Psyllid ID: psy6121


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MLTLSTDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEEKKKRREDKVEEEEDEKLEEEEMEEQKEEKKEKVEEEEVKEERREGGRGGR
cEEEEEEEEcccccccccEEEEEEEccEEEEEEEcccccEEEEEEcccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
cEEEEEHHHcccccccccEEEEEEccccEEEEEEcccccEEEEEEcccEEcccccccEEEEEEEHEEEcccccEEcEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
mltlstdcwlgdgsdgsdyLNVAIKDGGVAINLKLAMGkldmyirpnrlrfddnqwhhLSIHRRIqegtgcgkeeekkkrredkveeeEDEKLEEEEMEEQKEEKKEKVEEEEVKEERreggrggr
mltlstdcwlgdgsdGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHrriqegtgcgkeeekkkrredkveeeedekleeeemeeqkeekkekveeeevkeerreggrggr
MLTLSTDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGkeeekkkrredkveeeedekleeeemeeqkeekkekveeeevkeerreGGRGGR
*****TDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRI*************************************************************
MLTLSTDCWLG**SDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQ************************************************************
MLTLSTDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGT*********************************************************
MLTLSTDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEE*****************EEEE*****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTLSTDCWLGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGGRGGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
A1XQX8 1697 Neurexin-3a OS=Danio reri no N/A 0.563 0.041 0.315 2e-07
A1XQY1 1686 Neurexin-3b OS=Danio reri no N/A 0.563 0.042 0.315 2e-07
D0PRN3 1693 Neurexin-3 OS=Gallus gall yes N/A 0.563 0.041 0.315 2e-07
A1XQX2 1470 Neurexin-1b OS=Danio reri no N/A 0.444 0.038 0.321 2e-06
Q9Y4C0 1643 Neurexin-3 OS=Homo sapien yes N/A 0.539 0.041 0.315 2e-06
Q07310 1578 Neurexin-3 OS=Rattus norv no N/A 0.539 0.043 0.315 3e-06
Q6P9K9 1571 Neurexin-3 OS=Mus musculu yes N/A 0.539 0.043 0.315 3e-06
A1XQX0 1491 Neurexin-1a OS=Danio reri no N/A 0.444 0.037 0.321 5e-06
Q9ULB1 1477 Neurexin-1 OS=Homo sapien yes N/A 0.444 0.037 0.321 6e-06
Q28146 1530 Neurexin-1 OS=Bos taurus yes N/A 0.444 0.036 0.321 6e-06
>sp|A1XQX8|NR3AA_DANRE Neurexin-3a OS=Danio rerio GN=nrxn3a PE=2 SV=1 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 5/76 (6%)

Query: 2   LTLSTDCWLGDG-----SDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQW 56
           +TLS   W  +G        +DY+N+A+KDG V++ + L  G  +  + P   +F+DN W
Sbjct: 283 ITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNSW 342

Query: 57  HHLSIHRRIQEGTGCG 72
           H + + R +++ +G G
Sbjct: 343 HDVKVTRNLRQHSGIG 358




Neuronal cell surface protein that may be involved in cell recognition and cell adhesion.
Danio rerio (taxid: 7955)
>sp|A1XQY1|NR3BA_DANRE Neurexin-3b OS=Danio rerio GN=nrxn3b PE=2 SV=1 Back     alignment and function description
>sp|D0PRN3|NRX3A_CHICK Neurexin-3 OS=Gallus gallus PE=1 SV=1 Back     alignment and function description
>sp|A1XQX2|NR1BA_DANRE Neurexin-1b OS=Danio rerio GN=nrxn1b PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4C0|NRX3A_HUMAN Neurexin-3 OS=Homo sapiens GN=NRXN3 PE=1 SV=4 Back     alignment and function description
>sp|Q07310|NRX3A_RAT Neurexin-3 OS=Rattus norvegicus GN=Nrxn3 PE=1 SV=1 Back     alignment and function description
>sp|Q6P9K9|NRX3A_MOUSE Neurexin-3 OS=Mus musculus GN=Nrxn3 PE=1 SV=2 Back     alignment and function description
>sp|A1XQX0|NR1AA_DANRE Neurexin-1a OS=Danio rerio GN=nrxn1a PE=2 SV=1 Back     alignment and function description
>sp|Q9ULB1|NRX1A_HUMAN Neurexin-1 OS=Homo sapiens GN=NRXN1 PE=2 SV=1 Back     alignment and function description
>sp|Q28146|NRX1A_BOVIN Neurexin-1 OS=Bos taurus GN=NRXN1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
270010294 718 hypothetical protein TcasGA2_TC009676 [T 0.420 0.073 0.622 3e-14
312377883 448 hypothetical protein AND_10684 [Anophele 0.396 0.111 0.576 7e-14
328710867210 PREDICTED: neurexin-1-alpha-like, partia 0.436 0.261 0.543 7e-14
442620475 1525 neurexin 1, isoform G [Drosophila melano 0.412 0.034 0.576 2e-13
307191569213 Neurexin-3-alpha [Harpegnathos saltator] 0.420 0.248 0.547 2e-13
170055731 1554 neurexin [Culex quinquefasciatus] gi|167 0.396 0.032 0.576 2e-13
321469628 1345 hypothetical protein DAPPUDRAFT_20079 [D 0.444 0.041 0.571 3e-13
442620471 1825 neurexin 1, isoform E [Drosophila melano 0.412 0.028 0.576 4e-13
195502605 1835 GE10306 [Drosophila yakuba] gi|194184398 0.412 0.028 0.576 4e-13
195331037 1837 GM26438 [Drosophila sechellia] gi|194121 0.412 0.028 0.576 4e-13
>gi|270010294|gb|EFA06742.1| hypothetical protein TcasGA2_TC009676 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 83.2 bits (204), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 46/53 (86%)

Query: 15  DGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQE 67
           DG+DYLNVAIK+G +++ + L+ GK +M I+PN++RFDDNQWH +S+HRRIQE
Sbjct: 371 DGTDYLNVAIKEGCLSLTMGLSNGKQEMQIKPNKVRFDDNQWHKVSVHRRIQE 423




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312377883|gb|EFR24607.1| hypothetical protein AND_10684 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328710867|ref|XP_003244386.1| PREDICTED: neurexin-1-alpha-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|442620475|ref|NP_001262841.1| neurexin 1, isoform G [Drosophila melanogaster] gi|440217754|gb|AGB96221.1| neurexin 1, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307191569|gb|EFN75067.1| Neurexin-3-alpha [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|170055731|ref|XP_001863712.1| neurexin [Culex quinquefasciatus] gi|167875587|gb|EDS38970.1| neurexin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|321469628|gb|EFX80607.1| hypothetical protein DAPPUDRAFT_20079 [Daphnia pulex] Back     alignment and taxonomy information
>gi|442620471|ref|NP_001262839.1| neurexin 1, isoform E [Drosophila melanogaster] gi|440217752|gb|AGB96219.1| neurexin 1, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195502605|ref|XP_002098297.1| GE10306 [Drosophila yakuba] gi|194184398|gb|EDW98009.1| GE10306 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195331037|ref|XP_002032209.1| GM26438 [Drosophila sechellia] gi|194121152|gb|EDW43195.1| GM26438 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
FB|FBgn0038975 1840 Nrx-1 "Neurexin 1" [Drosophila 0.412 0.028 0.576 3.3e-13
UNIPROTKB|H0YJL2175 NRXN3 "Neurexin-3-beta, C-term 0.563 0.405 0.315 1.6e-08
UNIPROTKB|F1SQJ0163 LOC100519087 "Uncharacterized 0.444 0.343 0.321 2.9e-07
ZFIN|ZDB-GENE-070206-10 1687 nrxn3b "neurexin 3b" [Danio re 0.563 0.042 0.315 5.6e-07
ZFIN|ZDB-GENE-070206-9 1697 nrxn3a "neurexin 3a" [Danio re 0.563 0.041 0.315 5.6e-07
UNIPROTKB|D0PRN3 1693 D0PRN3 "Neurexin-3" [Gallus ga 0.563 0.041 0.315 7.2e-07
UNIPROTKB|F1NLI2 861 F1NLI2 "Uncharacterized protei 0.539 0.078 0.315 2.3e-06
UNIPROTKB|D4ABV7 1520 D4ABV7 "Uncharacterized protei 0.444 0.036 0.321 3e-06
UNIPROTKB|Q63372 1530 Nrxn1 "Neurexin-1" [Rattus nor 0.444 0.036 0.321 3e-06
UNIPROTKB|E1C8Q7 1540 E1C8Q7 "Uncharacterized protei 0.539 0.044 0.315 4.6e-06
FB|FBgn0038975 Nrx-1 "Neurexin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 3.3e-13, P = 3.3e-13
 Identities = 30/52 (57%), Positives = 47/52 (90%)

Query:    16 GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQE 67
             G+DYLN+A++DGGV++ + LA GK +M+I+P+++RFDD+QWH +++HRRIQE
Sbjct:   401 GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQE 452




GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0007268 "synaptic transmission" evidence=IDA
GO:0050808 "synapse organization" evidence=IDA
GO:0008306 "associative learning" evidence=IDA
GO:0007416 "synapse assembly" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
UNIPROTKB|H0YJL2 NRXN3 "Neurexin-3-beta, C-terminal fragment" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQJ0 LOC100519087 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070206-10 nrxn3b "neurexin 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070206-9 nrxn3a "neurexin 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D0PRN3 D0PRN3 "Neurexin-3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLI2 F1NLI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D4ABV7 D4ABV7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63372 Nrxn1 "Neurexin-1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Q7 E1C8Q7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 2e-06
smart00282132 smart00282, LamG, Laminin G domain 5e-06
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 3e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 2e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 3e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
COG4499434 COG4499, COG4499, Predicted membrane protein [Func 5e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 7e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.004
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
 Score = 43.2 bits (102), Expect = 2e-06
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 12 DGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRR 64
           G DG D+L + ++DG + +   L  G     +  +  + +D QWH +S+ R 
Sbjct: 14 GGEDGLDFLALELEDGRLVLRYDL--GSGGSVLLLSGKKLNDGQWHRVSVSRD 64


This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily. Length = 124

>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.62
smart00282135 LamG Laminin G domain. 99.54
KOG3514|consensus 1591 99.45
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.43
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.37
KOG3516|consensus 1306 99.31
KOG3516|consensus 1306 99.21
KOG3514|consensus 1591 99.19
KOG4289|consensus 2531 98.86
KOG1219|consensus 4289 98.29
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 98.09
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 96.35
KOG4289|consensus 2531 94.27
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 93.54
cd00152201 PTX Pentraxins are plasma proteins characterized b 92.11
KOG1834|consensus 952 92.06
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 89.17
smart00560133 LamGL LamG-like jellyroll fold domain. 88.95
PF14099224 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 85.61
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 81.73
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
Probab=99.62  E-value=2.6e-15  Score=108.33  Aligned_cols=70  Identities=21%  Similarity=0.414  Sum_probs=60.4

Q ss_pred             eeeceeeecCC--CCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEeccccc
Q psy6121           5 STDCWLGDGSD--GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEEK   77 (126)
Q Consensus         5 sfrtlLLyaG~--~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~~~~   77 (126)
                      ..+++|||.|.  ..|||+|+|.+|+|.+.|++|+++..+..   ...++||+||+|.+.|+.+.++|.||+...
T Consensus         5 ~~~Gllly~g~~~~~dfial~L~~G~l~~~~~~G~~~~~~~~---~~~i~dg~wh~v~~~r~~~~~~L~Vd~~~~   76 (131)
T PF00054_consen    5 EPNGLLLYLGSKDGKDFIALELRDGRLEFRYNLGSGPASLRS---PQKINDGKWHTVSVSRNGRNGSLSVDGEEV   76 (131)
T ss_dssp             SSSEEEEEEESSTTSSEEEEEEETTEEEEEEESSSEEEEEEE---SSETTSSSEEEEEEEEETTEEEEEETTSEE
T ss_pred             CCCceEEECCcCCCCCEEEEEEECCEEEEEEeCCCccceecC---CCccCCCcceEEEEEEcCcEEEEEECCccc
Confidence            34567999876  55999999999999999999999876543   245999999999999999999999999876



The laminin globular (G) domain can be found in one to several copies in various laminin family members, which includes a large number of extracellular proteins. The C terminus of laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin []. Laminin G domains can vary in their function, and a variety of binding functions has been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each has five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012680 from INTERPRO).; PDB: 1OKQ_A 1DYK_A 2C5D_A 1H30_A 1LHW_A 1KDK_A 1LHU_A 1KDM_A 1LHO_A 1D2S_A ....

>smart00282 LamG Laminin G domain Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3514|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>PF14099 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 3IKW_A 3INA_A 3IMN_A 3IN9_A 2ZZJ_A Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2h0b_A184 Crystal Structure Of The Second LnsLG DOMAIN FROM N 2e-06
3poy_A 1019 Crystal Structure Of The Alpha-Neurexin-1 Ectodomai 3e-06
3r05_A 1254 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 5e-06
3qcw_A 1245 Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), 5e-06
>pdb|2H0B|A Chain A, Crystal Structure Of The Second LnsLG DOMAIN FROM NEUREXIN 1 ALPHA Length = 184 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 34/54 (62%) Query: 16 GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGT 69 +DY+N+A+K+G V++ + L G + + P +F+DN WH + + R +++ T Sbjct: 51 SADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVT 104
>pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 Back     alignment and structure
>pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 Back     alignment and structure
>pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 7e-09
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-08
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-07
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 5e-08
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 1e-07
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 1e-07
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 4e-06
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 4e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-07
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 9e-05
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 2e-07
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 3e-07
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 5e-07
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 3e-07
3v64_A191 Low-density lipoprotein receptor-related protein; 4e-07
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 5e-07
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 6e-07
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 3e-06
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 4e-06
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 5e-06
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 1e-05
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 2e-05
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 3e-05
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
 Score = 50.2 bits (120), Expect = 7e-09
 Identities = 17/56 (30%), Positives = 34/56 (60%)

Query: 14  SDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGT 69
              +DY+N+A+K+G V++ + L  G  +  + P   +F+DN WH + + R +++ T
Sbjct: 49  GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVT 104


>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.72
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.68
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.67
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.67
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.66
3v64_A191 Low-density lipoprotein receptor-related protein; 99.64
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.64
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.64
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.63
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.61
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.61
1dyk_A 394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.56
2jd4_A 383 Laminin subunit alpha-1; basement membrane protein 99.55
1h30_A 422 GAS6, growth-arrest-specific protein; laminin G-do 99.52
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.51
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.51
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.49
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.45
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.45
2wjs_A 608 Laminin subunit alpha-2; integrin, secreted, coile 99.4
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.36
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 99.3
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 99.04
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.6
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.48
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 97.41
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 96.49
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 94.41
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 93.26
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 92.55
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 92.55
3pvn_A206 C-reactive protein; pentraxin family, immune syste 90.6
4dqa_A355 Uncharacterized protein; two domains structure, DU 88.69
2sli_A 679 Intramolecular trans-sialidase; hydrolase, neurami 87.95
2jkb_A 686 Sialidase B; intramolecular trans-sialidase, lyase 86.72
3zr5_A656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 82.3
4azz_A172 Levanase; hydrolase; 1.70A {Bacillus subtilis} 80.85
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
Probab=99.72  E-value=4.2e-17  Score=120.95  Aligned_cols=77  Identities=26%  Similarity=0.501  Sum_probs=67.2

Q ss_pred             eEEeeece-----eeecCCCCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEecccc
Q psy6121           2 LTLSTDCW-----LGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEE   76 (126)
Q Consensus         2 IS~sfrtl-----LLyaG~~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~~~   76 (126)
                      |+|.|+|.     |||.++..|||+|+|.+|+|.+.+++|+|+....+.++...+|||+||+|.+.|+.+.++|+||+..
T Consensus        32 isl~frT~~~~GlLl~~g~~~d~l~l~L~~G~l~~~~~~G~g~~~~~~~~~~~~l~Dg~WH~V~v~r~~~~~~L~VD~~~  111 (184)
T 2h0b_A           32 ITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGIL  111 (184)
T ss_dssp             EEEEEEESCSCEEEEEECCTTEEEEEEEETTEEEEEEEESSCEEEEEECCSSSCSSSSSCEEEEEEEETTEEEEEETTTE
T ss_pred             EEEEEEeCCCCEEEEEeCCCCCEEEEEEECCEEEEEEECCCCeEEEEEecCCcccCCCCeEEEEEEEeCCEEEEEEcCce
Confidence            68888875     9998888899999999999999999999986544445567899999999999999999999999876


Q ss_pred             cc
Q psy6121          77 KK   78 (126)
Q Consensus        77 ~~   78 (126)
                      ..
T Consensus       112 ~~  113 (184)
T 2h0b_A          112 TT  113 (184)
T ss_dssp             EE
T ss_pred             ee
Confidence            44



>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 4e-06
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 7e-05
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 1e-04
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 2e-04
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 0.002
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 41.7 bits (97), Expect = 4e-06
 Identities = 10/61 (16%), Positives = 22/61 (36%), Gaps = 1/61 (1%)

Query: 10  LGDGSDGSDYLNVAIKDGGVAINLKLAMGKLD-MYIRPNRLRFDDNQWHHLSIHRRIQEG 68
           LG  S   D + + + D  +  ++    G+   +Y         + QWH ++  +     
Sbjct: 42  LGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRL 101

Query: 69  T 69
            
Sbjct: 102 E 102


>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.61
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.59
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.58
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.58
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.57
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.57
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.18
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 97.56
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 95.38
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 94.73
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 94.16
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 93.86
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 92.74
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 91.44
d1oq1a_223 Hypothetical protein YesU {Bacillus subtilis [TaxI 83.62
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.61  E-value=1.7e-15  Score=111.32  Aligned_cols=74  Identities=22%  Similarity=0.305  Sum_probs=63.6

Q ss_pred             eEEeeece-----eeecCC--CCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEecc
Q psy6121           2 LTLSTDCW-----LGDGSD--GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKE   74 (126)
Q Consensus         2 IS~sfrtl-----LLyaG~--~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~   74 (126)
                      |+|.|+|.     |||.++  ..|||+|+|.+|+|.+.+++|+++..+.   +...+|||+||+|.+.|..+.++|.||+
T Consensus        42 i~~~frT~~~~GlL~~~~~~~~~dfi~l~l~~G~l~~~~~~g~~~~~~~---~~~~v~Dg~WH~V~v~~~~~~~~l~VD~  118 (189)
T d1dyka1          42 IELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTM---IPTKINDGQWHKIKIVRVKQEGILYVDD  118 (189)
T ss_dssp             EEEEEEECCSCEEEEEEECTTSSSEEEEEEETTEEEEEEESSSCEEEEE---CCSCCCSSSCEEEEEEEETTEEEEEETT
T ss_pred             EEEEEEECCCCEEEEEEcCCCCCcEEEEEEECCEEEEEEECCCccEEec---CCcEeeCCCEEEEEEEEcccEEEEEECC
Confidence            78889875     888754  6699999999999999999999886543   2467999999999999999999999998


Q ss_pred             cccc
Q psy6121          75 EEKK   78 (126)
Q Consensus        75 ~~~~   78 (126)
                      ....
T Consensus       119 ~~~~  122 (189)
T d1dyka1         119 ASSQ  122 (189)
T ss_dssp             EEEE
T ss_pred             ccee
Confidence            7543



>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure