Psyllid ID: psy623

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------7
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCSQ
ccccccHHHHHHHHHHHHHHHHccccccEEEEccccccEEEEEEEEcccccccccEEEEEEEEEccccc
ccccccHHHHHHHHHHHHHHHccccccEEEEEEcccccEEEEEEEEccccccccccEEEEEEEcccccc
MAQVPTSSALRALSMEYKslqeepvegfrvklvnddnlfewevaifgppdtlyqggyFKVCVVWYKCSQ
maqvptssalRALSMEYKslqeepveGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCSQ
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCSQ
************************VEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKC**
***************EYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKC**
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCSQ
*******SALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYKCSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query69 2.2.26 [Sep-21-2011]
Q29503 238 Ubiquitin-conjugating enz yes N/A 0.898 0.260 0.629 1e-17
Q6ZWZ2 238 Ubiquitin-conjugating enz yes N/A 0.898 0.260 0.629 1e-17
Q712K3 238 Ubiquitin-conjugating enz yes N/A 0.898 0.260 0.629 1e-17
Q8CFI2 235 Ubiquitin-conjugating enz no N/A 0.869 0.255 0.616 4e-15
P49427 236 Ubiquitin-conjugating enz no N/A 0.869 0.254 0.616 4e-15
Q9Y818 167 Ubiquitin-conjugating enz yes N/A 0.855 0.353 0.457 2e-10
Q4R5Y8 170 Ubiquitin-conjugating enz N/A N/A 0.782 0.317 0.481 1e-09
P62255 170 Ubiquitin-conjugating enz no N/A 0.782 0.317 0.481 1e-09
P62254 170 Ubiquitin-conjugating enz no N/A 0.782 0.317 0.481 1e-09
P62253 170 Ubiquitin-conjugating enz no N/A 0.782 0.317 0.481 1e-09
>sp|Q29503|UB2R2_RABIT Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 51/62 (82%)

Query: 1  MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKV 60
          MAQ   +S+ +AL +E KSLQEEPVEGFR+ LV++ +L+ WEVAIFGPP+TLY+GGYFK 
Sbjct: 1  MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKA 60

Query: 61 CV 62
           +
Sbjct: 61 HI 62
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes monoubiquitination and 'Lys-48'-linked polyubiquitination. May be involved in degradation of katenin.
Oryctolagus cuniculus (taxid: 9986)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: 1EC: 9
>sp|Q6ZWZ2|UB2R2_MOUSE Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=2 SV=1 Back     alignment and function description
>sp|Q712K3|UB2R2_HUMAN Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CFI2|UB2R1_MOUSE Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1 Back     alignment and function description
>sp|P49427|UB2R1_HUMAN Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y818|UBC15_SCHPO Ubiquitin-conjugating enzyme E2 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubc15 PE=3 SV=1 Back     alignment and function description
>sp|Q4R5Y8|UB2G1_MACFA Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1 Back     alignment and function description
>sp|P62255|UB2G1_RAT Ubiquitin-conjugating enzyme E2 G1 OS=Rattus norvegicus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62254|UB2G1_MOUSE Ubiquitin-conjugating enzyme E2 G1 OS=Mus musculus GN=Ube2g1 PE=2 SV=3 Back     alignment and function description
>sp|P62253|UB2G1_HUMAN Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens GN=UBE2G1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
346469665 266 hypothetical protein [Amblyomma maculatu 0.869 0.225 0.9 1e-24
427787953 266 Putative ubiquitin-protein ligase [Rhipi 0.869 0.225 0.9 1e-24
322796105148 hypothetical protein SINV_01285 [Solenop 0.898 0.418 0.888 1e-24
427781491 220 Putative ubiquitin-protein ligase [Rhipi 0.869 0.272 0.9 2e-24
307172394 238 Ubiquitin-conjugating enzyme E2 R2 [Camp 0.855 0.247 0.9 1e-23
156552864 242 PREDICTED: ubiquitin-conjugating enzyme 0.855 0.243 0.9 1e-23
307197724 238 Ubiquitin-conjugating enzyme E2 R2 [Harp 0.855 0.247 0.9 1e-23
240974026 278 ubiquitin protein ligase, putative [Ixod 0.869 0.215 0.866 1e-23
242015514 246 ubiquitin-conjugating enzyme E2-32 kDa c 0.855 0.239 0.9 2e-23
312378765 191 hypothetical protein AND_09591 [Anophele 0.855 0.308 0.864 2e-23
>gi|346469665|gb|AEO34677.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 57/60 (95%)

Query: 1  MAQVPTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKV 60
          MAQ PTSSALRAL +E+KSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLY+GGYFK 
Sbjct: 1  MAQQPTSSALRALGLEFKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYEGGYFKA 60

Source: Amblyomma maculatum

Species: Amblyomma maculatum

Genus: Amblyomma

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|427787953|gb|JAA59428.1| Putative ubiquitin-protein ligase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|322796105|gb|EFZ18681.1| hypothetical protein SINV_01285 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|427781491|gb|JAA56197.1| Putative ubiquitin-protein ligase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|307172394|gb|EFN63860.1| Ubiquitin-conjugating enzyme E2 R2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156552864|ref|XP_001600179.1| PREDICTED: ubiquitin-conjugating enzyme E2 R2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307197724|gb|EFN78873.1| Ubiquitin-conjugating enzyme E2 R2 [Harpegnathos saltator] gi|332027425|gb|EGI67508.1| Ubiquitin-conjugating enzyme E2 R2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|240974026|ref|XP_002401731.1| ubiquitin protein ligase, putative [Ixodes scapularis] gi|215491055|gb|EEC00696.1| ubiquitin protein ligase, putative [Ixodes scapularis] gi|442755195|gb|JAA69757.1| Putative ubiquitin protein ligase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|242015514|ref|XP_002428398.1| ubiquitin-conjugating enzyme E2-32 kDa complementing, putative [Pediculus humanus corporis] gi|212513010|gb|EEB15660.1| ubiquitin-conjugating enzyme E2-32 kDa complementing, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|312378765|gb|EFR25246.1| hypothetical protein AND_09591 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query69
FB|FBgn0036516 341 CG7656 [Drosophila melanogaste 0.797 0.161 0.927 2e-24
UNIPROTKB|F1NV52 237 UBE2R2 "Uncharacterized protei 0.855 0.248 0.677 7.5e-18
RGD|1594826 238 Ube2r2 "ubiquitin-conjugating 0.869 0.252 0.65 1.2e-17
UNIPROTKB|J9P7F2 238 UBE2R2 "Uncharacterized protei 0.855 0.247 0.661 1.6e-17
UNIPROTKB|Q712K3 238 UBE2R2 "Ubiquitin-conjugating 0.855 0.247 0.661 1.6e-17
UNIPROTKB|Q29503 238 UBE2R2 "Ubiquitin-conjugating 0.855 0.247 0.661 1.6e-17
MGI|MGI:1914865 238 Ube2r2 "ubiquitin-conjugating 0.855 0.247 0.661 1.6e-17
ZFIN|ZDB-GENE-040718-344 250 ube2r2 "ubiquitin-conjugating 0.797 0.22 0.666 1.1e-16
UNIPROTKB|E1BW49 235 CDC34 "Uncharacterized protein 0.855 0.251 0.627 7.7e-16
WB|WBGene00006702 243 ubc-3 [Caenorhabditis elegans 0.811 0.230 0.649 7.7e-16
FB|FBgn0036516 CG7656 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 279 (103.3 bits), Expect = 2.0e-24, P = 2.0e-24
 Identities = 51/55 (92%), Positives = 55/55 (100%)

Query:     5 PTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFK 59
             P+SSA+RAL+MEYKSLQEEPVEGFRVKL+NDDNLFEWEVAIFGPPDTLYQGGYFK
Sbjct:    59 PSSSAVRALAMEYKSLQEEPVEGFRVKLINDDNLFEWEVAIFGPPDTLYQGGYFK 113
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1NV52 UBE2R2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1594826 Ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7F2 UBE2R2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q712K3 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q29503 UBE2R2 "Ubiquitin-conjugating enzyme E2 R2" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
MGI|MGI:1914865 Ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-344 ube2r2 "ubiquitin-conjugating enzyme E2R 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW49 CDC34 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00006702 ubc-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZWZ2UB2R2_MOUSE6, ., 3, ., 2, ., 1, 90.62900.89850.2605yesN/A
Q29503UB2R2_RABIT6, ., 3, ., 2, ., 1, 90.62900.89850.2605yesN/A
Q712K3UB2R2_HUMAN6, ., 3, ., 2, ., 1, 90.62900.89850.2605yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.19LOW CONFIDENCE prediction!
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 7e-18
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 2e-16
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 2e-16
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 2e-14
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 3e-04
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 71.5 bits (176), Expect = 7e-18
 Identities = 29/56 (51%), Positives = 36/56 (64%)

Query: 5  PTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKV 60
           + SAL+ L  E K LQ++P  G     V+DDNLF WE  I GPPDT Y+GG FK+
Sbjct: 2  SSPSALKRLLKELKKLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKL 57

Length = 153
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 69
KOG0417|consensus148 99.88
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 99.87
KOG0419|consensus152 99.85
KOG0426|consensus165 99.84
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 99.82
PLN00172147 ubiquitin conjugating enzyme; Provisional 99.82
KOG0894|consensus 244 99.82
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 99.73
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 99.72
KOG0425|consensus 171 99.71
KOG0421|consensus175 99.69
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.66
KOG0418|consensus 200 99.65
KOG0424|consensus158 99.6
KOG0428|consensus 314 99.58
KOG0427|consensus161 99.53
KOG0416|consensus 189 99.33
KOG0423|consensus 223 99.28
KOG0422|consensus153 99.23
KOG0895|consensus 1101 98.75
KOG0420|consensus184 98.53
KOG0429|consensus 258 98.49
KOG0895|consensus 1101 98.42
KOG0896|consensus138 98.33
smart0034044 HALZ homeobox associated leucin zipper. 88.11
>KOG0417|consensus Back     alignment and domain information 
Probab=99.88  E-value=1.4e-22  Score=117.74  Aligned_cols=57  Identities=32%  Similarity=0.641  Sum_probs=54.1

Q ss_pred             HHHHHHHHHHHhhhCCCCCEEEEecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecC
Q psy623            9 ALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYK   66 (69)
Q Consensus         9 ~~~Rl~kEl~~l~~~~~~~~~~~~~~~~nl~~w~~~i~GP~~tpY~gg~f~l~i~fp~   66 (69)
                      +.+||.||+++++.+++++|++. ++++|+++|+|+|.||.+||||||+|+|.|.||.
T Consensus         2 a~~RI~kE~~~l~~dp~~~~~~~-~~~dnl~~w~a~I~GP~~SpYEgG~F~l~I~~p~   58 (148)
T KOG0417|consen    2 ASKRIIKELQDLLRDPPPGCSAG-PVGDNLFHWQATILGPPGSPYEGGVFFLEIHFPE   58 (148)
T ss_pred             cHHHHHHHHHHHhcCCCCCCccC-CCCCceeeEEEEEECCCCCCcCCCEEEEEEECCC
Confidence            34699999999999999999999 9999999999999999999999999999999974

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
3rz3_A 183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 7e-16
2ob4_A 180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 7e-16
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 4e-11
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 9e-10
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 2e-07
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 6e-07
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 6e-07
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 6e-07
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 6e-07
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-06
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 2e-06
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 3e-06
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 1e-05
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-05
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 2e-05
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 3e-05
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 1e-04
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 1e-04
1jas_A152 Hsubc2b Length = 152 1e-04
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 2e-04
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 2e-04
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 3e-04
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 3e-04
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 3e-04
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-04
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 3e-04
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 3e-04
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 3e-04
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 4e-04
4ii2_C 163 Crystal Structure Of Ubiquitin Activating Enzyme 1 5e-04
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 5e-04
1x23_A155 Crystal Structure Of Ubch5c Length = 155 5e-04
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 6e-04
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 6e-04
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 6e-04
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 6e-04
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 9e-04
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 45/55 (81%)
Query: 6  TSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKV 60
          + S+ +AL +E K LQEEPVEGFRV LV++ +L+ WEVAIFGPP+T Y+GGYFK 
Sbjct: 5  SPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKA 59
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query69
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 1e-24
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 5e-24
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 9e-24
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 1e-23
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 9e-20
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 7e-19
1ayz_A 169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 9e-19
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 1e-18
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 1e-18
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 1e-18
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 2e-18
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 3e-18
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-18
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 4e-18
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 4e-18
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 3e-17
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 5e-17
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 5e-17
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-16
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 2e-16
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 3e-16
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 4e-16
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 4e-16
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 4e-16
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 5e-16
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 7e-16
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 8e-16
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 1e-15
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 2e-15
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 2e-15
1yh2_A 169 HSPC150 protein similar to ubiquitin-conjugating e 4e-15
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 1e-14
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 3e-14
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 2e-13
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 3e-13
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 3e-13
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 4e-13
1yf9_A 171 Ubiquitin carrier protein 4; SGPP, structural geno 6e-13
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 8e-13
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 1e-12
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 2e-12
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 2e-12
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 2e-12
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 4e-12
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 7e-12
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 8e-12
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 1e-11
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 7e-11
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 8e-11
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 2e-09
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
 Score = 89.0 bits (221), Expect = 1e-24
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 5  PTSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKV 60
                  L  +   L + PVEGF   L++D++L+ WEV I GPPDTLY+GG FK 
Sbjct: 14 LVPRGSLLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKA 69
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 99.87
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 99.87
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 99.87
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 99.87
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 99.86
3rz3_A 183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 99.86
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 99.86
1ayz_A 169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 99.85
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 99.85
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 99.85
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 99.85
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 99.85
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 99.85
1yh2_A 169 HSPC150 protein similar to ubiquitin-conjugating e 99.85
2f4w_A 187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.85
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 99.84
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 99.84
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 99.84
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 99.84
2pwq_A 216 Ubiquitin conjugating enzyme; structural genomics 99.84
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 99.84
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 99.84
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 99.83
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 99.83
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 99.83
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 99.83
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 99.83
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 99.83
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 99.83
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 99.82
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 99.82
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 99.82
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 99.82
3k9o_A 201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.81
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 99.81
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 99.8
3e46_A 253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 99.8
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 99.79
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 99.78
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 99.78
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 99.77
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 99.77
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 99.77
1tte_A 215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 99.76
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 99.74
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 99.74
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 99.74
1yf9_A 171 Ubiquitin carrier protein 4; SGPP, structural geno 99.74
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.72
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 99.72
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 99.69
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.35
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 98.06
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 95.4
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
Probab=99.87  E-value=1e-21  Score=115.78  Aligned_cols=61  Identities=30%  Similarity=0.541  Sum_probs=55.9

Q ss_pred             chHHHHHHHHHHHHhhhCCCCCEEEEecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecC
Q psy623            6 TSSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYK   66 (69)
Q Consensus         6 ~~~~~~Rl~kEl~~l~~~~~~~~~~~~~~~~nl~~w~~~i~GP~~tpY~gg~f~l~i~fp~   66 (69)
                      ++.+.+||++|+++|+++++++|++.+.+++|+++|+++|.||++|||+||+|+|+|.||.
T Consensus         2 ~~~a~~RL~kEl~~l~~~~~~gi~~~~~~~~~l~~w~~~i~GP~~tpYegg~f~~~i~fp~   62 (165)
T 2ucz_A            2 SKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPK   62 (165)
T ss_dssp             CHHHHHHHHHHHHHHHHSCCTTEEEEESSSSCCSEEEEEEECCTTSTTTTCEEEEEEECCT
T ss_pred             ChHHHHHHHHHHHHHHhCCCCCEEEEECCCCCccEEEEEEECCCCCCccCcEEEEEEECCc
Confidence            3578899999999999999999999955568999999999999999999999999999974
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 69
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 1e-15
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 8e-15
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 9e-15
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 3e-14
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 5e-14
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 9e-14
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 5e-13
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 2e-12
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 6e-12
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 6e-12
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 1e-11
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 1e-11
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-11
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-10
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 5e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 5e-10
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 9e-10
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 9e-10
d1yf9a1 158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 1e-09
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 1e-09
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 1e-09
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 2e-09
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 6e-09
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 8e-09
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-08
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 2e-08
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 4e-07
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 4e-06
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 2e-05
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 3e-04
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 G1 [TaxId: 9606]

 Score = 63.5 bits (154), Expect = 1e-15
 Identities = 25/52 (48%), Positives = 35/52 (67%)

Query: 13 LSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVW 64
          L  +   L + PVEGF   L++D++L+ WEV I GPPDTLY+GG FK  + +
Sbjct: 4  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTF 55
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query69
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 99.87
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.87
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.86
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.86
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.85
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.85
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 99.85
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.85
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 99.84
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 99.84
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.84
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 99.83
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.83
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.83
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 99.82
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 99.81
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.8
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.79
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.79
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 99.78
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.77
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 99.74
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.7
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.7
d1yf9a1 158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 99.65
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.58
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 98.39
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 95.44
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Clam (Spisula solidissima), E-2C [TaxId: 6584]

Probab=99.87  E-value=1.6e-22  Score=117.10  Aligned_cols=65  Identities=26%  Similarity=0.435  Sum_probs=58.9

Q ss_pred             CCCCCc-hHHHHHHHHHHHHhhhCCCCCEEEEecCCCCcceEEEEEECCCCCCCCCcEEEEEEEecC
Q psy623            1 MAQVPT-SSALRALSMEYKSLQEEPVEGFRVKLVNDDNLFEWEVAIFGPPDTLYQGGYFKVCVVWYK   66 (69)
Q Consensus         1 m~~~~~-~~~~~Rl~kEl~~l~~~~~~~~~~~~~~~~nl~~w~~~i~GP~~tpY~gg~f~l~i~fp~   66 (69)
                      |+++.. ....+||++|+++|++++++||++. ++++|+++|+++|.||++|||+||+|++.|.||.
T Consensus         1 m~~~~~~~~~~kRl~kEl~~l~~~~~~gi~~~-p~~~dl~~W~~~i~Gp~~t~yegg~f~~~i~fp~   66 (156)
T d2e2ca_           1 MTTSKERHSVSKRLQQELRTLLMSGDPGITAF-PDGDNLFKWVATLDGPKDTVYESLKYKLTLEFPS   66 (156)
T ss_dssp             CCCCCSCCCHHHHHHHHHHHHHHHCCTTEEEE-ESSSCTTEEEEEEECCTTSTTTTCEEEEEEECCT
T ss_pred             CCCCcccchHHHHHHHHHHHHhHCCCCCEEEE-ECCCcccEEEEEEEcCCccccCCCEEEEEEEecC
Confidence            555543 4678999999999999999999999 7889999999999999999999999999999974
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure