Psyllid ID: psy6102


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MDKSICKEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
cccccccccccEEEEEEEEccEEEEEEEEEEccccccHHHHHHHHHHHccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccccccccccccEEEEEEEccHHHHHHHHHcccccccccccEEEcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cccccccccccEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHccccEcccccEccccccEccEEEcccEEEEccccccccccccccccccEcccccccccccccEEEEcccccccccEEEEEEccccEEEEEEEcccEEEEEEEEEccEEEEEEEEEEcccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccHcHHHccccccccccccEEEEEEEccHHHHHHHcccccccccccccEEEHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mdksickegnyIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCtgeygkgklgkalhftgshfhriipqfmiqggditnfngtggesiygpcfedenfklkgiypknkypgiyPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLetgrgkeiSRKQYRDLVKKKkkkngifgcvrqgfgvarevsyveaendkplvlNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYnqsqsktqQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCddillmepNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
mdksickegnyivfLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHyynqgalekkrgitehkkkletgrgkeisrkqyrdlvkkkkkkngifgcvrqgfgVAREVSYVEaendkplvlnqMEDVIRTIKNsgneyfklnrmhDAQRKYKKAVRYIKWYnqsqsktqqKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
MDKSICKEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVClfslgsglglglastlvgsYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVkkkkkkNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
****ICKEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGAL**************************************IFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYA*******
************VFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHY***********ITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWY*************SYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAF*****************RMFQ***
MDKSICKEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQS********FRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
********GNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHK******RGKEISRKQYRDLVKKKKKKNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNG*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKSICKEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHxxxxxxxxxxxxxxxxxxxxxHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQNGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query426 2.2.26 [Sep-21-2011]
P52009192 Peptidyl-prolyl cis-trans yes N/A 0.227 0.505 0.721 5e-34
Q9P3X9375 41 kDa peptidyl-prolyl ci N/A N/A 0.258 0.293 0.626 5e-34
Q5B4E7372 Peptidyl-prolyl cis-trans yes N/A 0.204 0.233 0.690 8e-34
Q2U0E0371 Peptidyl-prolyl cis-trans yes N/A 0.223 0.256 0.701 4e-32
Q38867176 Peptidyl-prolyl cis-trans no N/A 0.234 0.568 0.68 4e-32
P73789171 Peptidyl-prolyl cis-trans N/A N/A 0.227 0.567 0.670 5e-32
Q9CR16370 Peptidyl-prolyl cis-trans yes N/A 0.225 0.259 0.711 5e-32
Q6DGG0370 Peptidyl-prolyl cis-trans yes N/A 0.225 0.259 0.711 6e-32
P26882370 Peptidyl-prolyl cis-trans yes N/A 0.225 0.259 0.711 1e-31
P52015171 Peptidyl-prolyl cis-trans no N/A 0.227 0.567 0.690 1e-31
>sp|P52009|CYP1_CAEEL Peptidyl-prolyl cis-trans isomerase 1 OS=Caenorhabditis elegans GN=cyn-1 PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (367), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 76/97 (78%)

Query: 13  VFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIP 72
           VF DVSIGEE  GR+ +ELF  +VPKTAENFRALCTGE G G+ G ALHF GS FHRIIP
Sbjct: 24  VFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIP 83

Query: 73  QFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYP 109
           +FMIQGGD T  NGTGGESIYG  F+DENF LK   P
Sbjct: 84  EFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGP 120




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Caenorhabditis elegans (taxid: 6239)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9P3X9|PPID_NEUCR 41 kDa peptidyl-prolyl cis-trans isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-41 PE=1 SV=1 Back     alignment and function description
>sp|Q5B4E7|PPID_EMENI Peptidyl-prolyl cis-trans isomerase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpr6 PE=3 SV=1 Back     alignment and function description
>sp|Q2U0E0|PPID_ASPOR Peptidyl-prolyl cis-trans isomerase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpr6 PE=3 SV=1 Back     alignment and function description
>sp|Q38867|CP19C_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=2 SV=2 Back     alignment and function description
>sp|P73789|PPI2_SYNY3 Peptidyl-prolyl cis-trans isomerase slr1251 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1251 PE=3 SV=1 Back     alignment and function description
>sp|Q9CR16|PPID_MOUSE Peptidyl-prolyl cis-trans isomerase D OS=Mus musculus GN=Ppid PE=1 SV=3 Back     alignment and function description
>sp|Q6DGG0|PPID_RAT Peptidyl-prolyl cis-trans isomerase D OS=Rattus norvegicus GN=Ppid PE=1 SV=3 Back     alignment and function description
>sp|P26882|PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 Back     alignment and function description
>sp|P52015|CYP7_CAEEL Peptidyl-prolyl cis-trans isomerase 7 OS=Caenorhabditis elegans GN=cyn-7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
383853610376 PREDICTED: peptidyl-prolyl cis-trans iso 0.835 0.946 0.380 2e-60
380026192375 PREDICTED: peptidyl-prolyl cis-trans iso 0.845 0.96 0.386 2e-59
328789580375 PREDICTED: peptidyl-prolyl cis-trans iso 0.845 0.96 0.386 6e-59
340710400376 PREDICTED: peptidyl-prolyl cis-trans iso 0.849 0.962 0.369 9e-59
350415568377 PREDICTED: peptidyl-prolyl cis-trans iso 0.838 0.946 0.369 1e-58
332375905361 unknown [Dendroctonus ponderosae] 0.833 0.983 0.307 4e-46
440640802367 hypothetical protein GMDG_04979 [Geomyce 0.816 0.948 0.297 3e-39
291228525366 PREDICTED: peptidylprolyl isomerase D-li 0.835 0.972 0.310 1e-38
66810482354 tetratricopeptide-like helical domain-co 0.812 0.977 0.302 6e-37
307207304376 40 kDa peptidyl-prolyl cis-trans isomera 0.225 0.255 0.734 2e-35
>gi|383853610|ref|XP_003702315.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  239 bits (611), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 160/420 (38%), Positives = 217/420 (51%), Gaps = 64/420 (15%)

Query: 10  NYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHR 69
           N IVFLD++I  EKVGR+VIELFK +VP+T+ENFRALCTGE G G  GK LH+ GS FH+
Sbjct: 15  NPIVFLDIAIETEKVGRIVIELFKDVVPRTSENFRALCTGEKGIGINGKKLHYKGSIFHK 74

Query: 70  IIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLT 129
           ++PQFMIQGGDI NF+GT GESIYGP FEDENFKL                         
Sbjct: 75  VLPQFMIQGGDIINFDGTSGESIYGPQFEDENFKL------------------------- 109

Query: 130 FTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFTNNCEIHLQRLNVKLRKIEADL 189
                   S  SG   GL S +   Y  S +  F+ T +     HL   NV         
Sbjct: 110 --------SHSSG---GLLSMVNEGYPNSNSSQFIITIS--ASTHLDGTNVVF------- 149

Query: 190 SILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIF----GC 245
                      G + K  G+     ++ET +   + +    D  + K+ +N       G 
Sbjct: 150 -----------GKVLKGMGVILEVSQVETIKDTPVEKVHIIDCGELKQGQNWGMEESDGT 198

Query: 246 VRQGFGVAREVSYVEAENDKPLVLNQMEDVIRTIKNSGNEYFKLNRMHDAQRKYKKAVRY 305
                    + SY    + K L    +  VI  IK+SGN YF      DA RKYKKA+RY
Sbjct: 199 EDTFTPWPEDWSY--CTDHKGLDYKYIIGVIMKIKDSGNHYFLKKHYVDAGRKYKKALRY 256

Query: 306 IKWYNQSQSKTQQKH--FRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKAL 363
            KW  ++            +   A LLN+AAV+LK K Y+  + LC ++L +  NN KAL
Sbjct: 257 YKWMMKTVDVPDHSDTLIMNTKVAILLNLAAVKLKEKNYRDVLKLCTEVLQLNKNNSKAL 316

Query: 364 FRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQ 423
           FRR +A + +N ++ GL D +QAL   PN++ IL+E+  V+  M+ +L +E+ +  RMF+
Sbjct: 317 FRRSQAYMGLNEYDLGLADLKQALLESPNNKDILQEMDKVKTVMKKYLAIERASCQRMFK 376




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380026192|ref|XP_003696840.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Apis florea] Back     alignment and taxonomy information
>gi|328789580|ref|XP_003251298.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340710400|ref|XP_003393779.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415568|ref|XP_003490682.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332375905|gb|AEE63093.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|440640802|gb|ELR10721.1| hypothetical protein GMDG_04979 [Geomyces destructans 20631-21] Back     alignment and taxonomy information
>gi|291228525|ref|XP_002734227.1| PREDICTED: peptidylprolyl isomerase D-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|66810482|ref|XP_638951.1| tetratricopeptide-like helical domain-containing protein [Dictyostelium discoideum AX4] gi|60467577|gb|EAL65598.1| tetratricopeptide-like helical domain-containing protein [Dictyostelium discoideum AX4] Back     alignment and taxonomy information
>gi|307207304|gb|EFN85054.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query426
ZFIN|ZDB-GENE-040625-34371 ppid "peptidylprolyl isomerase 0.218 0.250 0.723 2e-59
UNIPROTKB|P26882370 PPID "Peptidyl-prolyl cis-tran 0.218 0.251 0.723 2.7e-56
MGI|MGI:1914988370 Ppid "peptidylprolyl isomerase 0.218 0.251 0.723 2.3e-52
RGD|1303174370 Ppid "peptidylprolyl isomerase 0.218 0.251 0.723 7.7e-52
UNIPROTKB|E1BXG9370 PPID "Uncharacterized protein" 0.215 0.248 0.709 3.6e-51
UNIPROTKB|F1RTY6370 PPID "Uncharacterized protein" 0.218 0.251 0.723 8.7e-51
TAIR|locus:2044596361 SQN "SQUINT" [Arabidopsis thal 0.215 0.254 0.645 1.1e-50
UNIPROTKB|Q08752370 PPID "Peptidyl-prolyl cis-tran 0.218 0.251 0.723 1.4e-50
UNIPROTKB|E2QTC7372 PPID "Uncharacterized protein" 0.227 0.260 0.704 1.8e-50
FB|FBgn0036020383 CG8336 [Drosophila melanogaste 0.230 0.255 0.612 1.4e-48
ZFIN|ZDB-GENE-040625-34 ppid "peptidylprolyl isomerase D" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 341 (125.1 bits), Expect = 2.0e-59, Sum P(3) = 2.0e-59
 Identities = 68/94 (72%), Positives = 72/94 (76%)

Query:    13 VFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGK-LGKALHFTGSHFHRII 71
             VF DV IG E+VGR+V ELF  +VPKTAENFRALCTGE G GK  GK LHF G  FHRII
Sbjct:    18 VFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRII 77

Query:    72 PQFMIQGGDITNFNGTGGESIYGPCFEDENFKLK 105
               FMIQGGD +N NGTGGESIYG  FEDENF  K
Sbjct:    78 KSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYK 111


GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0016853 "isomerase activity" evidence=IEA
UNIPROTKB|P26882 PPID "Peptidyl-prolyl cis-trans isomerase D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1914988 Ppid "peptidylprolyl isomerase D (cyclophilin D)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1303174 Ppid "peptidylprolyl isomerase D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXG9 PPID "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTY6 PPID "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2044596 SQN "SQUINT" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q08752 PPID "Peptidyl-prolyl cis-trans isomerase D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTC7 PPID "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0036020 CG8336 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52009CYP1_CAEEL5, ., 2, ., 1, ., 80.72160.22760.5052yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.766
4th Layer5.2.1.80.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 2e-53
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 6e-44
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-32
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 8e-24
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 4e-22
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-18
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 4e-18
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 4e-16
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 4e-15
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 8e-15
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 2e-14
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 2e-11
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-11
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-08
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 3e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-08
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-07
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 3e-06
pfam1337173 pfam13371, TPR_9, Tetratricopeptide repeat 1e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 2e-05
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.001
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 0.001
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.002
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
 Score =  175 bits (445), Expect = 2e-53
 Identities = 64/94 (68%), Positives = 72/94 (76%), Gaps = 2/94 (2%)

Query: 12  IVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRII 71
            VF D++IG E  GR+V+ELF  +VPKTAENFRALCTGE  KGK GK   + GS FHR+I
Sbjct: 2   KVFFDITIGGEPAGRIVMELFADVVPKTAENFRALCTGE--KGKGGKPFGYKGSTFHRVI 59

Query: 72  PQFMIQGGDITNFNGTGGESIYGPCFEDENFKLK 105
           P FMIQGGD T  NGTGG+SIYG  F DENFKLK
Sbjct: 60  PDFMIQGGDFTRGNGTGGKSIYGEKFPDENFKLK 93


This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. These enzymes have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. As cyclophilins, Human hCyP-A, human cyclophilin-B (hCyP-19), S. cerevisiae Cpr1 and C. elegans Cyp-3, are inhibited by the immunosuppressive drug cyclopsporin A (CsA). CsA binds to the PPIase active site. Cyp-3. S. cerevisiae Cpr1 interacts with the Rpd3 - Sin3 complex and in addition is a component of the Set3 complex. S. cerevisiae Cpr1 has also been shown to have a role in Zpr1p nuclear transport. Human cyclophilin H associates with the [U4/U6.U5] tri-snRNP particles of the splicesome. Length = 164

>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|205550 pfam13371, TPR_9, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 426
KOG0546|consensus372 100.0
KOG0880|consensus217 100.0
KOG0879|consensus177 100.0
KOG0881|consensus164 100.0
KOG0111|consensus298 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
PTZ00221249 cyclophilin; Provisional 100.0
KOG0883|consensus518 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0882|consensus558 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
KOG0884|consensus161 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0865|consensus167 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 99.98
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 99.98
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 99.97
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.97
KOG0885|consensus439 99.96
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.96
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.94
KOG0415|consensus 479 99.94
KOG0543|consensus397 99.85
KOG0553|consensus304 99.82
KOG4234|consensus271 99.67
KOG0545|consensus329 99.63
PRK15359144 type III secretion system chaperone protein SscB; 99.61
KOG0548|consensus539 99.61
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.57
KOG4648|consensus 536 99.55
KOG0547|consensus 606 99.54
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.52
KOG4626|consensus 966 99.51
KOG0550|consensus 486 99.49
KOG4626|consensus 966 99.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.47
KOG0548|consensus 539 99.43
KOG1126|consensus638 99.42
PRK11189296 lipoprotein NlpI; Provisional 99.42
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.39
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.35
KOG1155|consensus559 99.35
PRK10370198 formate-dependent nitrite reductase complex subuni 99.34
PRK10370198 formate-dependent nitrite reductase complex subuni 99.31
KOG1126|consensus638 99.3
PRK15359144 type III secretion system chaperone protein SscB; 99.29
KOG0551|consensus 390 99.29
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.28
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.27
KOG1155|consensus559 99.26
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.24
PRK12370553 invasion protein regulator; Provisional 99.23
KOG0376|consensus 476 99.23
PRK12370 553 invasion protein regulator; Provisional 99.23
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.22
KOG4642|consensus 284 99.21
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.2
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.18
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.17
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.17
PRK15331165 chaperone protein SicA; Provisional 99.17
KOG0547|consensus 606 99.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.15
PRK11189 296 lipoprotein NlpI; Provisional 99.15
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.14
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.14
KOG0624|consensus 504 99.14
KOG1125|consensus579 99.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.13
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.11
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.1
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.1
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.1
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.08
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.06
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.06
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.06
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.05
PLN02789 320 farnesyltranstransferase 99.05
KOG0624|consensus 504 99.04
PRK11788389 tetratricopeptide repeat protein; Provisional 99.03
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.02
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.02
KOG2076|consensus 895 99.0
KOG1173|consensus611 99.0
PLN02789 320 farnesyltranstransferase 99.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.99
KOG1125|consensus579 98.99
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.99
KOG0553|consensus 304 98.96
KOG0550|consensus 486 98.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.93
PRK10803263 tol-pal system protein YbgF; Provisional 98.92
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.9
KOG4555|consensus175 98.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.89
PF1337173 TPR_9: Tetratricopeptide repeat 98.88
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.86
KOG4162|consensus799 98.86
KOG2003|consensus 840 98.86
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.85
KOG1128|consensus 777 98.81
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.8
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.79
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.79
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.79
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.78
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.77
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.77
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.76
PF13512142 TPR_18: Tetratricopeptide repeat 98.75
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.75
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.74
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.71
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.71
PRK14574 822 hmsH outer membrane protein; Provisional 98.7
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.68
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.66
PF1337173 TPR_9: Tetratricopeptide repeat 98.65
KOG1308|consensus 377 98.63
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.63
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.62
KOG2002|consensus 1018 98.62
PRK11906458 transcriptional regulator; Provisional 98.62
KOG1129|consensus478 98.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.56
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.55
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.54
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.53
KOG1173|consensus611 98.53
KOG3060|consensus289 98.53
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.52
KOG2076|consensus 895 98.51
KOG4162|consensus799 98.5
KOG1840|consensus 508 98.49
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.49
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.48
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.47
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.47
KOG2002|consensus 1018 98.47
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.46
PRK14574 822 hmsH outer membrane protein; Provisional 98.45
KOG1128|consensus 777 98.45
PF12688120 TPR_5: Tetratrico peptide repeat 98.45
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.43
PF12688120 TPR_5: Tetratrico peptide repeat 98.42
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.41
KOG1156|consensus 700 98.41
KOG1310|consensus 758 98.38
KOG1840|consensus508 98.34
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.34
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.34
KOG3060|consensus289 98.32
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.31
PRK10803263 tol-pal system protein YbgF; Provisional 98.29
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.28
PRK15331165 chaperone protein SicA; Provisional 98.25
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
KOG1174|consensus 564 98.21
KOG0543|consensus397 98.21
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.2
KOG2003|consensus 840 98.19
KOG1129|consensus478 98.18
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.17
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.16
PRK11906458 transcriptional regulator; Provisional 98.12
KOG1127|consensus 1238 98.11
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.11
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.11
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.07
KOG1156|consensus 700 98.06
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.06
KOG4648|consensus 536 98.05
KOG0495|consensus 913 98.04
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.99
KOG4555|consensus175 97.99
KOG1174|consensus564 97.98
KOG4234|consensus271 97.97
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.97
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.97
PF1342844 TPR_14: Tetratricopeptide repeat 97.97
PF1342844 TPR_14: Tetratricopeptide repeat 97.97
PF1343134 TPR_17: Tetratricopeptide repeat 97.96
COG4700251 Uncharacterized protein conserved in bacteria cont 97.96
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.95
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.94
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.92
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.91
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.89
KOG1130|consensus 639 97.88
KOG0495|consensus 913 97.85
KOG1127|consensus 1238 97.81
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.8
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.75
KOG3785|consensus 557 97.73
KOG4642|consensus 284 97.73
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.71
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.71
KOG1130|consensus 639 97.62
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.59
KOG3785|consensus 557 97.57
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.53
PRK10941269 hypothetical protein; Provisional 97.52
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.51
PF1343134 TPR_17: Tetratricopeptide repeat 97.49
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.46
KOG2376|consensus 652 97.43
KOG0551|consensus 390 97.41
KOG1941|consensus 518 97.41
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.4
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.39
PF13512142 TPR_18: Tetratricopeptide repeat 97.37
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.35
KOG2376|consensus 652 97.31
KOG2796|consensus366 97.28
KOG4151|consensus 748 97.26
KOG2053|consensus 932 97.2
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.19
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.16
KOG2796|consensus366 97.15
KOG0376|consensus 476 97.14
KOG4340|consensus 459 97.09
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.07
KOG3824|consensus 472 97.01
PLN03218 1060 maturation of RBCL 1; Provisional 97.01
PRK04841 903 transcriptional regulator MalT; Provisional 96.9
KOG1941|consensus 518 96.89
KOG4507|consensus 886 96.88
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.88
KOG3364|consensus149 96.86
KOG3081|consensus299 96.82
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.82
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.82
KOG1586|consensus288 96.81
KOG1586|consensus 288 96.79
KOG4814|consensus 872 96.77
PLN03077 857 Protein ECB2; Provisional 96.77
PLN03218 1060 maturation of RBCL 1; Provisional 96.74
KOG1915|consensus 677 96.74
KOG1308|consensus 377 96.74
KOG0545|consensus329 96.72
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.7
KOG1585|consensus308 96.69
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.69
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.65
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.59
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.59
KOG2471|consensus 696 96.52
KOG4340|consensus 459 96.52
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.51
PRK04841 903 transcriptional regulator MalT; Provisional 96.46
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.35
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.34
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.33
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.33
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.32
KOG3824|consensus 472 96.3
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.3
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.28
COG4976 287 Predicted methyltransferase (contains TPR repeat) 96.28
KOG1915|consensus 677 96.27
COG4105 254 ComL DNA uptake lipoprotein [General function pred 96.27
KOG2471|consensus 696 96.24
KOG2396|consensus 568 96.2
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.17
COG2912269 Uncharacterized conserved protein [Function unknow 96.07
KOG3081|consensus299 96.06
KOG1070|consensus1710 95.98
KOG1585|consensus 308 95.95
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.94
KOG2610|consensus 491 95.88
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.86
PRK10941269 hypothetical protein; Provisional 95.78
KOG1070|consensus1710 95.75
COG4700251 Uncharacterized protein conserved in bacteria cont 95.72
KOG4814|consensus 872 95.53
PLN03077 857 Protein ECB2; Provisional 95.33
KOG0530|consensus 318 95.32
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.2
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.16
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.07
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.79
KOG4507|consensus 886 94.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.55
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.52
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.31
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.28
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 94.13
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 93.96
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.91
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.85
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.8
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.66
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.44
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.39
KOG1310|consensus 758 93.39
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.38
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.36
KOG2610|consensus 491 93.1
KOG2300|consensus 629 92.99
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.55
KOG3617|consensus 1416 92.49
KOG0882|consensus558 92.36
COG3629280 DnrI DNA-binding transcriptional activator of the 92.3
KOG2053|consensus 932 92.3
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 92.18
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.17
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.13
KOG3617|consensus 1416 91.94
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 91.93
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.88
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.79
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.72
PF13281374 DUF4071: Domain of unknown function (DUF4071) 91.63
COG2912269 Uncharacterized conserved protein [Function unknow 91.57
KOG0529|consensus 421 91.13
KOG1550|consensus 552 90.91
KOG3364|consensus149 90.74
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 90.7
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 90.58
KOG2047|consensus 835 90.49
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.24
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 89.93
KOG1550|consensus 552 89.83
KOG2047|consensus 835 89.72
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 89.71
COG3947361 Response regulator containing CheY-like receiver a 89.58
KOG0529|consensus 421 89.54
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.48
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 89.45
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.41
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.15
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 87.85
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 87.63
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 87.58
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 87.51
KOG1839|consensus 1236 87.39
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 87.27
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 87.08
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 87.02
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.79
KOG2422|consensus 665 85.63
COG3898 531 Uncharacterized membrane-bound protein [Function u 85.62
KOG0686|consensus 466 85.02
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.92
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 84.77
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 84.64
PF0421269 MIT: MIT (microtubule interacting and transport) d 84.28
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.26
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 84.02
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.96
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.77
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 83.4
KOG0530|consensus318 83.22
COG4455 273 ImpE Protein of avirulence locus involved in tempe 82.98
KOG1497|consensus 399 82.82
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 82.44
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 81.49
COG3898 531 Uncharacterized membrane-bound protein [Function u 81.02
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 80.37
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 80.33
PRK00969508 hypothetical protein; Provisional 80.21
>KOG0546|consensus Back     alignment and domain information
Probab=100.00  E-value=4.4e-65  Score=485.93  Aligned_cols=316  Identities=42%  Similarity=0.606  Sum_probs=285.3

Q ss_pred             CCCceEEEEEEECCeeeeeEEEEecCCCChHHHHHHHHhhhCCCCC-CCCCccccccCCcccccccccEEeeCccccCCC
Q psy6102           8 EGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGK-GKLGKALHFTGSHFHRIIPQFMIQGGDITNFNG   86 (426)
Q Consensus         8 ~~~~~~~~~~~~~~~~~G~i~~~l~~~~~P~~~~nf~~l~~~~~~~-~~~~k~~~y~~~~f~rv~~~~~iq~G~~~~~~~   86 (426)
                      ..||+|||||+|++.+.||||||||.|+||+||+||++||+|+.|. ...++..+|.|+.||||||+|||||||++.++|
T Consensus         6 ~~~pr~ffDISI~ge~~GRIvfeLf~dv~PKTaENFraLCtGE~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnG   85 (372)
T KOG0546|consen    6 RTNPRVFFDISIGGEPAGRIVFELFNDVVPKTAENFRALCTGEKGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNG   85 (372)
T ss_pred             CCCceEEEEEEeCCcccceEEEEeecccCchhHHHHHHHhccccCCCCCCCCeeeecCchhheeeecceeeccccccCCC
Confidence            3799999999999999999999999999999999999999999995 377899999999999999999999999999999


Q ss_pred             CCCccccCCCcCCccccccCCCCCCCCCCcchhhhhhhhhhcceeeeeeccccCCCCCCCCCCCccccceEEEEeecccc
Q psy6102          87 TGGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNT  166 (426)
Q Consensus        87 ~~~~~~~~~~~~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~sqF~i~~~~~~~  166 (426)
                      +||+||||..|+||+|.++|++     ||+              |||||.   |       |+  +||||||||+.    
T Consensus        86 tGGeSIYG~~FdDEnF~lKHdr-----pfl--------------LSMAN~---G-------pN--TNgSQFFITT~----  130 (372)
T KOG0546|consen   86 TGGESIYGEKFDDENFELKHDR-----PFL--------------LSMANR---G-------PN--TNGSQFFITTV----  130 (372)
T ss_pred             CCcccccccccccccceeccCc-----chh--------------hhhhcC---C-------CC--CCCcceEEeCC----
Confidence            9999999999999999999999     999              999999   9       99  99999999999    


Q ss_pred             ccCchhhhhhhhHHHHHHHHhhhhhhhhhhhchhhhhHhhhcchHHHhhhccCCCCccchhHHHHHhhhcccccceechh
Q psy6102         167 FTNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCV  246 (426)
Q Consensus       167 ~~~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~vFG~V  246 (426)
                         ++| ||||                                                             .|+|||+|
T Consensus       131 ---p~P-HLdG-------------------------------------------------------------kHVVFGqV  145 (372)
T KOG0546|consen  131 ---PTP-HLDG-------------------------------------------------------------KHVVFGQV  145 (372)
T ss_pred             ---CCC-CcCC-------------------------------------------------------------ceeEEeeE
Confidence               999 9999                                                             99999999


Q ss_pred             hccccHHHHHhhchhhC-Ccccccchh----------------------------------------------hhHHHHH
Q psy6102         247 RQGFGVAREVSYVEAEN-DKPLVLNQM----------------------------------------------EDVIRTI  279 (426)
Q Consensus       247 ieGldvl~~I~~l~~~~-~~P~~~i~i----------------------------------------------lk~a~~~  279 (426)
                      +.|+++++.|+.+.++. +.|...+.|                                              ...+...
T Consensus       146 I~G~~VVr~IEn~~~d~~skP~~dV~I~dCGel~~~~~~~~~~~a~~~~~sgd~~~d~p~~~~~~~~~~~~~~~~~~~~~  225 (372)
T KOG0546|consen  146 IKGKEVVREIENLETDEESKPLADVVISDCGELVKKSKVKEDAGASEPDETGDSYEDYPKDDRSWDDKDFDKALEREEKK  225 (372)
T ss_pred             eechhHHHHHhccccccCCCCccceEecccccccccccccccccCCCCCCCCCcccccccccccccccccchhhhhhhhh
Confidence            99999999999988843 345531111                                              1234567


Q ss_pred             HhccchhhhhhhHHHHHHHHHHHHHHHHhhcccchhhh---hhhcCcchHHHHHHHHHHHHHccCHHHHHHHHHHHHHhC
Q psy6102         280 KNSGNEYFKLNRMHDAQRKYKKAVRYIKWYNQSQSKTQ---QKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLME  356 (426)
Q Consensus       280 ~~~G~~~f~~g~y~~Ai~~y~kAl~~~~~~~~~~~~~~---~~~~~p~~~~~~~nlA~~~~~lg~~~~Ai~~~~~AL~ld  356 (426)
                      ++.|+..|++++|..|...|.++++++.........+.   ...+......++.+++.|-++++.+..|+..+..+++.+
T Consensus       226 k~~~~~~~kk~~~~~a~~k~~k~~r~~~~~s~~~~~e~~~~~~~~~~~r~~~~~n~~~~~lk~~~~~~a~~~~~~~~~~~  305 (372)
T KOG0546|consen  226 KNIGNKEFKKQRYREALAKYRKALRYLSEQSRDREKEQENRIPPLRELRFSIRRNLAAVGLKVKGRGGARFRTNEALRDE  305 (372)
T ss_pred             hccchhhhhhccHhHHHHHHHHHhhhhcccccccccccccccccccccccccccchHHhcccccCCCcceeccccccccC
Confidence            78999999999999999999999998765222211111   234566777899999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHhhHHHHHHHHHHhhhc
Q psy6102         357 PNNVKALFRRGRAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQ  423 (426)
Q Consensus       357 p~~~kal~~lg~a~~~lg~~~~Al~~l~kAl~l~P~n~~a~~~l~~i~~~l~~~~~a~k~~~~k~f~  423 (426)
                      ++..+++|++++++..+.++++|+++++.|....|++.++...+..+.....++.+.++..+.+||.
T Consensus       306 ~s~tka~~Rr~~~~~~~~~~~~a~~~~~~a~~~~p~d~~i~~~~~~~~~~~~~~~~~~~~~~~k~~s  372 (372)
T KOG0546|consen  306 RSKTKAHYRRGQAYKLLKNYDEALEDLKKAKQKAPNDKAIEEELENVRQKKKQYNRKQKKALSKMFS  372 (372)
T ss_pred             hhhCcHHHHHHhHHHhhhchhhhHHHHHHhhccCcchHHHHHHHHHhhhHHHHHHHHHHHHHHhhcC
Confidence            9999999999999999999999999999999999999999999999999999999999999999984



>KOG0880|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1839|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2422|consensus Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG0686|consensus Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 8e-33
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 1e-18
1dyw_A173 Biochemical And Structural Characterization Of A Di 4e-32
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 2e-31
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 7e-31
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 9e-29
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 1e-28
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 1e-26
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 1e-26
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 2e-26
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-26
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 8e-26
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 1e-25
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-25
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 4e-25
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 2e-24
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-24
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 2e-24
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 2e-24
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-24
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-24
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-24
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-24
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-24
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 2e-24
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 2e-24
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 2e-24
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 3e-24
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 3e-24
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 3e-24
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 4e-24
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 5e-24
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 5e-24
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 5e-24
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 6e-24
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 7e-24
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 7e-24
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 7e-24
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 8e-24
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 1e-23
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 2e-23
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 3e-23
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-22
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 1e-22
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 1e-22
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-22
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 2e-22
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-22
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-22
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 8e-22
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 8e-22
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 3e-21
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 4e-21
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-20
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 5e-20
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 1e-18
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 1e-17
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 1e-17
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 1e-17
2if4_A338 Crystal Structure Of A Multi-Domain Immunophilin Fr 6e-11
2fbn_A198 Plasmodium Falciparum Putative Fk506-Binding Protei 3e-10
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 6e-10
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 6e-10
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 6e-10
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 2e-09
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 2e-09
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 3e-09
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 3e-09
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-08
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 1e-07
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 3e-07
2ose_A234 Crystal Structure Of The Mimivirus Cyclophilin Leng 2e-06
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 7e-06
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 9e-06
3ieg_A359 Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A L 2e-05
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 3e-05
4apo_A165 Aip Tpr Domain In Complex With Human Tomm20 Peptide 4e-05
4aif_A144 Aip Tpr Domain In Complex With Human Hsp90 Peptide 4e-05
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 4e-04
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 69/97 (71%), Positives = 74/97 (76%), Gaps = 1/97 (1%) Query: 10 NYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKL-GKALHFTGSHFH 68 N VF DV IG E+VGR+V+ELF IVPKTAENFRALCTGE G G GK LHF G FH Sbjct: 15 NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH 74 Query: 69 RIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLK 105 RII +FMIQGGD +N NGTGGESIYG FEDENF K Sbjct: 75 RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYK 111
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 Back     alignment and structure
>pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2OSE|A Chain A, Crystal Structure Of The Mimivirus Cyclophilin Length = 234 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|3IEG|A Chain A, Crystal Structure Of P58(Ipk) Tpr Domain At 2.5 A Length = 359 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 Back     alignment and structure
>pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query426
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 9e-61
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-60
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 1e-60
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-60
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 3e-59
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 7e-59
1z81_A229 Cyclophilin; structural genomics, structural genom 2e-57
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-56
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 5e-55
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-48
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 3e-53
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 6e-53
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 6e-53
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 7e-53
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-52
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-52
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 2e-52
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 4e-52
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-51
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-39
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-38
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-36
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 9e-29
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 3e-28
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-27
2b71_A196 Cyclophilin-like protein; structural genomics, str 2e-26
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-26
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 3e-25
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 2e-24
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-24
2hq6_A185 Serologically defined colon cancer antigen 10; pro 9e-24
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 2e-22
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 6e-22
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-20
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 9e-20
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-20
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-19
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-18
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-18
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-17
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 2e-17
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-17
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-13
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-10
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-14
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-05
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-15
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 5e-15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 7e-15
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 7e-15
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 8e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 8e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-10
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-12
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-04
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-05
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 7e-11
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-08
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-06
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-06
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-06
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 4e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 7e-06
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 8e-07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 7e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 5e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 1e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-05
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-04
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 2e-04
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 4e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 8e-04
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
 Score =  194 bits (496), Expect = 9e-61
 Identities = 53/100 (53%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 7   KEGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGK-LGKALHFTGS 65
             G+     D+ I  E VGR++ +LF  I PKT +NF  LC+GE G GK  GK L + GS
Sbjct: 16  PRGSPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGS 75

Query: 66  HFHRIIPQFMIQGGDITNFNGTGGESIYGPCFEDENFKLK 105
            FHR++  FMIQGGD +  NG GGESIYG  F+DENF LK
Sbjct: 76  TFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILK 115


>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.97
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.86
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.85
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.78
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.77
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.76
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.72
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.71
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.68
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.67
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.67
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.66
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.66
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.62
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.62
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.61
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.61
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.59
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.57
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.54
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.54
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.54
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.52
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.51
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.5
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.48
3k9i_A117 BH0479 protein; putative protein binding protein, 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.48
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.48
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.47
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.46
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.46
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.46
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.45
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.45
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.44
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.44
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.43
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.43
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.42
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.42
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.42
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.4
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.4
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.39
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.39
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.39
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.39
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.38
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.38
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.38
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.38
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.37
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.37
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.35
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.35
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.35
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.35
3u4t_A272 TPR repeat-containing protein; structural genomics 99.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.34
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.34
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.33
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.33
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.33
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.33
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.31
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.3
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.28
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.27
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.27
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 99.27
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.27
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.27
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.26
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.26
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.25
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.25
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.24
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.23
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.23
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.23
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.16
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.16
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.15
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.15
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.15
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.15
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.14
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.12
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.12
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.12
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.11
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.11
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.1
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.1
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.08
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.07
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.07
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.06
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.06
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.05
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.05
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.05
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.04
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.03
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.03
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.02
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.0
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.98
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.96
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.95
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.93
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.92
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.91
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.9
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.89
3k9i_A117 BH0479 protein; putative protein binding protein, 98.88
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.88
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.85
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.82
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.78
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.76
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.74
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.69
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.65
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.63
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.62
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.62
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.56
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.54
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.52
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.5
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.5
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.43
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.42
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.34
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.3
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.23
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.23
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.22
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.14
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.07
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.04
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.04
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.02
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.96
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.91
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.88
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.87
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.81
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.43
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.38
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.24
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.14
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.11
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.89
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.6
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.5
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 96.33
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.28
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.81
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.81
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.68
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.08
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.75
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 94.48
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.26
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 94.26
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.11
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 93.02
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.65
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 92.35
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 92.3
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 91.66
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.16
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.09
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 89.98
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.97
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.18
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 86.16
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 84.24
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.57
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 81.48
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
Probab=100.00  E-value=2.4e-62  Score=492.69  Aligned_cols=314  Identities=42%  Similarity=0.704  Sum_probs=280.5

Q ss_pred             CceEEEEEEECCeeeeeEEEEecCCCChHHHHHHHHhhhCCCCCCCC-CccccccCCcccccccccEEeeCccccCCCCC
Q psy6102          10 NYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKL-GKALHFTGSHFHRIIPQFMIQGGDITNFNGTG   88 (426)
Q Consensus        10 ~~~~~~~~~~~~~~~G~i~~~l~~~~~P~~~~nf~~l~~~~~~~~~~-~k~~~y~~~~f~rv~~~~~iq~G~~~~~~~~~   88 (426)
                      +|+|||||+|++++.|+|+||||++.||+||+||++||++++|.|.. ++..||+|+.||||||+|||||||++.++|+|
T Consensus        15 ~~~v~~~~~~~~~~~G~i~~~l~~~~~P~t~~nf~~l~~~~~~~~~~~g~~~~y~~~~fhrv~~~f~~q~Gd~~~~~g~g   94 (370)
T 1ihg_A           15 NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTG   94 (370)
T ss_dssp             SCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHCTTCBCTTTSSBSCCTTCBEEEEETTTEEEECCTTTSSSSC
T ss_pred             CCeEEEEEEECCEecccEEEEEcCCCCchHHHHHHHHcCCCcCcCccCCCcceeCCcEeEEEECCcEEECCCCCCCCCCC
Confidence            89999999999999999999999999999999999999998887643 55668999999999999999999999899999


Q ss_pred             CccccCCCcCCccccccCCCCCCCCCCcchhhhhhhhhhcceeeeeeccccCCCCCCCCCCCccccceEEEEeecccccc
Q psy6102          89 GESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTFT  168 (426)
Q Consensus        89 ~~~~~~~~~~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~sqF~i~~~~~~~~~  168 (426)
                      |+|+||.+|+||++.++|+.     ||+              ||||+.   |       |+  ++|||||||++      
T Consensus        95 ~~~~~~~~~~~e~~~~~~~~-----~g~--------------l~ma~~---~-------~~--~~~sqffi~~~------  137 (370)
T 1ihg_A           95 GESIYGEKFEDENFHYKHDK-----EGL--------------LSMANA---G-------SN--TNGSQFFITTV------  137 (370)
T ss_dssp             CCBTTBSCBCCCCCCBCCCS-----TTE--------------EEECCS---S-------TT--CBCSCEEEESS------
T ss_pred             CCCCCCCCcCCCcCCcCCCC-----CeE--------------EEEeeC---C-------CC--CCCceEEEeCC------
Confidence            99999999999999999998     999              999999   8       99  99999999999      


Q ss_pred             CchhhhhhhhHHHHHHHHhhhhhhhhhhhchhhhhHhhhcchHHHhhhccCCCCccchhHHHHHhhhcccccceechhhc
Q psy6102         169 NNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVRQ  248 (426)
Q Consensus       169 ~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~vFG~Vie  248 (426)
                       ++| |||+                                                             .|++||+|++
T Consensus       138 -~~~-~ld~-------------------------------------------------------------~~~vfG~v~~  154 (370)
T 1ihg_A          138 -PTP-HLDG-------------------------------------------------------------KHVVFGQVIK  154 (370)
T ss_dssp             -CCG-GGTT-------------------------------------------------------------TSCEEEEEEE
T ss_pred             -CCc-ccCC-------------------------------------------------------------CceEEEEEec
Confidence             999 9999                                                             9999999999


Q ss_pred             cccHHHHHhhchhhCCcccc-----------------------------------------cchhhhHHHHHHhccchhh
Q psy6102         249 GFGVAREVSYVEAENDKPLV-----------------------------------------LNQMEDVIRTIKNSGNEYF  287 (426)
Q Consensus       249 Gldvl~~I~~l~~~~~~P~~-----------------------------------------~i~ilk~a~~~~~~G~~~f  287 (426)
                      |++++++|+...+..++|..                                         .......+..++.+|+.++
T Consensus       155 g~~v~~~i~~~~~~~~~P~~~v~I~~~g~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~  234 (370)
T 1ihg_A          155 GMGVAKILENVEVKGEKPAKLCVIAECGELKEGDDWGIFPKDGSGDSHPDFPEDADVDLKDVDKILLISEDLKNIGNTFF  234 (370)
T ss_dssp             CHHHHHHHHTSCEETTEESSCEEEEEEEEECTTCCCCCSCCSSSCCCSCSSGGGSSSCTTCHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHcCCCCCCccceeEEEEEEEEeccCccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHH
Confidence            99999999987764343332                                         1112335677999999999


Q ss_pred             hhhhHHHHHHHHHHHHHHHHhhcccchhhhhhhcCcchHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHH
Q psy6102         288 KLNRMHDAQRKYKKAVRYIKWYNQSQSKTQQKHFRSYYTAALLNMAAVQLKFKAYKRAINLCDDILLMEPNNVKALFRRG  367 (426)
Q Consensus       288 ~~g~y~~Ai~~y~kAl~~~~~~~~~~~~~~~~~~~p~~~~~~~nlA~~~~~lg~~~~Ai~~~~~AL~ldp~~~kal~~lg  367 (426)
                      +.|+|++|+..|++|+++++........+....++|.+..+|.++|.|++++++|++|+.+|++||+++|+++++|+++|
T Consensus       235 ~~g~~~~Ai~~y~kAl~~~~~~~~~~~~~~~~~~~~~~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg  314 (370)
T 1ihg_A          235 KSQNWEMAIKKYTKVLRYVEGSRAAAEDADGAKLQPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRA  314 (370)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHHHHHSCHHHHGGGHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHH
T ss_pred             HhcCHHHHHHHHHHHHHHhhcCccccChHHHHHHHHHHHHHHHHHHHHHHhccCHHHHHHHHHHHHHhCchhHHHHHHHH
Confidence            99999999999999999766543222234444568899999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCChHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHhhHHHHHHHHHHhhhc
Q psy6102         368 RAQVSMNNFEQGLQDYEQALDLLPNDQQILKEIAFVRKQMRHHLNLEKMTYARMFQ  423 (426)
Q Consensus       368 ~a~~~lg~~~~Al~~l~kAl~l~P~n~~a~~~l~~i~~~l~~~~~a~k~~~~k~f~  423 (426)
                      .+|..+|++++|+.+|++|++++|++..++..++.++..+++.+++++..+++||+
T Consensus       315 ~~~~~~g~~~eA~~~l~~Al~l~P~~~~~~~~l~~~~~~~~~~~~a~k~~~~kmf~  370 (370)
T 1ihg_A          315 QGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAYAKMFA  370 (370)
T ss_dssp             HHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHHHHHCCC-----
T ss_pred             HHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhC
Confidence            99999999999999999999999999999999999999999999999999999985



>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 426
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 4e-28
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-27
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 5e-26
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-25
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6e-25
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 2e-23
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 3e-23
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 4e-23
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 7e-21
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-20
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 3e-20
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-19
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 4e-19
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 6e-17
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 1e-16
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-15
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 6e-14
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-14
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-13
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 5e-11
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 6e-11
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 1e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 7e-09
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 2e-08
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 7e-08
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 7e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 5e-05
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 6e-05
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 7e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-04
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.002
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.003
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Nematode (Brugia malayi) [TaxId: 6279]
 Score =  107 bits (267), Expect = 4e-28
 Identities = 56/98 (57%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 13  VFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKL-GKALHFTGSHFHRII 71
           VFLDV+I     GR+V+EL+  I P+T  NF  LCTG  G GK+ GK LH+ GS FHR+I
Sbjct: 6   VFLDVTIDGNLAGRIVMELYNDIAPRTCNNFLMLCTGMAGTGKISGKPLHYKGSTFHRVI 65

Query: 72  PQFMIQGGDITNFNGTGGESIYGPCFEDENFKLKGIYP 109
             FMIQGGD T  +GTGGESIYG  F+DE F +K   P
Sbjct: 66  KNFMIQGGDFTKGDGTGGESIYGGMFDDEEFVMKHDEP 103


>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query426
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 99.98
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 99.98
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 99.97
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.97
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 99.97
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 99.97
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.97
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.97
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.96
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.86
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.85
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.83
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.8
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.75
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.65
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.62
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.53
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.5
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.49
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.47
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.43
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.34
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.32
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.32
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.31
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.11
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 99.07
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.07
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.02
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.99
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.98
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.98
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.88
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.8
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.77
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.73
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.69
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.62
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.6
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.42
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.37
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.36
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.3
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.99
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.69
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.68
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.64
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 86.91
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 86.46
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]
Probab=100.00  E-value=5.7e-39  Score=286.50  Aligned_cols=167  Identities=50%  Similarity=0.793  Sum_probs=156.9

Q ss_pred             CCCceEEEEEEECCeeeeeEEEEecCCCChHHHHHHHHhhhCCCCCCCCCccccccCCcccccccccEEeeCccccCCCC
Q psy6102           8 EGNYIVFLDVSIGEEKVGRMVIELFKHIVPKTAENFRALCTGEYGKGKLGKALHFTGSHFHRIIPQFMIQGGDITNFNGT   87 (426)
Q Consensus         8 ~~~~~~~~~~~~~~~~~G~i~~~l~~~~~P~~~~nf~~l~~~~~~~~~~~k~~~y~~~~f~rv~~~~~iq~G~~~~~~~~   87 (426)
                      +.|++|||||+|+++++|+|+||||.+.||+||+||++||+++.+....+|.++|+++.||||+++++||+|++..++|+
T Consensus         1 ~~~~~v~~Di~i~~~~~G~i~ieL~~~~aP~tv~nF~~L~~~~~~~~~~~k~~~y~~~~f~rv~~~~~i~~G~~~~~~~~   80 (172)
T d2igva1           1 MSRSKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGT   80 (172)
T ss_dssp             CCCCEEEEEEEETTEEEEEEEEEECTTTCHHHHHHHHHHHHTTTCBCTTSSBSCCTTCBCCEEETTTEEEECCTTTSSSS
T ss_pred             CCCCEEEEEEEECCEeccEEEEEEcCCCCcHHHHHHHHHHhccccccccCcccccCCcceeEEEecceEEcCCccCCCCC
Confidence            46899999999999999999999999999999999999999988888888999999999999999999999999988999


Q ss_pred             CCccccCCCcCCccccccCCCCCCCCCCcchhhhhhhhhhcceeeeeeccccCCCCCCCCCCCccccceEEEEeeccccc
Q psy6102          88 GGESIYGPCFEDENFKLKGIYPKNKYPGIYPSLVKAMFRMLTFTSMVCLFSLGSGLGLGLASTLVGSYQFSCTVSFLNTF  167 (426)
Q Consensus        88 ~~~~~~~~~~~~e~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~sqF~i~~~~~~~~  167 (426)
                      ++.++++..|++|.....|+.     +|+              ||||+.   +       |+  +++||||||++     
T Consensus        81 ~~~~~~~~~~~~e~~~~~~~~-----~G~--------------lsma~~---~-------~~--~~~sqFfIt~~-----  124 (172)
T d2igva1          81 GGESIYGEKFPDENFKEKHTG-----PGV--------------LSMANA---G-------PN--TNGSQFFLCTV-----  124 (172)
T ss_dssp             CCCBTTBSCBCCCCCCSCCCS-----TTE--------------EEECCS---S-------TT--CBSSCEEEESS-----
T ss_pred             CCcccCCCccCccccccccCC-----CcE--------------EEEeec---C-------CC--CcCceeEeeec-----
Confidence            999999999999988888888     899              999999   8       88  99999999999     


Q ss_pred             cCchhhhhhhhHHHHHHHHhhhhhhhhhhhchhhhhHhhhcchHHHhhhccCCCCccchhHHHHHhhhcccccceechhh
Q psy6102         168 TNNCEIHLQRLNVKLRKIEADLSILEAKHYYNQGALEKKRGITEHKKKLETGRGKEISRKQYRDLVKKKKKKNGIFGCVR  247 (426)
Q Consensus       168 ~~~~~~~l~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~vFG~Vi  247 (426)
                        ++| +||+                                                             .|++||+|+
T Consensus       125 --~~~-~ld~-------------------------------------------------------------~~~vFG~Vv  140 (172)
T d2igva1         125 --KTE-WLDG-------------------------------------------------------------KHVVFGRVV  140 (172)
T ss_dssp             --CCG-GGTT-------------------------------------------------------------TSCEEEEEE
T ss_pred             --CCc-ccCC-------------------------------------------------------------ceeEEEEEe
Confidence              999 9999                                                             999999999


Q ss_pred             ccccHHHHHhhchhhCCcccccchhhh
Q psy6102         248 QGFGVAREVSYVEAENDKPLVLNQMED  274 (426)
Q Consensus       248 eGldvl~~I~~l~~~~~~P~~~i~ilk  274 (426)
                      +||+++++|+...+..++|...+.|..
T Consensus       141 ~Gmdvl~~I~~~~~~~g~P~~~i~I~~  167 (172)
T d2igva1         141 EGLDVVKAVESNGSQSGKPVKDCMIAD  167 (172)
T ss_dssp             ECHHHHHHHHTTCCTTSCCSSCEEEEE
T ss_pred             ccHHHHHHHHcCCCCCCCCCCCeEEEe
Confidence            999999999998888889988776654



>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure