May be involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation. Required in a complex with RAB11A and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Together with RAB11A participates in CFTR trafficking to the plasma membrane and TF (transferrin) recycling in nonpolarized cells. Together with RAB11A and RAB8A participates in epithelial cell polarization. Together with RAB25 regulates transcytosis. Homo sapiens (taxid: 9606)
May be involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation (By similarity). Required in a complex with RAB11A and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane (By similarity). Together with RAB11A participates in CFTR trafficking to the plasma membrane and TF (transferrin) recycling in nonpolarized cells (By similarity). Together with RAB11A and RAB8A participates in epithelial cell polarization (By similarity). Together with RAB25 regulates transcytosis.
May be involved in vesicular trafficking via its association with the CART complex. The CART complex is necessary for efficient transferrin receptor recycling but not for EGFR degradation (By similarity). Required in a complex with RAB11A and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane (By similarity). Together with RAB11A participates in CFTR trafficking to the plasma membrane and TF (transferrin) recycling in nonpolarized cells (By similarity). Together with RAB11A and RAB8A participates in epithelial cell polarization (By similarity). Together with RAB25 regulates transcytosis.
Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. May also be required for some polarization process involved in dendrite formation.
Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. May also be required for some polarization process involved in dendrite formation.
Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. Involved in melanosome transport. May also be required for some polarization process involved in dendrite formation.
Processive actin-based motor that can move in large steps approximating the 36-nm pseudo-repeat of the actin filament. May be involved in melanosome transport, or alternatively, it may be required for some polarization process involved in dendrite formation.
Score = 69.3 bits (168), Expect = 6e-12, Method: Compositional matrix adjust.
Identities = 27/48 (56%), Positives = 35/48 (72%)
Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
IG +L+AINPYT LP+YG I Y GK +G L PH++AVAE+A+ M
Sbjct: 114 IGKILIAINPYTSLPLYGKEMISAYYGKQLGTLAPHVYAVAEDAFKDM 161
Processive motor protein that can move over long distances along F-actin without disassociating; processiveness depends on high physiological Mg(2+) concentrations. Presents a high actin affinity in the presence of ADP, fast ATP hydrolysis, and a high steady-state ATPase activity in the presence of actin that is rate limited by ADP release. Physiological decrease of free Mg(2+) ions leads to an increased rate of ADP release and shortening of the fraction of time it spends in the strong acting binding states.
Score = 60.5 bits (145), Expect = 3e-09, Method: Compositional matrix adjust.
Identities = 24/47 (51%), Positives = 30/47 (63%)
Query: 11 GIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
G+ V INPY LPIY N I YRGK ++ PHI+A++E AY M
Sbjct: 119 GLFCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCM 165
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2.
Bos taurus (taxid: 9913)
Close Homologs in the Non-Redundant Database Detected by BLAST
Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 691
Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin. Length = 677
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain)
Score = 69.6 bits (171), Expect = 2e-15
Identities = 25/48 (52%), Positives = 34/48 (70%)
Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
G +L+A+NPY +LP YG TI YRGK+ +L PH+FA+A+ AY M
Sbjct: 33 AGPILIAVNPYKDLPNYGPETIRKYRGKSRSELPPHVFAIADRAYRNM 80
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 679
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins
Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins
Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]
Score = 61.7 bits (150), Expect = 8e-13
Identities = 28/56 (50%), Positives = 40/56 (71%), Gaps = 4/56 (7%)
Query: 6 KEKEI----GIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM 57
K+K I G +LVA+NPY LPIY ++ I Y+ K++G+L PHIFA+++ AYT M
Sbjct: 25 KKKLIYTYTGSILVAVNPYQILPIYTADEIKLYKNKSIGELPPHIFAISDNAYTNM 80
Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 671
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport
Score = 59.7 bits (145), Expect = 5e-12
Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 3/58 (5%)
Query: 10 IGIVLVAINPYTELP-IYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKM--ESRQPSI 64
G +L+A+NP+ LP +Y + + Y+G +G+L PH+FA+A+ AY M E + SI
Sbjct: 34 TGNILIAVNPFQRLPHLYDVHMMEQYKGAALGELSPHVFAIADAAYRAMINEGKSQSI 91
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 674
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins
Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 717
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins
In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata
Score = 52.5 bits (126), Expect = 2e-09
Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 7/58 (12%)
Query: 11 GIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVN 68
G VLVA+NP+ E+P+YG++ I YR K+ PH++A+A+ AY +M DEVN
Sbjct: 42 GPVLVAVNPFKEVPLYGNDYIEAYRKKSND--SPHVYAIADTAYNEMMR-----DEVN 92
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 677
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins
Score = 46.0 bits (109), Expect = 3e-07
Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
Query: 10 IGIVLVAINPYTELPIYGSNTIWTYRG-KNMGDLDPHIFAVAEEAYTKM 57
G +LVA+NP+ LPIY + Y + +G L PHIFA+A+ AY M
Sbjct: 40 AGSILVAVNPFKFLPIYNPKYVRLYENQQRLGKLPPHIFAIADVAYYNM 88
Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins
Myosin III has been shown to play a role in the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 653
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 767
Myosins V transport a variety of intracellular cargo processively along actin filaments, such as membraneous organelles and mRNA. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an act
>cd01377 MYSc_type_II Myosin motor domain, type II myosins
Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydro
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the
>cd01378 MYSc_type_I Myosin motor domain, type I myosins
Probab=99.92 E-value=1.3e-25 Score=180.86 Aligned_cols=79 Identities=35% Similarity=0.573 Sum_probs=73.6
Q ss_pred CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137 2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE 81 (93)
Q Consensus 2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~ 81 (93)
.+|+||||+|++|||||||+++|+|++.++..|+++...++|||||++|++||+.|+.+++|||||| |||||. ||-|
T Consensus 25 ~~~~iYT~~G~iLiavNPy~~l~ly~~~~~~~Y~~~~~~~~~PHifaiA~~Ay~~m~~~~~~QsIii--sGESGa-GKTe 101 (674)
T cd01378 25 QNDLIYTYIGPVLISVNPFKQLPIYTDETIELYKGKSRYELPPHIYALADNAYRSMKSENENQCVII--SGESGA-GKTE 101 (674)
T ss_pred hcCCCeeccCCcEEEEcCCCCCCCCCHHHHHHHhCCCCCCCCCCHHHHHHHHHHHHHHcCCCceEEE--EcCCCC-Ccch
Confidence 4799999999999999999999999999999999999899999999999999999999999999987 999997 5555
Q ss_pred HH
Q psy6137 82 EE 83 (93)
Q Consensus 82 ~~ 83 (93)
--
T Consensus 102 ~~ 103 (674)
T cd01378 102 AA 103 (674)
T ss_pred HH
Confidence 43
Myosin I generates movement at the leading edge in cell motility, and class I myosins have been implicated in phagocytosis and vesicle transport. Myosin I, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 picon
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins
Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins
Probab=99.92 E-value=1.7e-25 Score=180.32 Aligned_cols=79 Identities=32% Similarity=0.569 Sum_probs=73.4
Q ss_pred CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137 2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE 81 (93)
Q Consensus 2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~ 81 (93)
.+|+||||+|++|||||||+.+|+|+++++..|++....++|||||++|++||+.|+.+++|||||| |||||. ||-|
T Consensus 26 ~~~~iYT~~G~iLiavNP~k~l~ly~~~~~~~Y~~~~~~~~~PHifavA~~Ay~~m~~~~~~QsIii--sGESGa-GKTe 102 (677)
T cd01387 26 ERNLIYTYIGSILVSVNPYKMFPIYGPEQVQQYAGRALGENPPHLFAIANLAFAKMLDAKQNQCVII--SGESGS-GKTE 102 (677)
T ss_pred cCCCCeEeECCEEEEECCCCCCCCCCHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHHhcCCCceEEE--EcCCCC-Ceeh
Confidence 5799999999999999999999999999999999998889999999999999999999999999987 999996 5554
Q ss_pred HH
Q psy6137 82 EE 83 (93)
Q Consensus 82 ~~ 83 (93)
--
T Consensus 103 ~~ 104 (677)
T cd01387 103 AT 104 (677)
T ss_pred HH
Confidence 43
In vertebrates, myosin XV appears to be expressed in sensory tissue and play a role in hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis caus
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins
Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the hea
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new act
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril
Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. The globular head is well conserved, some highly-conserved regions possibly relating to functional and structural domains []. The rod-like tail starts with an invariant proline residue, and contains many repeats of a 28 residue region, interrupted at 4 regularly-spaced points known as skip residues. Although the sequence of the tail is not well conserved, the chemical character is, hydrophobic, charged and skip residues occuring in a highly ordered and repeated fashion [].; GO: 0003774 motor activity, 0005524 ATP binding, 0016459 myosin complex; PDB: 1LKX_A 2V26_A 2BKI_A 3L9I_A 2BKH_A 2X51_A 2VB6_A 2VAS_A 1OE9_A 1W8J_A ....
Probab=99.91 E-value=9.9e-25 Score=175.82 Aligned_cols=79 Identities=37% Similarity=0.633 Sum_probs=73.5
Q ss_pred CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137 2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE 81 (93)
Q Consensus 2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~ 81 (93)
.+|+||||+|++|||||||+.+++|+++++..|+++...++|||||++|++||+.|+.+++|||||| |||||. ||-|
T Consensus 25 ~~~~iYT~~G~iLiavNPy~~l~~y~~~~~~~y~~~~~~~~pPHifavA~~Ay~~m~~~~~~QsIii--sGESGa-GKTe 101 (679)
T cd00124 25 KKDLIYTYAGPILIAVNPYKDLPNYGPETIRKYRGKSRSELPPHVFAIADRAYRNMLRDRRNQSIII--SGESGA-GKTE 101 (679)
T ss_pred cCCCCeEeECCEEEEECCCCCCCCCCHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHhcCCCceEEE--ecCCCC-CchH
Confidence 4789999999999999999999999999999999998899999999999999999999999999987 999997 5555
Q ss_pred HH
Q psy6137 82 EE 83 (93)
Q Consensus 82 ~~ 83 (93)
--
T Consensus 102 ~~ 103 (679)
T cd00124 102 NT 103 (679)
T ss_pred HH
Confidence 43
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the fila
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins
Myosin VI is a monomeric myosin, which moves towards the minus-end of actin filaments, in contrast to most other myosins. It has been implicated in endocytosis, secretion, and cell migration. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the minus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of
Probab=99.90 E-value=2.3e-24 Score=173.71 Aligned_cols=79 Identities=41% Similarity=0.666 Sum_probs=73.3
Q ss_pred CCCCceeeecccEEEeCCCCCCCCCchHHHHHhhCCCCCCCChhHHHhHHHHHHHHHhcCCCceEEEeccCCcchhhhhh
Q psy6137 2 RKEEKEKEIGIVLVAINPYTELPIYGSNTIWTYRGKNMGDLDPHIFAVAEEAYTKMESRQPSIDEVNLYEKEEEEKEKKE 81 (93)
Q Consensus 2 ~~~~iYT~~G~iLIaVNP~k~l~iY~~~~~~~y~~~~~~~lpPHiyaiA~~Ay~~m~~~~~nQsIvi~~sGESg~~~~~~ 81 (93)
.+|+|||++|++|||||||+.+++|++.++..|++....++|||||++|++||+.|+.+++|||||| |||||. ||-|
T Consensus 31 ~~~~iYT~~G~iLiavNP~~~l~~y~~~~~~~y~~~~~~~~~PHifavA~~Ay~~m~~~~~~QsIii--sGESGa-GKTe 107 (677)
T smart00242 31 LKDLIYTYIGLVLVAVNPYKQLPIYTDEVIKKYRGKSRGELPPHVFAIADNAYRNMLNDKENQSIII--SGESGA-GKTE 107 (677)
T ss_pred hhCCccccccceEEEecCCccCCCCCHHHHHHccCCCCCCCCCCHHHHHHHHHHHHHhcCCCceEEE--ecCCCC-cchH
Confidence 4689999999999999999999999999999999998889999999999999999999999999987 999997 5555
Q ss_pred HH
Q psy6137 82 EE 83 (93)
Q Consensus 82 ~~ 83 (93)
--
T Consensus 108 ~~ 109 (677)
T smart00242 108 NT 109 (677)
T ss_pred HH
Confidence 43
Large ATPases. ATPase; molecular motor. Muscle contraction consists of a cyclical interaction between myosin and actin. The core of the myosin structure is similar in fold to that of kinesin.
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates f
>cd01379 MYSc_type_III Myosin motor domain, type III myosins
Myosin III has been shown to play a role in the vision process in insects and in hearing in mammals. Myosin III, an unconventional myosin, does not form dimers. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1
