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~~~~r~~~~~~~   76 (79)
                      .+||..+++|+.++++  +|..++++++  +++|||+||.++...++++++||+.+++|+.+++||.+|..|++|+
T Consensus       214 ~~~~~~~~~~~~~~~~p~~r~~~~~~~~--~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p~~R~~~~~~~  287 (288)
T d1zgka1         214 ERYDVETETWTFVAPMKHRRSALGITVH--QGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAV  287 (288)
T ss_dssp             EEEETTTTEEEECCCCSSCCBSCEEEEE--TTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECSSCCBSCEEEE
T ss_pred             eeeeecceeeecccCccCcccceEEEEE--CCEEEEEecCCCCeecceEEEEECCCCEEEECCCCCCCcEeEEEEE
Confidence            5789999999999854  4788899999  9999999999887778999999999999999999999999998886



>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure