Psyllid ID: psy6207


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820---
MECVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
ccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEccccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEccccEEEccccccccc
ccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccc
mecvpvctdecirgtciapntckcevgfggptcniakdaktkptdtytfrlmfpqcmdpcpegtwgkqcvhycscpvesmecsridgncscppgfrgakckertcpdglygegcdrtcecnventklcvpvctdecirgtciapntckcevgfggptcniecpeghygpdcklacqcengagcdpntgacdcldgymgthceevcgpgrfgqncsqecqcrngaechpatgecscqpgftgslceercppgthgpscinrcrcqngaicnpangqclcapgwmgsvcnvpctpgmwgqgctvpcecfngaschhvtgecqcepgfkgqkcmdpcpegtwgkqcvhycscpvesmecsridgncscppgfrgakckertcpdglygegcdrtcecnventklchavtgkcecgpgwdgltcdrpcpitrwgdncsqhcnckndalcfprngtntyQYFFLQSLTLFTflslthsgfsgrhcekpcpqgsygqdcsqtclcskegsascspgsgqcvcrpggagqlcdrpcsegrygqnctqecrcmngaacnpqdgtclcpagyygplcqkrcefmtygrncaqactcftensqgcdivtgkcicrpgfkghrcetqcsnpntygedcsldcgcnnggtcnqldggcncgrgyqgklctapcpegqygynckeecltkgqdvpvrTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLReceercppgthgpscinrcrcqngaicnpangqclcapgwmgsvcnvpctpgmwgqgctvpcecfngaschhvtgecqcepgfkgqk
mecvpvctdecirgtciapntcKCEVGFGgptcniakdaktKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFtensqgcdiVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKvhmginarryvNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERcppgthgpscinRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGEcqcepgfkgqk
MECVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYfflqsltlftflslthsgfsGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
**CVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCS***********GQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQC********
MECVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFK***
MECVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCL**************QCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
**CVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKTKPTDTYTFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query823 2.2.26 [Sep-21-2011]
A6BM72 1044 Multiple epidermal growth yes N/A 0.825 0.650 0.418 1e-142
Q80T91 1091 Multiple epidermal growth yes N/A 0.825 0.622 0.421 1e-140
Q96KG7 1140 Multiple epidermal growth no N/A 0.801 0.578 0.392 1e-137
Q6DIB5 1147 Multiple epidermal growth no N/A 0.801 0.575 0.390 1e-137
A0JM12 1114 Multiple epidermal growth yes N/A 0.815 0.602 0.411 1e-136
O882811574 Multiple epidermal growth no N/A 0.890 0.465 0.358 1e-113
Q80V701572 Multiple epidermal growth no N/A 0.842 0.440 0.367 1e-110
O750951541 Multiple epidermal growth no N/A 0.922 0.492 0.361 1e-109
Q8VIK5 1034 Platelet endothelial aggr no N/A 0.645 0.513 0.396 2e-98
Q5VY43 1037 Platelet endothelial aggr no N/A 0.782 0.621 0.364 1e-95
>sp|A6BM72|MEG11_HUMAN Multiple epidermal growth factor-like domains protein 11 OS=Homo sapiens GN=MEGF11 PE=2 SV=3 Back     alignment and function desciption
 Score =  505 bits (1301), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 297/709 (41%), Positives = 389/709 (54%), Gaps = 30/709 (4%)

Query: 122 VENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGA 181
            E+   C+P+CT+EC+ G C++P+TC CE G+GGP C+  C   H+GP C   CQC+NGA
Sbjct: 93  YESGDFCIPLCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRCQCQNGA 152

Query: 182 GCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTG 241
            C+P TGAC C  G+ G  CEE+C PG  G+ C   CQCR+GA C P  GEC C PG+TG
Sbjct: 153 LCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGYTG 212

Query: 242 SLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCT 301
             CEE CPPG+HG  C  RC CQNG  C+   G+C C PGW G+VC  PC PG +GQ C+
Sbjct: 213 VYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCS 272

Query: 302 VPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDG 361
             C C +G  C HVTG+C C  G+ G +C + CP G++G QC  +C C     +CS   G
Sbjct: 273 QDCPCHHGGQCDHVTGQCHCTAGYMGDRCQEECPFGSFGFQCSQHCDC-HNGGQCSPTTG 331

Query: 362 NCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCD 421
            C C PG++G +C+ER CP+GL+G GC   C C+ +NT  CH VTG C C PGW G  C+
Sbjct: 332 ACECEPGYKGPRCQERLCPEGLHGPGCTLPCPCDADNTISCHPVTGACTCQPGWSGHHCN 391

Query: 422 RPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCE 481
             CP+  +GD C   C C+N A C    G  T                    GF G  C 
Sbjct: 392 ESCPVGYYGDGCQLPCTCQNGADCHSITGGCT-----------------CAPGFMGEVCA 434

Query: 482 KPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQE 541
             C  G+YG +CS  C C+  G  +CSP  G C C+ G  G  C  PC  G +G NC + 
Sbjct: 435 VSCAAGTYGPNCSSICSCNNGG--TCSPVDGSCTCKEGWQGLDCTLPCPSGTWGLNCNES 492

Query: 542 CRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGK 601
           C C NGAAC+P DG+C C  G+ G  C+  C   T+G NC++ C C   ++ GCD VTG 
Sbjct: 493 CTCANGAACSPIDGSCSCTPGWLGDTCELPCPDGTFGLNCSEHCDC--SHADGCDPVTGH 550

Query: 602 CICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPC 661
           C C  G+ G RC++ C  P  +G +CS+ C C NGG+C+  DG C C  G++G LC   C
Sbjct: 551 CCCLAGWTGIRCDSTCP-PGRWGPNCSVSCSCENGGSCSPEDGSCECAPGFRGPLCQRIC 609

Query: 662 PEGQYGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATF--NTTLYLYL 719
           P G YG+ C + C            +S   +   G +      V     F  +       
Sbjct: 610 PPGFYGHGCAQPCPLCVHSSRPCHHISGICECLPGFSGALCNQVCAGGYFGQDCAQLCSC 669

Query: 720 FVNLTYGILYKTLVRL-----RECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAP 774
             N T   +  +         ++C + CPPG  GP+C + C C NGA C+  +G C C P
Sbjct: 670 ANNGTCSPIDGSCQCFPGWIGKDCSQACPPGFWGPACFHACSCHNGASCSAEDGACHCTP 729

Query: 775 GWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK 823
           GW G  C   C    +G+ C   C+C NGASC H++G+C C  GF GQ 
Sbjct: 730 GWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQH 778




May regulate the mosaic spacing of specific neuron subtypes in the retina through homotypic retinal neuron repulsion. Mosaics provide a mechanism to distribute each cell type evenly across the retina, ensuring that all parts of the visual field have access to a full set of processing elements.
Homo sapiens (taxid: 9606)
>sp|Q80T91|MEG11_MOUSE Multiple epidermal growth factor-like domains protein 11 OS=Mus musculus GN=Megf11 PE=1 SV=3 Back     alignment and function description
>sp|Q96KG7|MEG10_HUMAN Multiple epidermal growth factor-like domains protein 10 OS=Homo sapiens GN=MEGF10 PE=1 SV=1 Back     alignment and function description
>sp|Q6DIB5|MEG10_MOUSE Multiple epidermal growth factor-like domains protein 10 OS=Mus musculus GN=Megf10 PE=1 SV=1 Back     alignment and function description
>sp|A0JM12|MEG10_XENTR Multiple epidermal growth factor-like domains protein 10 OS=Xenopus tropicalis GN=megf10 PE=2 SV=1 Back     alignment and function description
>sp|O88281|MEGF6_RAT Multiple epidermal growth factor-like domains protein 6 OS=Rattus norvegicus GN=Megf6 PE=1 SV=1 Back     alignment and function description
>sp|Q80V70|MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus GN=Megf6 PE=2 SV=3 Back     alignment and function description
>sp|O75095|MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens GN=MEGF6 PE=1 SV=4 Back     alignment and function description
>sp|Q8VIK5|PEAR1_MOUSE Platelet endothelial aggregation receptor 1 OS=Mus musculus GN=Pear1 PE=1 SV=1 Back     alignment and function description
>sp|Q5VY43|PEAR1_HUMAN Platelet endothelial aggregation receptor 1 OS=Homo sapiens GN=PEAR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
383848080 1002 PREDICTED: multiple epidermal growth fac 0.778 0.639 0.444 1e-160
380024321 1001 PREDICTED: multiple epidermal growth fac 0.776 0.638 0.445 1e-160
345495719 1020 PREDICTED: multiple epidermal growth fac 0.783 0.632 0.440 1e-159
307193492 1007 Multiple epidermal growth factor-like do 0.778 0.636 0.437 1e-155
380024323 990 PREDICTED: multiple epidermal growth fac 0.763 0.634 0.438 1e-154
307182743 991 Multiple epidermal growth factor-like do 0.817 0.679 0.435 1e-154
350424059 993 PREDICTED: multiple epidermal growth fac 0.818 0.678 0.433 1e-154
332022203 962 Multiple epidermal growth factor-like do 0.765 0.654 0.435 1e-153
189234402 993 PREDICTED: similar to draper CG2086-PB [ 0.778 0.645 0.439 1e-153
340726359 991 PREDICTED: multiple epidermal growth fac 0.770 0.639 0.430 1e-153
>gi|383848080|ref|XP_003699680.1| PREDICTED: multiple epidermal growth factor-like domains protein 11-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  573 bits (1477), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 310/698 (44%), Positives = 408/698 (58%), Gaps = 57/698 (8%)

Query: 126 KLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECPEGHYGPDCKLACQCENGAGCDP 185
           + C+P+C+ +C+ GTCIAP+ CKCE G+GGP C+ +CP G +G  C+  C C+N A CDP
Sbjct: 95  ERCIPICSKDCVHGTCIAPDVCKCESGYGGPLCDYKCPPGKWGKSCEKDCLCQNDASCDP 154

Query: 186 NTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAECHPATGECSCQPGFTGSLCE 245
             G C C  G+ G +CE+ C P R+GQ+C +EC+CRNG  CH  +GEC C PG+TG LC+
Sbjct: 155 FDGKCRCTRGWTGDYCEQQCSPDRYGQDCGEECRCRNGGSCHHISGECHCAPGYTGPLCD 214

Query: 246 ERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCE 305
           + CPPG HG  C + C+CQNG  CNP  G C CAPGW G VC + C  G WG+ C+  C+
Sbjct: 215 DFCPPGKHGDECKSDCKCQNGGSCNPTTGSCYCAPGWTGIVCALRCPEGFWGKNCSQVCD 274

Query: 306 CFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCSC 365
           C+N ASCHH+TGEC+C+PG+   KC+  CPEG +G  C   C+C     +CS ++G C+C
Sbjct: 275 CYNKASCHHLTGECECKPGYYDVKCLQICPEGKFGLNCTSNCTCE-NGADCSPVNGTCTC 333

Query: 366 PPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLCHAVTGKCECGPGWDGLTCDRPCP 425
            PG+ G KC +R CPDGL+G  C + C+C+ +NT LCH  TG+C C  GWDG TC+RPCP
Sbjct: 334 KPGWTGKKCNKRACPDGLFGPNCLKVCQCSDDNTDLCHPATGECICKAGWDGETCNRPCP 393

Query: 426 ITRWGDNCSQHCNCKNDALCFPRNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCP 485
              +G  C   CNCKN+A C P NGT                  +  +G+ G  C + CP
Sbjct: 394 FYTYGKGCQNRCNCKNNAQCLPINGT-----------------CICAAGYRGEDCSEVCP 436

Query: 486 QGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAGQLCDRPCSEGRYGQNCTQECRCM 545
             +YG++C+Q C+C  +  A+CSP +G+C C  G  G  CDRPC +  +G+NC  +C+C 
Sbjct: 437 DHTYGENCAQKCVC--KNGATCSPENGRCNCTAGWVGVSCDRPCDDRSFGRNCEGKCKCF 494

Query: 546 NGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDIVTGKCICR 605
           N AACNPQ+GTC C AG+ G LCQ  C+   +G  C Q C C  +NS GCD  TG+CIC+
Sbjct: 495 NNAACNPQNGTCTCAAGFTGELCQDHCKTGYFGLGCTQVCDCHEDNSLGCDPATGRCICK 554

Query: 606 PGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQ 665
           P ++G RCET+C     YG DC   C C N  +C+   G C C RG++G  C+ PC EG 
Sbjct: 555 PEWRGVRCETKCPE-GLYGNDCHSHCECMNNSSCDPDTGTCICARGWEGADCSQPCKEGW 613

Query: 666 YGYNCKEECLTKGQDVPVRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTY 725
           YG  CKE+C  K QD      V+       G                       ++ LT 
Sbjct: 614 YGVGCKEKCPEKMQDNMTCDHVTGEYVCRPG-----------------------YLGLT- 649

Query: 726 GILYKTLVRLRECEERCPPGTHGPSCINRCRCQNGAICNPANGQCLCAPGWMGSVCNVPC 785
                       CE  CPP  +G +C NRCRC+NG  C+   G C C PGW    C  PC
Sbjct: 650 ------------CEHPCPPNRYGLNCANRCRCKNGGECHHVTGICQCRPGWKDEHCQTPC 697

Query: 786 TPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQK 823
             G +G  C+  C C NG  C    G C+C PG+ G K
Sbjct: 698 PEGTYGINCSQHCTCQNGGKCRSNDGHCRCAPGWIGTK 735




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380024321|ref|XP_003695949.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|345495719|ref|XP_001606322.2| PREDICTED: multiple epidermal growth factor-like domains protein 11-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307193492|gb|EFN76269.1| Multiple epidermal growth factor-like domains 10 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|380024323|ref|XP_003695950.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|307182743|gb|EFN69867.1| Multiple epidermal growth factor-like domains 11 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350424059|ref|XP_003493675.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022203|gb|EGI62518.1| Multiple epidermal growth factor-like domains 10 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189234402|ref|XP_974971.2| PREDICTED: similar to draper CG2086-PB [Tribolium castaneum] gi|270002777|gb|EEZ99224.1| draper [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340726359|ref|XP_003401527.1| PREDICTED: multiple epidermal growth factor-like domains protein 10-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query823
UNIPROTKB|E1C393 1132 MEGF10 "Uncharacterized protei 0.778 0.566 0.380 2.8e-165
UNIPROTKB|F1PYQ7 1604 MEGF6 "Uncharacterized protein 0.783 0.402 0.374 1.4e-163
UNIPROTKB|F1PYQ8 1573 MEGF6 "Uncharacterized protein 0.783 0.410 0.374 1.4e-163
UNIPROTKB|F1NXF9 1371 Gga.18391 "Uncharacterized pro 0.952 0.571 0.336 2.9e-160
UNIPROTKB|A0JM12 1114 megf10 "Multiple epidermal gro 0.763 0.563 0.379 3.3e-158
WB|WBGene000134161714 Y64G10A.7 [Caenorhabditis eleg 0.771 0.370 0.371 5.4e-158
ZFIN|ZDB-GENE-090312-12 1513 megf6a "multiple EGF-like-doma 0.931 0.506 0.338 6.2e-157
UNIPROTKB|Q96KG7 1140 MEGF10 "Multiple epidermal gro 0.763 0.550 0.374 5.5e-156
ZFIN|ZDB-GENE-060503-252 1114 megf11 "multiple EGF-like-doma 0.713 0.526 0.380 3e-155
UNIPROTKB|F1MET4 1136 MEGF10 "Uncharacterized protei 0.763 0.552 0.371 8e-155
UNIPROTKB|E1C393 MEGF10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1356 (482.4 bits), Expect = 2.8e-165, Sum P(2) = 2.8e-165
 Identities = 267/701 (38%), Positives = 348/701 (49%)

Query:     3 CVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIAKDAKT-KPTDTYTFRLMFPQCMDP-- 59
             CVP C D+C+ G CIAPNTC+CE G+GGP C+ A D+    P  +   +       +P  
Sbjct:   105 CVPHCADKCVHGRCIAPNTCQCEPGWGGPNCSSACDSDHWGPHCSSRCQCKNGALCNPIT 164

Query:    60 ----CPEGTWGKQCVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERT----CPDGLYG 111
                 C  G  G +C   C       +C +    C C     GA C   T    CP G  G
Sbjct:   165 GACHCASGFKGWRCEERCDQGTYGNDCHQ---KCQCQ---NGATCDHVTGECRCPPGYTG 218

Query:   112 EGCDRTCECNVENTKLCVPVCTDECI---RGTCI-APNTCKCEVGF--GGPTCNIECPEG 165
               C+  C           P C + C     G C      C C  G+   G  C   CPEG
Sbjct:   219 AFCEDLCPPGKHG-----PQCEERCPCQNGGICHHVTGECACPPGWMTQGMVCGQPCPEG 273

Query:   166 HYGPDCKLACQCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQCRNGAE 225
              YG +C   CQC NG  CD  TG C C  GY G  C++ C  G +G  C++ CQC NG +
Sbjct:   274 RYGNNCSQECQCHNGGICDSATGQCHCSPGYTGERCQDECPVGTYGVRCAETCQCMNGGK 333

Query:   226 CHPATGECSCQPGFTGSLCEER-CPPGTHGPSCINRCRCQ--NGAICNPANGQCLCAPGW 282
             C+  +G C C+PG+TG  CE R CP G +G  C  +C C   N   C+P +G+C C PGW
Sbjct:   334 CYHISGACLCEPGYTGEHCETRLCPEGVYGLKCDKKCPCHLHNTWSCHPMSGECSCKPGW 393

Query:   283 MGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGTWGKQ 342
              G  CN  C+PG +G+ C   C C NGA C  VTG+C C  GFKG  C  PC  GT+G  
Sbjct:   394 SGLYCNETCSPGFYGKSCQQICSCQNGADCDSVTGKCICASGFKGADCGTPCLPGTYGVN 453

Query:   343 CVHYCSCPVESMECSRIDGNCSCPPGFRGAKCKERTCPDGLYGEGCDRTCECNVENTKLC 402
             C   C+C  E++ CS +DG+C+C  G+ G  C    CP G +G GC+ TC+C   N   C
Sbjct:   454 CSSVCNCKNEAI-CSSVDGSCTCKAGWHGVDCSIN-CPSGTWGLGCNLTCQCL--NGGAC 509

Query:   403 HAVTGKCECGPGWDGLTCDRPCPITRWGDNCSQHCNCKNDALCFPRNGTNTYQYXXXXXX 462
             +A+ G C C PGW G  C+ PC    +G +C++ C+C +   C P  G     Y      
Sbjct:   510 NALDGTCTCAPGWRGEKCELPCQDGTYGMDCAERCDCSHADGCHPTTG-----YCRCLPG 564

Query:   463 XXXXXXXXXXXXXXGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSPGSGQCVCRPGGAG 522
                           G HC+  C +G +G +CS +C C K G ASCSP  G C C PG  G
Sbjct:   565 WS------------GIHCDSVCAEGQWGPNCSLSCYC-KNG-ASCSPDDGICECAPGYRG 610

Query:   523 QLCDRPCSEGRYGQNCTQEC-RCMNGAA-CNPQDGTCLCPAGYYGPLCQKRCEFMTYGRN 580
               C R CS G YG  C+Q C +C++ +  C+   G C C  G+ G LC + C    +G+N
Sbjct:   611 TTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVCPSGRFGKN 670

Query:   581 CAQACTCFTENSQGCDIVTGKCICRPGFKGHRCETQCSNPNTYGEDCSLDCGCNNGGTCN 640
             C   CTC T N   C+ +   C C PG+ G  C   C  P+ +G +C   C C+NG  C+
Sbjct:   671 CIGICTC-TNNGT-CNPIDRSCQCYPGWIGSDCSQPCP-PSHWGPNCIHTCNCHNGAYCS 727

Query:   641 QLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTK-GQD 680
               DG C C  G+ G  CT  CP G YG +C   C  + G D
Sbjct:   728 AYDGECKCTPGWTGLYCTQRCPLGFYGKDCALICQCRNGAD 768


GO:0001891 "phagocytic cup" evidence=IEA
GO:0014719 "satellite cell activation" evidence=IEA
GO:0014816 "satellite cell differentiation" evidence=IEA
GO:0014841 "satellite cell proliferation" evidence=IEA
GO:0034109 "homotypic cell-cell adhesion" evidence=IEA
GO:0043654 "recognition of apoptotic cell" evidence=IEA
GO:0048641 "regulation of skeletal muscle tissue development" evidence=IEA
GO:0051147 "regulation of muscle cell differentiation" evidence=IEA
GO:0055001 "muscle cell development" evidence=IEA
UNIPROTKB|F1PYQ7 MEGF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYQ8 MEGF6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXF9 Gga.18391 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A0JM12 megf10 "Multiple epidermal growth factor-like domains protein 10" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
WB|WBGene00013416 Y64G10A.7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-12 megf6a "multiple EGF-like-domains 6a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96KG7 MEGF10 "Multiple epidermal growth factor-like domains protein 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-252 megf11 "multiple EGF-like-domains 11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MET4 MEGF10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A6BM72MEG11_HUMANNo assigned EC number0.41880.82500.6503yesN/A
Q80T91MEG11_MOUSENo assigned EC number0.42170.82500.6223yesN/A
A0JM12MEG10_XENTRNo assigned EC number0.41110.81530.6023yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 823
KOG0994|consensus 1758 100.0
KOG0994|consensus 1758 99.98
KOG1836|consensus 1705 99.77
KOG1836|consensus 1705 99.76
KOG4289|consensus 2531 99.7
KOG4289|consensus 2531 99.61
KOG1225|consensus525 99.38
KOG1225|consensus525 99.38
KOG1217|consensus487 99.25
KOG1217|consensus487 99.24
KOG1219|consensus 4289 98.96
KOG1218|consensus316 98.95
KOG1218|consensus316 98.94
KOG1219|consensus 4289 98.94
KOG1214|consensus 1289 98.69
KOG1214|consensus 1289 98.65
KOG1226|consensus783 98.54
KOG1226|consensus783 98.48
KOG4260|consensus350 98.05
KOG4260|consensus350 97.81
KOG3512|consensus592 97.37
smart0005163 DSL delta serrate ligand. 96.82
KOG3512|consensus592 96.79
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.71
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.27
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.26
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.25
smart0005163 DSL delta serrate ligand. 96.23
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 96.19
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 96.12
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 95.76
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.72
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 95.48
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 95.31
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 95.23
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.91
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.77
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.55
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.45
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 94.18
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 94.13
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 93.88
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 93.54
cd0005336 EGF Epidermal growth factor domain, found in epide 93.2
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 93.0
smart0018135 EGF Epidermal growth factor-like domain. 91.79
smart0018135 EGF Epidermal growth factor-like domain. 91.6
PF1266224 cEGF: Complement Clr-like EGF-like 91.46
cd0005336 EGF Epidermal growth factor domain, found in epide 91.3
PF1266224 cEGF: Complement Clr-like EGF-like 88.77
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 85.49
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 84.41
>KOG0994|consensus Back     alignment and domain information
Probab=100.00  E-value=3.9e-31  Score=298.75  Aligned_cols=540  Identities=32%  Similarity=0.858  Sum_probs=376.2

Q ss_pred             CeeecCCCCcCCCCCCCCCCCCCCCCCc--ccccCCCcccCCCCCCCCCCCCCCCCCCCCCCCcccC----------C-C
Q psy6207          20 NTCKCEVGFGGPTCNIAKDAKTKPTDTY--TFRLMFPQCMDPCPEGTWGKQCVHYCSCPVESMECSR----------I-D   86 (823)
Q Consensus        20 ~~C~C~~G~~G~~C~~~~~~~~C~~~~~--~~~~~~~~C~~~C~~g~~G~~C~~~C~C~~~~~~C~~----------~-~   86 (823)
                      ..|.|.-.-.|.+|+...++-.  .-++  ..+-....|              ..|.|+.|+.+|+-          + .
T Consensus       300 G~C~C~HNT~G~nCE~C~~fYn--DlPWrpAeG~~~neC--------------rkC~CNgHa~sCHFD~aV~~ASG~vSG  363 (1758)
T KOG0994|consen  300 GRCMCKHNTAGLNCEHCAPFYN--DLPWRPAEGKTSNEC--------------RKCECNGHADTCHFDMAVYEASGNVSG  363 (1758)
T ss_pred             ceeEeccCCCCCChHHhhHhhc--CCCCCccCCCCcccc--------------cccCCCCCcccccccHHHHhhcCCccc
Confidence            5789999999999987432200  0011  001111122              13578888777751          1 2


Q ss_pred             Cccc-CCCCccCCCCCccCCCCCCcCCCCC--------ccccccCCCCCcccccCCCCCCCccccC---------Cceee
Q psy6207          87 GNCS-CPPGFRGAKCKERTCPDGLYGEGCD--------RTCECNVENTKLCVPVCTDECIRGTCIA---------PNTCK  148 (823)
Q Consensus        87 ~~C~-C~~G~~G~~C~~~~C~~~~~g~~C~--------~~C~C~~~~~~~C~~~c~~~C~~G~C~~---------~~~C~  148 (823)
                      |.|. |.+...|.+|+  .|.+.||-+.=.        .+|.|.+.-.        .  ..|.|..         .+.|.
T Consensus       364 GVCDdCqHNT~G~~CE--~CkP~fYRdprr~i~~p~vC~pC~CdP~GS--------~--~~g~cds~~Dp~~GlvaGqC~  431 (1758)
T KOG0994|consen  364 GVCDDCQHNTEGQNCE--RCKPFFYRDPRRDISDPDVCKPCECDPAGS--------Q--DGGICDSFCDPSTGLVAGQCR  431 (1758)
T ss_pred             ccCccccccccccchh--hcCcccccCCCCCCCCccccccccCCCCcC--------c--CCCccccccCccccccccccc
Confidence            4775 99999999999  898887764210        2333322110        0  0134431         47899


Q ss_pred             ccCCCCCCccccCCCCCCCCCCCCC-----CCCCC-----CCCeecCCCCcccCCCCCcCCCCCCCCCCCCCCCCCC---
Q psy6207         149 CEVGFGGPTCNIECPEGHYGPDCKL-----ACQCE-----NGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCS---  215 (823)
Q Consensus       149 C~~Gy~G~~C~~~c~~g~~g~~C~~-----~c~C~-----~~g~C~~~~g~C~C~~Gy~G~~C~~~C~~g~~g~~C~---  215 (823)
                      |+++..|..|+ .|.+||||..-..     +|.|+     ++..|++.+|.|.|+.-.+|..|.. |.|.+||..=.   
T Consensus       432 CK~~V~G~RCd-~Ck~Gywgl~~~dp~GC~~C~CN~lGT~~~s~CD~~TG~C~ckrlvTg~~cdq-clPeh~gLs~~~~g  509 (1758)
T KOG0994|consen  432 CKEHVAGRRCD-RCKDGYWGLTSADPYGCRPCDCNPLGTRNGSGCDPETGDCYCKRLVTGIDCDQ-CLPEHWGLSNDLEG  509 (1758)
T ss_pred             cccCcCccccc-hhccCcccCccCCCCCccccccccccccCCCCCCCCCCceEeeccccCCCccc-cCccccccCCCCCC
Confidence            99999999999 5999999975333     24563     3445999999999999999999997 99999986433   


Q ss_pred             -CCCCCCCCC----eecCCCCccccCCCCCCCCCCcCCCCCC--------------------------------------
Q psy6207         216 -QECQCRNGA----ECHPATGECSCQPGFTGSLCEERCPPGT--------------------------------------  252 (823)
Q Consensus       216 -~~~~C~~~g----~C~~~~~~C~C~~G~~G~~C~~~C~~g~--------------------------------------  252 (823)
                       .++.|..+|    +|...+++|.|+++|.|.+|+..++.-|                                      
T Consensus       510 c~~cdcd~GGs~d~sc~~~sGqC~CRe~~~GR~c~~~~~~yy~~~l~h~i~eAe~~~~~~~~~v~~r~~~~~~~~~sftG  589 (1758)
T KOG0994|consen  510 CRPCDCDQGGSYDNSCDLHSGQCECREHMLGRRCEQVCPGYYSPVLDHYIYEAEDAGTGVEVNVKERKVLKSTKLPSFTG  589 (1758)
T ss_pred             CcccccCCCCCCCcccccccCccccccccccccccccCCcccccccchhhhhhhhccccceeeeeeeeecccCCCccccc
Confidence             234676665    6777799999999999988876100000                                      


Q ss_pred             --------------------------------------------------------------------------------
Q psy6207         253 --------------------------------------------------------------------------------  252 (823)
Q Consensus       253 --------------------------------------------------------------------------------  252 (823)
                                                                                                      
T Consensus       590 ~gf~r~~e~~~l~f~~~~ip~sm~Ydv~ir~~~~~~~~wen~~itvqrp~~p~~g~c~~~~~~dd~~~~sl~p~sRyvv~  669 (1758)
T KOG0994|consen  590 KGFVRVPEGTTLEFTVPIIPPSMEYDVLIRYDPRTPKLWENAKITVQRPGQPSLGRCGMAIPKDDRIPFSLPPGSRYVVA  669 (1758)
T ss_pred             cceeecCCCceeeeecCCCCcccccchheeccCCCcchhhhheEEeecCCCCcccccccccccccccccccCCCceeeec
Confidence                                                                                            


Q ss_pred             -----------------------------------------------CC-----------CCC---------------C-
Q psy6207         253 -----------------------------------------------HG-----------PSC---------------I-  258 (823)
Q Consensus       253 -----------------------------------------------~g-----------~~C---------------~-  258 (823)
                                                                     .|           -.|               . 
T Consensus       670 ~~~vClE~G~~Yklri~~~~~~~~~esp~aLiDSl~L~P~~~~l~iFqg~~~a~~~~yerYqC~~sl~~~k~~~~e~C~~  749 (1758)
T KOG0994|consen  670 PNPVCLEAGKVYKLRIYFERKSHDVESPYALIDSLVLIPRIDVLPIFQGSVLADKKTYERYQCESSLSDMKTKSDEVCQN  749 (1758)
T ss_pred             CCchhhccCcceEEEEEeccccCCcccchhhhhhhhhccccccccccccchhhhhHHHHHhhhhhcccccccCcchhhhh
Confidence                                                           00           000               0 


Q ss_pred             -------------CCCCCCC----CCeecCCCCeeeCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCC----CCeecCC
Q psy6207         259 -------------NRCRCQN----GAICNPANGQCLCAPGWMGSVCNVPCTPGMWGQGCT--VPCECFN----GASCHHV  315 (823)
Q Consensus       259 -------------~~c~C~~----~g~C~~~~g~C~C~~G~~G~~C~~~C~~g~~g~~C~--~~~~C~~----~g~C~~~  315 (823)
                                   +.|.|..    .++|....|+|+|+|+..|+.|+ .|.+|+||..=+  ..+.|+.    +.-|..+
T Consensus       750 l~~~lsa~l~n~a~~CnCnptGSlS~vCn~~GGqCqCkPnVVGR~Cd-qCApGtyGFGPsGCk~CdC~~~Gs~~~~Cd~~  828 (1758)
T KOG0994|consen  750 LDNSLSALLHNGASMCNCNPTGSLSSVCNPNGGQCQCKPNVVGRRCD-QCAPGTYGFGPSGCKACDCNSIGSLDKYCDKI  828 (1758)
T ss_pred             hhhhHHHHHhcCccccccCCCccccccccCCCceecccCcccccccc-ccCCcccCcCCccCcccccccccccccccccc
Confidence                         0112222    23566566799999999999999 799999986422  3345654    3458889


Q ss_pred             CCcccCCCCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCeeecCCceEE-CCCCccCCCCCCccCCCCCCCCC-------
Q psy6207         316 TGECQCEPGFKGQKCMDPCPEGTWGKQCVHYCSCPVESMECSRIDGNCS-CPPGFRGAKCKERTCPDGLYGEG-------  387 (823)
Q Consensus       316 ~g~C~C~~G~~G~~C~~~C~~~~~g~~C~~~c~C~~~~g~C~~~~~~C~-C~~G~~G~~C~~~~C~~g~~g~~-------  387 (823)
                      +|+|+|.+|-.|..| +.|..|+||++--.+|.|+.+..+|+.+++.|+ |....+|..|+  .|.+||||++       
T Consensus       829 tGQC~C~~g~ygrqC-nqCqpG~WgFPeCr~CqCNgHA~~Cd~~tGaCi~CqD~T~G~~Cd--rCl~GyyGdP~lg~g~~  905 (1758)
T KOG0994|consen  829 TGQCQCRPGTYGRQC-NQCQPGYWGFPECRPCQCNGHADTCDPITGACIDCQDSTTGHSCD--RCLDGYYGDPRLGSGIG  905 (1758)
T ss_pred             ccceeeccccchhhc-cccCCCccCCCcCccccccCcccccCccccccccccccccccchh--hhhccccCCcccCCCCC
Confidence            999999999999999 599999999987777888887678988899996 99999999998  8999999884       


Q ss_pred             CCCCCCCCCCC------CCcccC----CCcceEcCCCcccCCCCCCCCCCccCCCCCCC----CCCCCC------CcccC
Q psy6207         388 CDRTCECNVEN------TKLCHA----VTGKCECGPGWDGLTCDRPCPITRWGDNCSQH----CNCKND------ALCFP  447 (823)
Q Consensus       388 C~~~~~C~~~~------~~~C~~----~~~~C~C~~G~~G~~C~~~C~~~~~~~~C~~~----~~C~~~------g~C~~  447 (823)
                      |. +++|..+.      ...|..    ..-.|.|++||+|.+|+. |.+++||++-...    +.|+++      +.|..
T Consensus       906 Cr-PCpCP~gp~Sg~~~A~sC~~d~~t~~ivC~C~~GY~G~RCe~-CA~~~fGnP~~GGtCq~CeC~~NiD~~d~~aCD~  983 (1758)
T KOG0994|consen  906 CR-PCPCPDGPASGRQHADSCYLDTRTQQIVCHCQEGYSGSRCEI-CADNHFGNPSEGGTCQKCECSNNIDLYDPGACDV  983 (1758)
T ss_pred             CC-CCCCCCCCccchhccccccccccccceeeecccCccccchhh-hcccccCCcccCCccccccccCCcCccCCCccch
Confidence            32 45666552      124442    123899999999999998 9999999875421    123332      23444


Q ss_pred             CCCccccccccccccccceeeccCCCCccCCCCCCCCCCCCCCCCCCCC---cCCCCCC---CCcccCCCceeeCCCCCC
Q psy6207         448 RNGTNTYQYFFLQSLTLFTFLSLTHSGFSGRHCEKPCPQGSYGQDCSQT---CLCSKEG---SASCSPGSGQCVCRPGGA  521 (823)
Q Consensus       448 ~~g~C~~~~~~~~~~~~~s~~C~C~~Gy~G~~C~~~C~~g~~g~~C~~~---c~C~~~g---~g~C~~~~~~C~C~~G~~  521 (823)
                      .+|.|.                .|...-+|++|+. |.+||||+.=.+.   +.|.-.|   .+.|...+++|-|.|...
T Consensus       984 ~TG~CL----------------kCL~hTeG~hCe~-Ck~Gf~GdA~~q~CqrC~Cn~LGTn~~~~CDr~tGQCpClpNv~ 1046 (1758)
T KOG0994|consen  984 ATGACL----------------KCLYHTEGDHCEH-CKDGFYGDALRQNCQRCVCNFLGTNSTCHCDRFTGQCPCLPNVQ 1046 (1758)
T ss_pred             hhchhh----------------hhhhcccccchhh-ccccchhHHHHhhhhhheccccccCCccccccccCcCCCCcccc
Confidence            444441                5777778999998 9999998875543   3354211   355667899999999999


Q ss_pred             CCCCCCCCCCCcc----CCCCCCCCCCCC--CCeeeCCCcEEeCCCCCcCCCccccCcCCcCCCCCCC--CCCCCC--CC
Q psy6207         522 GQLCDRPCSEGRY----GQNCTQECRCMN--GAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQ--ACTCFT--EN  591 (823)
Q Consensus       522 G~~C~~~c~~g~~----~~~C~~~c~C~~--~g~C~~~~~~C~C~~G~~G~~C~~~c~~~~~g~~C~~--~~~C~~--~~  591 (823)
                      |.+|+. |.+.+|    |..|++- .|+.  +-+|+..+++|.|.|||-|..|++ |.+-|+|++=..  .+.|+.  ..
T Consensus      1047 G~~CDq-CA~N~w~laSG~GCe~C-~Cd~~~~pqCN~ftGQCqCkpGfGGR~C~q-Cqel~WGdP~~~C~aCdCd~rG~~ 1123 (1758)
T KOG0994|consen 1047 GVRCDQ-CAENHWNLASGEGCEPC-NCDPIGGPQCNEFTGQCQCKPGFGGRTCSQ-CQELYWGDPNEKCRACDCDPRGIE 1123 (1758)
T ss_pred             cccccc-cccchhccccCCCCCcc-CCCccCCccccccccceeccCCCCCcchhH-HHHhhcCCCCCCceecCCCCCCCC
Confidence            999997 877766    4556642 4443  337888899999999999999984 888888886221  234421  12


Q ss_pred             CCeeecCCCeEecCCCCCCCCccc
Q psy6207         592 SQGCDIVTGKCICRPGFKGHRCET  615 (823)
Q Consensus       592 ~~~C~~~~~~C~C~~G~~G~~C~~  615 (823)
                      .-+|+..+++|+|.+|..|..|+.
T Consensus      1124 tpQCdr~tG~C~C~~Gv~G~rCdq 1147 (1758)
T KOG0994|consen 1124 TPQCDRATGRCVCRPGVGGPRCDQ 1147 (1758)
T ss_pred             CCCccccCCceeecCCCCCcchhh
Confidence            346777889999999999998863



>KOG0994|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
2gy5_A423 Tie2 Ligand-Binding Domain Crystal Structure Length 9e-17
2gy5_A423 Tie2 Ligand-Binding Domain Crystal Structure Length 2e-15
2gy5_A423 Tie2 Ligand-Binding Domain Crystal Structure Length 5e-15
2gy5_A 423 Tie2 Ligand-Binding Domain Crystal Structure Length 1e-07
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 8e-08
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure

Iteration: 1

Score = 85.9 bits (211), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 56/148 (37%), Positives = 72/148 (48%), Gaps = 6/148 (4%) Query: 161 ECPEGHYGPDCKLAC-QCENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQ 219 C +GP+C C C N C +TG C C G+MG CE+ C FG+ C + C Sbjct: 188 RCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCS 247 Query: 220 ----CRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQ 275 C++ C P CSC G+ G C E C PG +GP C RC C NG +C+ G Sbjct: 248 GQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQG- 306 Query: 276 CLCAPGWMGSVCNVPCTPGMWGQGCTVP 303 CLC+PGW G C P M + +P Sbjct: 307 CLCSPGWQGLQCEREGIPRMTPKIVDLP 334
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure
>pdb|2GY5|A Chain A, Tie2 Ligand-Binding Domain Crystal Structure Length = 423 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query823
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-29
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-23
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-21
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 7e-21
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-19
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-15
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-13
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-11
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-10
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-25
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 8e-21
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-17
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-17
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-15
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 6e-15
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-14
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-07
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-06
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-06
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-25
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-18
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-18
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-17
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 8e-17
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 8e-17
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 9e-13
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 9e-12
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-11
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-24
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-22
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-20
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-19
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-18
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-17
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-14
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-09
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-05
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-17
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-15
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-07
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-06
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-05
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-10
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-07
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-06
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-07
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 7e-07
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 6e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-04
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 8e-06
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 8e-05
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 9e-06
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-05
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 1e-04
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 5e-04
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 3e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 5e-04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 6e-04
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 5e-05
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 3e-04
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 4e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-04
2vh0_B134 Activated factor XA light chain; serine protease, 2e-04
2vh0_B134 Activated factor XA light chain; serine protease, 5e-04
1mox_A501 Epidermal growth factor receptor; EGFR, receptor, 2e-04
2uvo_A171 Agglutinin isolectin 1; carbohydrate-binding prote 2e-04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 5e-04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-04
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
 Score =  121 bits (304), Expect = 2e-29
 Identities = 64/241 (26%), Positives = 91/241 (37%), Gaps = 8/241 (3%)

Query: 104 TCPDGLYGEGCDRTCECNVENTKLCVPVCTDECIRGTCIAPNTCKCEVGFGGPTCNIECP 163
              +G +     R    ++    L      D  +                        C 
Sbjct: 133 IYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSAR--YIGGNLFTSAFTRLIVRRCE 190

Query: 164 EGHYGPDCKLACQ-CENGAGCDPNTGACDCLDGYMGTHCEEVCGPGRFGQNCSQECQ--- 219
              +GP+C   C  C N   C  +TG C C  G+MG  CE+ C    FG+ C + C    
Sbjct: 191 AQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQE 250

Query: 220 -CRNGAECHPATGECSCQPGFTGSLCEERCPPGTHGPSCINRCRCQNGAICNPANGQCLC 278
            C++   C P    CSC  G+ G  C E C PG +GP C  RC C NG +C+   G CLC
Sbjct: 251 GCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQG-CLC 309

Query: 279 APGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHVTGECQCEPGFKGQKCMDPCPEGT 338
           +PGW G  C     P M  +   +P      +   +   +    P    ++     P+GT
Sbjct: 310 SPGWQGLQCEREGIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGT 369

Query: 339 W 339
            
Sbjct: 370 V 370


>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Length = 501 Back     alignment and structure
>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.78
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.77
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.76
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.75
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.73
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.72
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.71
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.68
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.58
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.54
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.54
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.52
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.51
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.5
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.5
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.49
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.49
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.46
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.44
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.42
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.38
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.32
2bou_A143 EGF-like module containing mucin-like hormone rece 99.15
2bou_A143 EGF-like module containing mucin-like hormone rece 99.14
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.96
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.93
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.92
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.92
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.83
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.77
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.77
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.71
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.65
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.63
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.59
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.59
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.56
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.4
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.33
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.29
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.25
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.25
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.17
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.11
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.07
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.02
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.0
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.99
2vh0_B134 Activated factor XA light chain; serine protease, 97.97
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.97
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.91
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.9
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.87
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.84
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.83
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.82
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.81
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.77
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.75
2vh0_B134 Activated factor XA light chain; serine protease, 97.75
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.71
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.7
2y38_A403 Laminin subunit alpha-5; structural protein, cell 97.59
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.58
2y38_A403 Laminin subunit alpha-5; structural protein, cell 97.49
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.48
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 97.47
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 97.45
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.22
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.19
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.98
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.95
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.8
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.74
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.53
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.53
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.47
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.47
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.34
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.31
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.03
3v65_B386 Low-density lipoprotein receptor-related protein; 95.99
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.9
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.81
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.8
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.77
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.46
3v65_B 386 Low-density lipoprotein receptor-related protein; 95.44
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 94.83
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.69
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.68
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 94.08
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 92.78
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 92.18
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 91.82
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 91.54
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 90.98
2i9a_A145 Urokinase-type plasminogen activator; growth facto 90.89
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.86
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 90.81
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.59
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 90.44
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 89.57
2i9a_A145 Urokinase-type plasminogen activator; growth facto 89.09
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.97
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 88.39
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 88.0
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 87.98
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 87.7
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 87.27
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 85.89
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 85.8
1ob1_C99 Major merozoite surface protein; immune system, im 85.67
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 85.3
1ob1_C99 Major merozoite surface protein; immune system, im 85.28
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 84.83
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 84.4
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 83.92
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 83.36
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 82.49
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 81.56
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 81.25
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 80.79
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
Probab=99.78  E-value=7e-23  Score=209.93  Aligned_cols=235  Identities=11%  Similarity=-0.047  Sum_probs=166.0

Q ss_pred             ccccceeeccCCCC---ccCCCCCCCCCCCCCCCCCCCCcCCCCCCCCcccC--CCceeeCCCCCCCCCCCCCCCCCccC
Q psy6207         461 SLTLFTFLSLTHSG---FSGRHCEKPCPQGSYGQDCSQTCLCSKEGSASCSP--GSGQCVCRPGGAGQLCDRPCSEGRYG  535 (823)
Q Consensus       461 ~~~~~s~~C~C~~G---y~G~~C~~~C~~g~~g~~C~~~c~C~~~g~g~C~~--~~~~C~C~~G~~G~~C~~~c~~g~~~  535 (823)
                      .+..++|++.+.+|   |+|.+++..      ++++..  +|.+  +|+|++  .+|+|.|++||+|.+|+..      +
T Consensus         7 ~n~~Gg~s~~~~pgg~~~~g~~~~~n------~~~~~~--~c~n--gG~C~~g~~~y~C~Cp~Gf~G~~Ce~n------i   70 (267)
T 4fbr_A            7 QNQWGGSQATWNPGGLWLIGARDKQN------VVALDI--KSDD--GGKTLKGTMTYNGEGPIGFRGTLSSAN------N   70 (267)
T ss_dssp             EEECSSTTSCCEEEEEEECCCCSSCC------EEEEEE--ECSS--TTSEEEEEEEETTSCCEEEEEEECSTT------E
T ss_pred             eecCCcccCCcCCCCceeeccccccc------cccCCC--CcCC--CCeecCCCCCeEEeCCCCccccccccc------c
Confidence            44566888899988   678877764      222222  5888  999987  4899999999999999986      5


Q ss_pred             CC------CCCCCCCCCCCeeeCCCcEEeCCCCCcCCCccccCcCCcCCCCCCCCCCCCCCCCCeeec--CCCeEecCCC
Q psy6207         536 QN------CTQECRCMNGAACNPQDGTCLCPAGYYGPLCQKRCEFMTYGRNCAQACTCFTENSQGCDI--VTGKCICRPG  607 (823)
Q Consensus       536 ~~------C~~~c~C~~~g~C~~~~~~C~C~~G~~G~~C~~~c~~~~~g~~C~~~~~C~~~~~~~C~~--~~~~C~C~~G  607 (823)
                      ++      |.+. ||+++++|            |+|..|++.       ++|+.. +|  .++++|++  .+|+|+|++|
T Consensus        71 ~ec~~~~~c~s~-pC~nggtc------------~~G~~c~~~-------~eC~s~-pC--~ngG~C~~~~~sy~C~C~~G  127 (267)
T 4fbr_A           71 YTVENQWGGTSA-PWQPGGVW------------VLGARDKQN-------IVAVSI-KS--NDGGKTLTGTTTYNGEGPIG  127 (267)
T ss_dssp             EEEEEESSSTTS-CEEEEEEE------------ECCCCSSCC-------EEEEEE-EC--SSTTSEEEEEEEETTSCCEE
T ss_pred             cccccccCcCCC-cccCCCee------------eccCccccc-------cccCCC-CC--CCCCEEecCCccEEeeCCCC
Confidence            66      5555 77777665            467888764       346654 78  89999975  5899999999


Q ss_pred             CCCCCccccCCCCCccCCCCCCC-----CCCCCCCeecCCCCeeecCCCCCCCCCCCCCCCCCcCCcccccccccCCCCC
Q psy6207         608 FKGHRCETQCSNPNTYGEDCSLD-----CGCNNGGTCNQLDGGCNCGRGYQGKLCTAPCPEGQYGYNCKEECLTKGQDVP  682 (823)
Q Consensus       608 ~~G~~C~~~c~~~~~~~~~C~~~-----~~C~~~g~C~~~~~~C~C~~Gy~G~~C~~~c~~g~~g~~C~~~c~c~~~~~~  682 (823)
                      |+|..|+..       +++|+..     .+|.++++|            |.|.+|++..       +             
T Consensus       128 f~G~~Ce~~-------~d~C~n~~~c~s~pC~ngg~c------------~~G~~c~~~i-------~-------------  168 (267)
T 4fbr_A          128 FKSEVTDGD-------TYSVENQWGGSAAPWHSGGVW------------VLGTRGKQNV-------I-------------  168 (267)
T ss_dssp             EEEEECCCC-------EEEEEEECSSTTSCCEEEEEE------------ECCSSTTSCE-------E-------------
T ss_pred             ccccCCCCC-------cccccccCCcCCccccCCcce------------eccccccccc-------c-------------
Confidence            999999876       4564433     145544444            4566666531       1             


Q ss_pred             cccccccccccccccCceeeeeeeeceeeecccceeEeecccceeeecCCeeecccCccCCCCCCCCCCCCCC---CCCC
Q psy6207         683 VRTAVSHALKVHMGINARRYVNVRMVATFNTTLYLYLFVNLTYGILYKTLVRLRECEERCPPGTHGPSCINRC---RCQN  759 (823)
Q Consensus       683 ~~~~~~~~~~~~c~~~g~~~~~~~~~~~C~~~~g~~~~~~~~~~C~C~~G~~g~~C~~~C~~g~~G~~C~~~C---~C~~  759 (823)
                             +...+|.++|          +|++...+|+       |+|++||+|.+|+..          ++++   ..-.
T Consensus       169 -------c~~~~c~ngg----------~C~dg~~~y~-------C~Cp~Gf~G~~c~~~----------i~ec~~~~~c~  214 (267)
T 4fbr_A          169 -------NVDAKSNDGG----------KTLSGTMTYN-------GEGPIGFRGTLTSPD----------TYTVENQWGGS  214 (267)
T ss_dssp             -------EEEEECSSTT----------SEEEEEEEET-------TSCCEEEEEEEEETT----------EEEEEEECSCT
T ss_pred             -------cCCCCCCCCC----------EeeCCCCCeE-------EeCCCCccccccccc----------cceeccCCCcc
Confidence                   2245678999          9999888888       999999999999875          2222   1122


Q ss_pred             CCeecCC-CCeeeCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCeeecc--CceeecCCCCccC
Q psy6207         760 GAICNPA-NGQCLCAPGWMGSVCNVPCTPGMWGQGCTVPCECFNGASCHHV--TGECQCEPGFKGQ  822 (823)
Q Consensus       760 ~g~C~~~-~~~C~C~~G~~G~~C~~~C~~~~~g~~C~~~c~C~~~~~C~~~--~g~C~C~~G~~G~  822 (823)
                      .+.|.+. .+.+.|+.++.+..|+.               +|.|+|+|++.  .++|.||+||+|.
T Consensus       215 ~~~c~~gG~~~~~C~~g~n~~~c~~---------------~c~ngGtC~dg~~sy~CeCp~GF~G~  265 (267)
T 4fbr_A          215 TAPWNPGGFWMIGARNGQNVVALNV---------------ASSDGGKTLAGTMIYNGEGPIGFRAR  265 (267)
T ss_dssp             TSCCEEEEEEECCCCTTCCEEEEEE---------------ECSSTTSEEEEEEEETTSCCEEEEEE
T ss_pred             CCcccCCCeEEEecCCCCccccCCc---------------CCCCCCEeeCCCcceeecCCCCcccc
Confidence            2233332 23455777777655433               67899999975  3599999999985



>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query823
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.11
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.08
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.03
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.99
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.95
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.93
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.92
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.91
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.86
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.69
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.6
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.59
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.57
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.56
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.56
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.5
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.45
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.42
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.35
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.29
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.26
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.25
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.2
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.68
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.44
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.34
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.32
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.0
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 95.92
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.91
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.71
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.67
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.61
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.46
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.44
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.35
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.31
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.23
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.22
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.4
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 94.39
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.29
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.0
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.64
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.56
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.47
d1i0ua241 Low density lipoprotein (LDL) receptor, different 93.43
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.35
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 93.1
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.85
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 92.85
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 92.52
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.46
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 92.21
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.07
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 91.71
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.42
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 91.24
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 90.62
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 90.21
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.96
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 89.74
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 89.73
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 89.31
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.85
d1szba245 Mannose-binding protein associated serine protease 87.81
d1nt0a345 Mannose-binding protein associated serine protease 87.18
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 86.93
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 86.92
d1szba245 Mannose-binding protein associated serine protease 86.38
d1i0ua241 Low density lipoprotein (LDL) receptor, different 86.37
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 85.9
d1nt0a345 Mannose-binding protein associated serine protease 85.85
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 85.2
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 84.72
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 83.25
d3bpse140 Low density lipoprotein (LDL) receptor, different 80.7
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.11  E-value=8.4e-07  Score=61.06  Aligned_cols=35  Identities=34%  Similarity=0.811  Sum_probs=31.6

Q ss_pred             CCCCCCCCCCCCCCeeeCC--CcEEeCCCCCcCCCccc
Q psy6207         535 GQNCTQECRCMNGAACNPQ--DGTCLCPAGYYGPLCQK  570 (823)
Q Consensus       535 ~~~C~~~c~C~~~g~C~~~--~~~C~C~~G~~G~~C~~  570 (823)
                      +|+|+++ ||+++|+|++.  +|+|.|++||+|.+||.
T Consensus         1 Id~C~~~-PC~n~g~C~~~~~~y~C~C~~G~~G~~Ce~   37 (39)
T d2vj3a2           1 VNECVSN-PCQNDATCLDQIGEFQCICMPGYEGVHCEV   37 (39)
T ss_dssp             CCTTTTC-CCCSSCEEEECSSCEEEECCTTEESSSSCE
T ss_pred             CcCCcCC-CCCCCCEEECCCCCEEEeCCCCCccCcCee
Confidence            4789888 99999999986  67999999999999985



>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure