Psyllid ID: psy6137


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MRKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKEEEKEEKRKKKEE
cccccEEEEEEcEEEEEccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHcc
cccEEEEEEEEEEEEEEccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHccc
MRKEEKEKEIGIVLVAInpytelpiygsntiwtyrgknmgdldpHIFAVAEEAYTKmesrqpsidevnlyEKEEEEKEKKEEEKEEKRKKKEE
mrkeekekeIGIVLvainpytelpiYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKmesrqpsidevnlyekeeeekekkeeekeekrkkkee
MRKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYekeeeekekkeeekeekrkkkee
*********IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAY***************************************
*RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEE*****************
********EIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYE**********************
MRKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSID***L************************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q9ULV0 1848 Unconventional myosin-Vb yes N/A 0.516 0.025 0.75 6e-18
P21271 1818 Unconventional myosin-Vb yes N/A 0.516 0.026 0.729 2e-17
P70569 1846 Unconventional myosin-Vb yes N/A 0.516 0.026 0.729 3e-17
Q9Y4I1 1855 Unconventional myosin-Va no N/A 0.516 0.025 0.729 4e-16
Q99104 1853 Unconventional myosin-Va no N/A 0.516 0.025 0.729 4e-16
Q9QYF3 1828 Unconventional myosin-Va no N/A 0.516 0.026 0.729 4e-16
Q02440 1829 Unconventional myosin-Va no N/A 0.516 0.026 0.729 4e-16
Q9NQX4 1742 Unconventional myosin-Vc no N/A 0.580 0.030 0.642 7e-16
P54697 2245 Myosin-J heavy chain OS=D yes N/A 0.516 0.021 0.562 6e-12
Q27991 1976 Myosin-10 OS=Bos taurus G no N/A 0.505 0.023 0.510 3e-09
>sp|Q9ULV0|MYO5B_HUMAN Unconventional myosin-Vb OS=Homo sapiens GN=MYO5B PE=1 SV=3 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (87%)

Query: 10  IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
            GIVLVAINPY +LPIYG + I+TY G+NMGD+DPHIFAVAEEAY +M
Sbjct: 103 CGIVLVAINPYEQLPIYGQDVIYTYSGQNMGDMDPHIFAVAEEAYKQM 150




May be involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. Required in a complex with RAB11A and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Together with RAB11A participates in CFTR trafficking to the plasma membrane and TF (transferrin) recycling in nonpolarized cells. Together with RAB11A and RAB8A participates in epithelial cell polarization. Together with RAB25 regulates transcytosis.
Homo sapiens (taxid: 9606)
>sp|P21271|MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus GN=Myo5b PE=2 SV=2 Back     alignment and function description
>sp|P70569|MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus GN=Myo5b PE=1 SV=1 Back     alignment and function description
>sp|Q9Y4I1|MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens GN=MYO5A PE=1 SV=2 Back     alignment and function description
>sp|Q99104|MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus GN=Myo5a PE=1 SV=2 Back     alignment and function description
>sp|Q9QYF3|MYO5A_RAT Unconventional myosin-Va OS=Rattus norvegicus GN=Myo5a PE=1 SV=1 Back     alignment and function description
>sp|Q02440|MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus GN=MYO5A PE=1 SV=1 Back     alignment and function description
>sp|Q9NQX4|MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens GN=MYO5C PE=1 SV=2 Back     alignment and function description
>sp|P54697|MYOJ_DICDI Myosin-J heavy chain OS=Dictyostelium discoideum GN=myoJ PE=4 SV=2 Back     alignment and function description
>sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus GN=MYH10 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
156546679 1826 PREDICTED: myosin-Va [Nasonia vitripenni 0.526 0.026 0.795 4e-18
307215244 1859 Myosin-Va [Harpegnathos saltator] 0.526 0.026 0.795 5e-18
350426534 1851 PREDICTED: myosin-Va-like [Bombus impati 0.526 0.026 0.795 5e-18
340723794 1851 PREDICTED: myosin-Va-like [Bombus terres 0.526 0.026 0.795 5e-18
383855428 1796 PREDICTED: unconventional myosin-Va [Meg 0.526 0.027 0.795 6e-18
380013651 1852 PREDICTED: LOW QUALITY PROTEIN: unconven 0.526 0.026 0.795 6e-18
328778355 1784 PREDICTED: LOW QUALITY PROTEIN: myosin-V 0.526 0.027 0.795 7e-18
307185093 1832 Myosin-Va [Camponotus floridanus] 0.526 0.026 0.775 6e-17
270010527 1778 hypothetical protein TcasGA2_TC009935 [T 0.559 0.029 0.769 8e-17
91087053 1832 PREDICTED: similar to myosin VA (heavy p 0.559 0.028 0.769 8e-17
>gi|156546679|ref|XP_001604064.1| PREDICTED: myosin-Va [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 95.1 bits (235), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 44/49 (89%)

Query: 10  IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKME 58
            GIVLVA NPY ELPIYG++TIW YRG+ MGDL+PHIFAVAEEAYTK+E
Sbjct: 102 CGIVLVAFNPYNELPIYGNDTIWAYRGQAMGDLEPHIFAVAEEAYTKLE 150




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307215244|gb|EFN90001.1| Myosin-Va [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350426534|ref|XP_003494466.1| PREDICTED: myosin-Va-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723794|ref|XP_003400273.1| PREDICTED: myosin-Va-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383855428|ref|XP_003703214.1| PREDICTED: unconventional myosin-Va [Megachile rotundata] Back     alignment and taxonomy information
>gi|380013651|ref|XP_003690864.1| PREDICTED: LOW QUALITY PROTEIN: unconventional myosin-Va-like [Apis florea] Back     alignment and taxonomy information
>gi|328778355|ref|XP_001122188.2| PREDICTED: LOW QUALITY PROTEIN: myosin-Va [Apis mellifera] Back     alignment and taxonomy information
>gi|307185093|gb|EFN71292.1| Myosin-Va [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270010527|gb|EFA06975.1| hypothetical protein TcasGA2_TC009935 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91087053|ref|XP_974649.1| PREDICTED: similar to myosin VA (heavy polypeptide 12, myoxin) [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
UNIPROTKB|F1NQW5278 MYO5C "Uncharacterized protein 0.505 0.169 0.723 2.3e-14
UNIPROTKB|F1PX69 596 MYO5B "Uncharacterized protein 0.505 0.078 0.744 2.6e-14
UNIPROTKB|H0YMK3269 MYO5C "Unconventional myosin-V 0.580 0.200 0.642 3e-14
UNIPROTKB|Q9ULV0 1848 MYO5B "Unconventional myosin-V 0.505 0.025 0.765 3.6e-14
UNIPROTKB|H0YM96153 MYO5C "Unconventional myosin-V 0.505 0.307 0.702 4.9e-14
UNIPROTKB|G3MZH3 654 G3MZH3 "Uncharacterized protei 0.580 0.082 0.678 8.2e-14
MGI|MGI:106598 1818 Myo5b "myosin VB" [Mus musculu 0.505 0.025 0.744 1.2e-13
UNIPROTKB|F1LUM1 1818 Myo5b "Unconventional myosin-V 0.505 0.025 0.744 1.2e-13
UNIPROTKB|F1PX71 1823 MYO5B "Uncharacterized protein 0.505 0.025 0.744 1.2e-13
UNIPROTKB|F1M3R4 1844 Myo5b "Unconventional myosin-V 0.505 0.025 0.744 1.2e-13
UNIPROTKB|F1NQW5 MYO5C "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 184 (69.8 bits), Expect = 2.3e-14, P = 2.3e-14
 Identities = 34/47 (72%), Positives = 39/47 (82%)

Query:    11 GIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
             GI+LVAINPY +LPIYG   I  Y G+NMGD+DPHIFAVAEEAY +M
Sbjct:   102 GIILVAINPYKQLPIYGDAIIHAYSGQNMGDMDPHIFAVAEEAYKQM 148




GO:0003774 "motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
UNIPROTKB|F1PX69 MYO5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YMK3 MYO5C "Unconventional myosin-Vc" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULV0 MYO5B "Unconventional myosin-Vb" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YM96 MYO5C "Unconventional myosin-Vc" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZH3 G3MZH3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:106598 Myo5b "myosin VB" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUM1 Myo5b "Unconventional myosin-Vb" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PX71 MYO5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3R4 Myo5b "Unconventional myosin-Vb" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ULV0MYO5B_HUMANNo assigned EC number0.750.51610.0259yesN/A
Q00647MYO1_EMENINo assigned EC number0.520.53760.0400yesN/A
Q4WC55MYO1_ASPFUNo assigned EC number0.540.53760.0400yesN/A
P21271MYO5B_MOUSENo assigned EC number0.72910.51610.0264yesN/A
Q2US45MYO1_ASPORNo assigned EC number0.520.53760.0396yesN/A
P54697MYOJ_DICDINo assigned EC number0.56250.51610.0213yesN/A
P70569MYO5B_RATNo assigned EC number0.72910.51610.0260yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 2e-21
smart00242 677 smart00242, MYSc, Myosin 3e-19
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 2e-16
cd00124 679 cd00124, MYSc, Myosin motor domain 2e-15
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 6e-14
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-13
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 3e-13
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 8e-13
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 5e-12
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 6e-12
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 3e-10
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 2e-09
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 3e-07
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 1e-05
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 2e-05
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 0.001
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
 Score = 86.2 bits (214), Expect = 2e-21
 Identities = 32/48 (66%), Positives = 36/48 (75%)

Query: 11 GIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKME 58
          GIVLVAINPY  LPIYG   I  Y G+  G+LDPHIFA+AEEAY +M 
Sbjct: 34 GIVLVAINPYARLPIYGEEIIQAYSGQRKGELDPHIFAIAEEAYKQMT 81


Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 691

>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
KOG0161|consensus 1930 99.93
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 99.93
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 99.93
COG5022 1463 Myosin heavy chain [Cytoskeleton] 99.93
PTZ00014 821 myosin-A; Provisional 99.92
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 99.92
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 99.92
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 99.92
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 99.92
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 99.92
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 99.92
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 99.91
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 99.91
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 99.91
KOG0164|consensus 1001 99.9
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 99.9
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 99.9
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 99.89
KOG0162|consensus 1106 99.88
KOG0163|consensus 1259 99.85
KOG0160|consensus 862 99.75
KOG4229|consensus 1062 99.64
cd01363 186 Motor_domain Myosin and Kinesin motor domain. Thes 93.69
KOG0925|consensus 699 91.29
PF0249559 7kD_coat: 7kD viral coat protein; InterPro: IPR003 81.69
>KOG0161|consensus Back     alignment and domain information
Probab=99.93  E-value=9.8e-27  Score=200.50  Aligned_cols=77  Identities=35%  Similarity=0.566  Sum_probs=72.6

Q ss_pred             CCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhhH
Q psy6137           3 KEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKEE   82 (93)
Q Consensus         3 ~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~~   82 (93)
                      .+.||||+|++||+||||+++|||++.++..|.|+++.++|||||+||+.||++|+.++.||||+|  +||||. ||-+-
T Consensus       108 ~~lIyTYSGLFcVviNPyk~lpiYt~~v~~~ykgkrr~e~pPHIfavad~AYr~mL~~renQSiLi--TGESGA-GKTeN  184 (1930)
T KOG0161|consen  108 SDLIYTYSGLFCVVINPYKRLPIYTESVVRMYKGKKREEMPPHIFAVADEAYRNMLQDRENQSILI--TGESGA-GKTEN  184 (1930)
T ss_pred             hChHHHcccceeEEecCCcCCCCCCHHHHHHhcccccccCCchHHHHHHHHHHHHHhcCCCceEee--ecCCCC-Ccchh
Confidence            589999999999999999999999999999999999999999999999999999999999999987  999997 55443



>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF02495 7kD_coat: 7kD viral coat protein; InterPro: IPR003411 This family consists of a 7 kDa coat protein from Carlavirus and Potexvirus [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 2e-16
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 3e-16
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 3e-16
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 3e-09
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 3e-09
2x51_A 789 M6 Delta Insert1 Length = 789 3e-09
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 3e-09
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 3e-09
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 3e-09
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 3e-09
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 3e-09
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 3e-09
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 3e-09
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 3e-09
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 4e-09
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 7e-09
1b7t_A 835 Myosin Digested By Papain Length = 835 8e-09
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 8e-09
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 8e-09
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 8e-09
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 8e-09
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 8e-09
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 3e-08
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 6e-08
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 7e-08
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 8e-08
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 9e-08
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 9e-08
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 2e-07
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 2e-07
2w4a_M 840 Isometrically Contracting Insect Asynchronous Fligh 5e-07
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 8e-07
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 9e-07
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 9e-07
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 1e-06
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 1e-06
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-06
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-06
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 1e-06
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 1e-06
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-06
2y0r_X 758 Structural Basis For The Allosteric Interference Of 1e-06
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-06
2y9e_X 758 Structural Basis For The Allosteric Interference Of 1e-06
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 1e-06
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 1e-06
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 1e-06
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 1e-06
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-06
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-06
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-06
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 1e-06
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 1e-06
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-06
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-06
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 2e-06
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-06
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 3e-06
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 2e-05
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 2e-05
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure

Iteration: 1

Score = 80.9 bits (198), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 38/57 (66%), Positives = 44/57 (77%), Gaps = 2/57 (3%) Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM--ESRQPSI 64 GIVLVAINPY +LPIYG + I Y G+NMGD+DPHIFAVAEEAY +M + R SI Sbjct: 103 CGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSI 159
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|2W4A|M Chain M, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 840 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 2e-22
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 2e-22
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 7e-22
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 1e-21
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 1e-20
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-20
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 5e-20
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 1e-18
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-18
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-13
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
 Score = 88.8 bits (221), Expect = 2e-22
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESR 60
          IG V+++ NP+  L IY  + I  Y G+   ++ PH++A+A +AY  M   
Sbjct: 41 IGDVVISTNPFKNLNIYKESDIKAYNGRYKYEMPPHMYALANDAYRSMRQS 91


>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 99.93
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 99.93
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.93
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 99.93
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 99.93
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.93
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 99.93
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.93
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.93
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 99.93
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.93
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
Probab=99.93  E-value=8e-27  Score=189.18  Aligned_cols=80  Identities=28%  Similarity=0.445  Sum_probs=74.2

Q ss_pred             CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137           2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE   81 (93)
Q Consensus         2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~   81 (93)
                      .+++||||+|++|||||||+++|+|++.++..|+++...++|||||++|++||+.|+++++||||||  |||||. ||-|
T Consensus       110 ~~~~IYTy~G~iLvavNPyk~l~iY~~~~~~~Y~g~~~~~~pPHifaiA~~Ay~~m~~~~~nQsIii--SGESGA-GKTe  186 (783)
T 4db1_A          110 GSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILI--TGESGA-GKTV  186 (783)
T ss_dssp             HTTCCEEEETTEEEEECCSSCCSCSSHHHHHHHTTCCGGGSCCCHHHHHHHHHHHHHHHTCCEEEEE--ECSTTS-SHHH
T ss_pred             cCCceEEecCceeEecCCCccCCCCCHHHHHHhcCCCcCCCCchhhHHHHHHHHHHHhhCCCceEEE--eCCCCC-CCch
Confidence            3689999999999999999999999999999999999999999999999999999999999999987  999996 6655


Q ss_pred             HHH
Q psy6137          82 EEK   84 (93)
Q Consensus        82 ~~~   84 (93)
                      --|
T Consensus       187 ~tK  189 (783)
T 4db1_A          187 NTK  189 (783)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            443



>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 1e-19
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 2e-19
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 5e-19
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 6e-19
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 2e-18
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 3e-18
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), Va isoform [TaxId: 9031]
 Score = 79.4 bits (195), Expect = 1e-19
 Identities = 35/52 (67%), Positives = 41/52 (78%)

Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQ 61
           GIVLVAINPY +LPIYG + I  Y G+NMGD+DPHIFAVAEEAY +M   +
Sbjct: 41 CGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDE 92


>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 99.93
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.92
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 99.92
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 99.92
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 99.92
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 99.91
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.93  E-value=1.4e-26  Score=184.30  Aligned_cols=79  Identities=27%  Similarity=0.510  Sum_probs=73.3

Q ss_pred             CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137           2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE   81 (93)
Q Consensus         2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~   81 (93)
                      .+|+||||+|++|||||||+.+|+|+++++..|+++...++|||||++|++||+.|+.+++|||||+  |||||. ||-|
T Consensus        64 ~~~~iYT~~G~iLiavNP~k~l~iy~~~~~~~y~~~~~~~~~PHifaiA~~Ay~~m~~~~~nQsIii--sGeSGa-GKTe  140 (712)
T d1d0xa2          64 NQDLIYTYSGLFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLI--TGESGA-GKTE  140 (712)
T ss_dssp             HTTCCEEEETTEEEEECCSSCCSCCSHHHHHHHTTCCGGGSCCCHHHHHHHHHHHHHHHTCCEEEEE--ECSTTS-SHHH
T ss_pred             cCCCceeeECCEEEEECCCCCCCCCCHHHHHHHcCCCcCCCCCcHHHHHHHHHHHHHHhCCCceEEE--eCCCCC-CHHH
Confidence            4789999999999999999999999999999999999999999999999999999999999999987  999997 5554


Q ss_pred             HH
Q psy6137          82 EE   83 (93)
Q Consensus        82 ~~   83 (93)
                      --
T Consensus       141 ~~  142 (712)
T d1d0xa2         141 NT  142 (712)
T ss_dssp             HH
T ss_pred             HH
Confidence            43



>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure