Psyllid ID: psy6121
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| 270010294 | 718 | hypothetical protein TcasGA2_TC009676 [T | 0.420 | 0.073 | 0.622 | 3e-14 | |
| 312377883 | 448 | hypothetical protein AND_10684 [Anophele | 0.396 | 0.111 | 0.576 | 7e-14 | |
| 328710867 | 210 | PREDICTED: neurexin-1-alpha-like, partia | 0.436 | 0.261 | 0.543 | 7e-14 | |
| 442620475 | 1525 | neurexin 1, isoform G [Drosophila melano | 0.412 | 0.034 | 0.576 | 2e-13 | |
| 307191569 | 213 | Neurexin-3-alpha [Harpegnathos saltator] | 0.420 | 0.248 | 0.547 | 2e-13 | |
| 170055731 | 1554 | neurexin [Culex quinquefasciatus] gi|167 | 0.396 | 0.032 | 0.576 | 2e-13 | |
| 321469628 | 1345 | hypothetical protein DAPPUDRAFT_20079 [D | 0.444 | 0.041 | 0.571 | 3e-13 | |
| 442620471 | 1825 | neurexin 1, isoform E [Drosophila melano | 0.412 | 0.028 | 0.576 | 4e-13 | |
| 195502605 | 1835 | GE10306 [Drosophila yakuba] gi|194184398 | 0.412 | 0.028 | 0.576 | 4e-13 | |
| 195331037 | 1837 | GM26438 [Drosophila sechellia] gi|194121 | 0.412 | 0.028 | 0.576 | 4e-13 |
| >gi|270010294|gb|EFA06742.1| hypothetical protein TcasGA2_TC009676 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 83.2 bits (204), Expect = 3e-14, Method: Composition-based stats.
Identities = 33/53 (62%), Positives = 46/53 (86%)
Query: 15 DGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQE 67
DG+DYLNVAIK+G +++ + L+ GK +M I+PN++RFDDNQWH +S+HRRIQE
Sbjct: 371 DGTDYLNVAIKEGCLSLTMGLSNGKQEMQIKPNKVRFDDNQWHKVSVHRRIQE 423
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312377883|gb|EFR24607.1| hypothetical protein AND_10684 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|328710867|ref|XP_003244386.1| PREDICTED: neurexin-1-alpha-like, partial [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|442620475|ref|NP_001262841.1| neurexin 1, isoform G [Drosophila melanogaster] gi|440217754|gb|AGB96221.1| neurexin 1, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|307191569|gb|EFN75067.1| Neurexin-3-alpha [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|170055731|ref|XP_001863712.1| neurexin [Culex quinquefasciatus] gi|167875587|gb|EDS38970.1| neurexin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|321469628|gb|EFX80607.1| hypothetical protein DAPPUDRAFT_20079 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|442620471|ref|NP_001262839.1| neurexin 1, isoform E [Drosophila melanogaster] gi|440217752|gb|AGB96219.1| neurexin 1, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195502605|ref|XP_002098297.1| GE10306 [Drosophila yakuba] gi|194184398|gb|EDW98009.1| GE10306 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195331037|ref|XP_002032209.1| GM26438 [Drosophila sechellia] gi|194121152|gb|EDW43195.1| GM26438 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 126 | ||||||
| FB|FBgn0038975 | 1840 | Nrx-1 "Neurexin 1" [Drosophila | 0.412 | 0.028 | 0.576 | 3.3e-13 | |
| UNIPROTKB|H0YJL2 | 175 | NRXN3 "Neurexin-3-beta, C-term | 0.563 | 0.405 | 0.315 | 1.6e-08 | |
| UNIPROTKB|F1SQJ0 | 163 | LOC100519087 "Uncharacterized | 0.444 | 0.343 | 0.321 | 2.9e-07 | |
| ZFIN|ZDB-GENE-070206-10 | 1687 | nrxn3b "neurexin 3b" [Danio re | 0.563 | 0.042 | 0.315 | 5.6e-07 | |
| ZFIN|ZDB-GENE-070206-9 | 1697 | nrxn3a "neurexin 3a" [Danio re | 0.563 | 0.041 | 0.315 | 5.6e-07 | |
| UNIPROTKB|D0PRN3 | 1693 | D0PRN3 "Neurexin-3" [Gallus ga | 0.563 | 0.041 | 0.315 | 7.2e-07 | |
| UNIPROTKB|F1NLI2 | 861 | F1NLI2 "Uncharacterized protei | 0.539 | 0.078 | 0.315 | 2.3e-06 | |
| UNIPROTKB|D4ABV7 | 1520 | D4ABV7 "Uncharacterized protei | 0.444 | 0.036 | 0.321 | 3e-06 | |
| UNIPROTKB|Q63372 | 1530 | Nrxn1 "Neurexin-1" [Rattus nor | 0.444 | 0.036 | 0.321 | 3e-06 | |
| UNIPROTKB|E1C8Q7 | 1540 | E1C8Q7 "Uncharacterized protei | 0.539 | 0.044 | 0.315 | 4.6e-06 |
| FB|FBgn0038975 Nrx-1 "Neurexin 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 189 (71.6 bits), Expect = 3.3e-13, P = 3.3e-13
Identities = 30/52 (57%), Positives = 47/52 (90%)
Query: 16 GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQE 67
G+DYLN+A++DGGV++ + LA GK +M+I+P+++RFDD+QWH +++HRRIQE
Sbjct: 401 GTDYLNLALRDGGVSLTMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQE 452
|
|
| UNIPROTKB|H0YJL2 NRXN3 "Neurexin-3-beta, C-terminal fragment" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQJ0 LOC100519087 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070206-10 nrxn3b "neurexin 3b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070206-9 nrxn3a "neurexin 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D0PRN3 D0PRN3 "Neurexin-3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLI2 F1NLI2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ABV7 D4ABV7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q63372 Nrxn1 "Neurexin-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8Q7 E1C8Q7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| pfam02210 | 124 | pfam02210, Laminin_G_2, Laminin G domain | 2e-06 | |
| smart00282 | 132 | smart00282, LamG, Laminin G domain | 5e-06 | |
| cd00110 | 151 | cd00110, LamG, Laminin G domain; Laminin G-like do | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 5e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.001 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.001 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.004 |
| >gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain | Back alignment and domain information |
|---|
Score = 43.2 bits (102), Expect = 2e-06
Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%)
Query: 12 DGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRR 64
G DG D+L + ++DG + + L G + + + +D QWH +S+ R
Sbjct: 14 GGEDGLDFLALELEDGRLVLRYDL--GSGGSVLLLSGKKLNDGQWHRVSVSRD 64
|
This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily. Length = 124 |
| >gnl|CDD|214598 smart00282, LamG, Laminin G domain | Back alignment and domain information |
|---|
| >gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| PF00054 | 131 | Laminin_G_1: Laminin G domain; InterPro: IPR012679 | 99.62 | |
| smart00282 | 135 | LamG Laminin G domain. | 99.54 | |
| KOG3514|consensus | 1591 | 99.45 | ||
| cd00110 | 151 | LamG Laminin G domain; Laminin G-like domains are | 99.43 | |
| PF02210 | 128 | Laminin_G_2: Laminin G domain; InterPro: IPR012680 | 99.37 | |
| KOG3516|consensus | 1306 | 99.31 | ||
| KOG3516|consensus | 1306 | 99.21 | ||
| KOG3514|consensus | 1591 | 99.19 | ||
| KOG4289|consensus | 2531 | 98.86 | ||
| KOG1219|consensus | 4289 | 98.29 | ||
| smart00210 | 184 | TSPN Thrombospondin N-terminal -like domains. Hepa | 98.09 | |
| PF13385 | 157 | Laminin_G_3: Concanavalin A-like lectin/glucanases | 96.35 | |
| KOG4289|consensus | 2531 | 94.27 | ||
| smart00159 | 206 | PTX Pentraxin / C-reactive protein / pentaxin fami | 93.54 | |
| cd00152 | 201 | PTX Pentraxins are plasma proteins characterized b | 92.11 | |
| KOG1834|consensus | 952 | 92.06 | ||
| PF02973 | 190 | Sialidase: Sialidase, N-terminal domain; InterPro: | 89.17 | |
| smart00560 | 133 | LamGL LamG-like jellyroll fold domain. | 88.95 | |
| PF14099 | 224 | Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A | 85.61 | |
| PF00354 | 195 | Pentaxin: Pentaxin family; InterPro: IPR001759 Pen | 81.73 |
| >PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
Probab=99.62 E-value=2.6e-15 Score=108.33 Aligned_cols=70 Identities=21% Similarity=0.414 Sum_probs=60.4
Q ss_pred eeeceeeecCC--CCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEeccccc
Q psy6121 5 STDCWLGDGSD--GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEEK 77 (126)
Q Consensus 5 sfrtlLLyaG~--~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~~~~ 77 (126)
..+++|||.|. ..|||+|+|.+|+|.+.|++|+++..+.. ...++||+||+|.+.|+.+.++|.||+...
T Consensus 5 ~~~Gllly~g~~~~~dfial~L~~G~l~~~~~~G~~~~~~~~---~~~i~dg~wh~v~~~r~~~~~~L~Vd~~~~ 76 (131)
T PF00054_consen 5 EPNGLLLYLGSKDGKDFIALELRDGRLEFRYNLGSGPASLRS---PQKINDGKWHTVSVSRNGRNGSLSVDGEEV 76 (131)
T ss_dssp SSSEEEEEEESSTTSSEEEEEEETTEEEEEEESSSEEEEEEE---SSETTSSSEEEEEEEEETTEEEEEETTSEE
T ss_pred CCCceEEECCcCCCCCEEEEEEECCEEEEEEeCCCccceecC---CCccCCCcceEEEEEEcCcEEEEEECCccc
Confidence 34567999876 55999999999999999999999876543 245999999999999999999999999876
|
The laminin globular (G) domain can be found in one to several copies in various laminin family members, which includes a large number of extracellular proteins. The C terminus of laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin []. Laminin G domains can vary in their function, and a variety of binding functions has been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each has five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012680 from INTERPRO).; PDB: 1OKQ_A 1DYK_A 2C5D_A 1H30_A 1LHW_A 1KDK_A 1LHU_A 1KDM_A 1LHO_A 1D2S_A .... |
| >smart00282 LamG Laminin G domain | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans | Back alignment and domain information |
|---|
| >PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >smart00210 TSPN Thrombospondin N-terminal -like domains | Back alignment and domain information |
|---|
| >PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >smart00159 PTX Pentraxin / C-reactive protein / pentaxin family | Back alignment and domain information |
|---|
| >cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00560 LamGL LamG-like jellyroll fold domain | Back alignment and domain information |
|---|
| >PF14099 Polysacc_lyase: Polysaccharide lyase; PDB: 3ILR_A 3IKW_A 3INA_A 3IMN_A 3IN9_A 2ZZJ_A | Back alignment and domain information |
|---|
| >PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 126 | ||||
| 2h0b_A | 184 | Crystal Structure Of The Second LnsLG DOMAIN FROM N | 2e-06 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 3e-06 | ||
| 3r05_A | 1254 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 5e-06 | ||
| 3qcw_A | 1245 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 5e-06 |
| >pdb|2H0B|A Chain A, Crystal Structure Of The Second LnsLG DOMAIN FROM NEUREXIN 1 ALPHA Length = 184 | Back alignment and structure |
|
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 | Back alignment and structure |
| >pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 126 | |||
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 7e-09 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 2e-08 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-07 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-06 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 7e-06 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-05 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 1e-04 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 5e-08 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 1e-07 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 1e-07 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 4e-06 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 4e-06 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 2e-07 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 9e-05 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 2e-07 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 3e-07 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 5e-07 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 3e-07 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 4e-07 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 5e-07 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 6e-07 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 3e-06 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 4e-06 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 5e-06 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 1e-05 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 2e-05 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-04 |
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 | Back alignment and structure |
|---|
Score = 50.2 bits (120), Expect = 7e-09
Identities = 17/56 (30%), Positives = 34/56 (60%)
Query: 14 SDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGT 69
+DY+N+A+K+G V++ + L G + + P +F+DN WH + + R +++ T
Sbjct: 49 GKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVT 104
|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 | Back alignment and structure |
|---|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| 2h0b_A | 184 | Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A | 99.72 | |
| 3bod_A | 178 | Neurexin-1-alpha; neurexin1D, LNS6, alternative sp | 99.68 | |
| 2r16_A | 182 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sp | 99.67 | |
| 1pz7_A | 204 | Agrin; structural protein; 1.42A {Gallus gallus} S | 99.67 | |
| 1d2s_A | 170 | SHBG, sex hormone-binding globulin; steroid transp | 99.66 | |
| 3v64_A | 191 | Low-density lipoprotein receptor-related protein; | 99.64 | |
| 2r1b_A | 220 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.64 | |
| 1f5f_A | 205 | SHBG, sex hormone-binding globulin; jellyroll, sig | 99.64 | |
| 3sh4_A | 195 | LG3 peptide; actin disassambly, integrin alpha12 B | 99.63 | |
| 2r1d_A | 226 | Neurexin-1-beta, neurexin I-beta; beta-sandwich, c | 99.61 | |
| 3pve_A | 189 | Agrin, AGRN protein; mRNA splicing, structural gen | 99.61 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.56 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.55 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.52 | |
| 2jd4_A | 383 | Laminin subunit alpha-1; basement membrane protein | 99.51 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.51 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.49 | |
| 1dyk_A | 394 | Laminin alpha 2 chain; metal binding protein; 2.0A | 99.45 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.45 | |
| 2wjs_A | 608 | Laminin subunit alpha-2; integrin, secreted, coile | 99.4 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 99.36 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 99.3 | |
| 1h30_A | 422 | GAS6, growth-arrest-specific protein; laminin G-do | 99.04 | |
| 2erf_A | 209 | Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug | 97.6 | |
| 1za4_A | 251 | Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel | 97.48 | |
| 2uur_A | 245 | Collagen alpha-1(IX) chain; glycoprotein, hydroxyl | 97.41 | |
| 2v73_A | 191 | CBM40, putative EXO-alpha-sialidase; carbohydrate- | 96.49 | |
| 4b1m_A | 185 | Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil | 94.41 | |
| 3flp_A | 217 | SAP-like pentraxin; physiological doubly-stacked h | 93.26 | |
| 3kqr_A | 204 | Serum amyloid P-component; glycoprotein, disulfide | 92.55 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 92.55 | |
| 3pvn_A | 206 | C-reactive protein; pentraxin family, immune syste | 90.6 | |
| 4dqa_A | 355 | Uncharacterized protein; two domains structure, DU | 88.69 | |
| 2sli_A | 679 | Intramolecular trans-sialidase; hydrolase, neurami | 87.95 | |
| 2jkb_A | 686 | Sialidase B; intramolecular trans-sialidase, lyase | 86.72 | |
| 3zr5_A | 656 | Galactocerebrosidase; hydrolase, GALC, glycosyl hy | 82.3 | |
| 4azz_A | 172 | Levanase; hydrolase; 1.70A {Bacillus subtilis} | 80.85 |
| >2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} | Back alignment and structure |
|---|
Probab=99.72 E-value=4.2e-17 Score=120.95 Aligned_cols=77 Identities=26% Similarity=0.501 Sum_probs=67.2
Q ss_pred eEEeeece-----eeecCCCCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEecccc
Q psy6121 2 LTLSTDCW-----LGDGSDGSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKEEE 76 (126)
Q Consensus 2 IS~sfrtl-----LLyaG~~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~~~ 76 (126)
|+|.|+|. |||.++..|||+|+|.+|+|.+.+++|+|+....+.++...+|||+||+|.+.|+.+.++|+||+..
T Consensus 32 isl~frT~~~~GlLl~~g~~~d~l~l~L~~G~l~~~~~~G~g~~~~~~~~~~~~l~Dg~WH~V~v~r~~~~~~L~VD~~~ 111 (184)
T 2h0b_A 32 ITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNGKFNDNAWHDVKVTRNLRQVTISVDGIL 111 (184)
T ss_dssp EEEEEEESCSCEEEEEECCTTEEEEEEEETTEEEEEEEESSCEEEEEECCSSSCSSSSSCEEEEEEEETTEEEEEETTTE
T ss_pred EEEEEEeCCCCEEEEEeCCCCCEEEEEEECCEEEEEEECCCCeEEEEEecCCcccCCCCeEEEEEEEeCCEEEEEEcCce
Confidence 68888875 9998888899999999999999999999986544445567899999999999999999999999876
Q ss_pred cc
Q psy6121 77 KK 78 (126)
Q Consensus 77 ~~ 78 (126)
..
T Consensus 112 ~~ 113 (184)
T 2h0b_A 112 TT 113 (184)
T ss_dssp EE
T ss_pred ee
Confidence 44
|
| >3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* | Back alignment and structure |
|---|
| >2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} | Back alignment and structure |
|---|
| >1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A | Back alignment and structure |
|---|
| >1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* | Back alignment and structure |
|---|
| >3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A | Back alignment and structure |
|---|
| >2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* | Back alignment and structure |
|---|
| >1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* | Back alignment and structure |
|---|
| >3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A | Back alignment and structure |
|---|
| >2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* | Back alignment and structure |
|---|
| >3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* | Back alignment and structure |
|---|
| >2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A | Back alignment and structure |
|---|
| >1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A | Back alignment and structure |
|---|
| >2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} | Back alignment and structure |
|---|
| >2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} | Back alignment and structure |
|---|
| >4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A | Back alignment and structure |
|---|
| >3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A | Back alignment and structure |
|---|
| >3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A | Back alignment and structure |
|---|
| >4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* | Back alignment and structure |
|---|
| >2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* | Back alignment and structure |
|---|
| >3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* | Back alignment and structure |
|---|
| >4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 126 | ||||
| d1dyka2 | 185 | b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse | 4e-06 | |
| d1h30a1 | 191 | b.29.1.4 (A:261-451) Growth-arrest-specific protei | 7e-05 | |
| d1d2sa_ | 170 | b.29.1.4 (A:) Sex hormone-binding globulin {Human | 1e-04 | |
| d1h30a2 | 218 | b.29.1.4 (A:461-678) Growth-arrest-specific protei | 2e-04 | |
| d1dyka1 | 189 | b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse | 0.002 |
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Laminin alpha2 chain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 41.7 bits (97), Expect = 4e-06
Identities = 10/61 (16%), Positives = 22/61 (36%), Gaps = 1/61 (1%)
Query: 10 LGDGSDGSDYLNVAIKDGGVAINLKLAMGKLD-MYIRPNRLRFDDNQWHHLSIHRRIQEG 68
LG S D + + + D + ++ G+ +Y + QWH ++ +
Sbjct: 42 LGVSSQKMDGMGIEMIDEKLMFHVDNGAGRFTAIYDAEIPGHMCNGQWHKVTAKKIKNRL 101
Query: 69 T 69
Sbjct: 102 E 102
|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 126 | |||
| d1dyka1 | 189 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.61 | |
| d1h30a1 | 191 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.59 | |
| d1dyka2 | 185 | Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: | 99.58 | |
| d1pz7a_ | 195 | Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.58 | |
| d1d2sa_ | 170 | Sex hormone-binding globulin {Human (Homo sapiens) | 99.57 | |
| d2r1da1 | 177 | Ligand-binding domain of neurexin 1beta {Rat (Ratt | 99.57 | |
| d1h30a2 | 218 | Growth-arrest-specific protein Gas6 {Human (Homo s | 99.18 | |
| d2erfa1 | 206 | Thrombospondin 1 N-terminal domain {Human (Homo sa | 97.56 | |
| d2slia1 | 196 | Leech intramolecular trans-sialidase, N-terminal d | 95.38 | |
| d1epwa1 | 218 | Botulinum neurotoxin {Clostridium botulinum, serot | 94.73 | |
| d3btaa1 | 207 | Botulinum neurotoxin {Clostridium botulinum, serot | 94.16 | |
| d1a8da1 | 247 | Tetanus neurotoxin {Clostridium tetani [TaxId: 151 | 93.86 | |
| d1b09a_ | 206 | C-reactive protein (CRP) {Human (Homo sapiens) [Ta | 92.74 | |
| d1saca_ | 204 | Serum amyloid P component (SAP) {Human (Homo sapie | 91.44 | |
| d1oq1a_ | 223 | Hypothetical protein YesU {Bacillus subtilis [TaxI | 83.62 |
| >d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Laminin G-like module domain: Laminin alpha2 chain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.61 E-value=1.7e-15 Score=111.32 Aligned_cols=74 Identities=22% Similarity=0.305 Sum_probs=63.6
Q ss_pred eEEeeece-----eeecCC--CCCeEEEEEeCCEEEEEEEcCCceEEEEEcCCCcccCCCCceEEEEEEeceeEEEEecc
Q psy6121 2 LTLSTDCW-----LGDGSD--GSDYLNVAIKDGGVAINLKLAMGKLDMYIRPNRLRFDDNQWHHLSIHRRIQEGTGCGKE 74 (126)
Q Consensus 2 IS~sfrtl-----LLyaG~--~~DFIaLeL~~G~L~l~~nlGsG~~~~~i~~s~~~lnDgqWH~V~v~R~~r~~sL~vd~ 74 (126)
|+|.|+|. |||.++ ..|||+|+|.+|+|.+.+++|+++..+. +...+|||+||+|.+.|..+.++|.||+
T Consensus 42 i~~~frT~~~~GlL~~~~~~~~~dfi~l~l~~G~l~~~~~~g~~~~~~~---~~~~v~Dg~WH~V~v~~~~~~~~l~VD~ 118 (189)
T d1dyka1 42 IELEVRTEAESGLLFYMARINHADFATVQLRNGFPYFSYDLGSGDTSTM---IPTKINDGQWHKIKIVRVKQEGILYVDD 118 (189)
T ss_dssp EEEEEEECCSCEEEEEEECTTSSSEEEEEEETTEEEEEEESSSCEEEEE---CCSCCCSSSCEEEEEEEETTEEEEEETT
T ss_pred EEEEEEECCCCEEEEEEcCCCCCcEEEEEEECCEEEEEEECCCccEEec---CCcEeeCCCEEEEEEEEcccEEEEEECC
Confidence 78889875 888754 6699999999999999999999886543 2467999999999999999999999998
Q ss_pred cccc
Q psy6121 75 EEKK 78 (126)
Q Consensus 75 ~~~~ 78 (126)
....
T Consensus 119 ~~~~ 122 (189)
T d1dyka1 119 ASSQ 122 (189)
T ss_dssp EEEE
T ss_pred ccee
Confidence 7543
|
| >d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} | Back information, alignment and structure |
|---|
| >d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} | Back information, alignment and structure |
|---|
| >d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} | Back information, alignment and structure |
|---|
| >d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|