Psyllid ID: psy6300


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MVATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
ccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccccEEc
ccccccHHccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHH
mvatddvsdlspeLLLYRASTVHNLPVMCHALALgaskdwtnpnddhrTYLHQAVIgvndvsdlspeLLLYRASTVHNLPVMCHALALgaskdwtnpnddhrTYLHQAVIGNSVMACEYLILNglkincpdaqgktplylatelgHTSQVCLLLKHkadqhivdssgveplTLAVEKANADIVTL
mvatddvsdlspELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVdssgvepltlavekanadivtl
MVATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
************ELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAV**********
MVATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
*********LSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
*VATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
Q6ZQK5770 Arf-GAP with coiled-coil, yes N/A 0.556 0.133 0.539 2e-32
Q5FVC7770 Arf-GAP with coiled-coil, yes N/A 0.556 0.133 0.539 2e-32
Q6IVG4778 Arf-GAP with coiled-coil, yes N/A 0.556 0.132 0.539 4e-32
Q15057778 Arf-GAP with coiled-coil, yes N/A 0.556 0.132 0.539 4e-32
Q5ZK62781 Arf-GAP with coiled-coil, no N/A 0.681 0.161 0.523 2e-30
Q15027740 Arf-GAP with coiled-coil, no N/A 0.681 0.170 0.503 3e-26
A5PK26745 Arf-GAP with coiled-coil, no N/A 0.681 0.169 0.488 1e-24
Q96P50834 Arf-GAP with coiled-coil, no N/A 0.697 0.154 0.488 2e-24
Q8K2H4740 Arf-GAP with coiled-coil, no N/A 0.686 0.171 0.453 4e-23
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.632 0.062 0.319 4e-08
>sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 85/126 (67%)

Query: 60  DVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEY 119
           D   L+P L LYRAS   NLP M  ALA GA  +W N +++  T L QAV+G S++ CE+
Sbjct: 592 DSKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSDENQATPLIQAVLGGSLVTCEF 651

Query: 120 LILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKAN 179
           L+ NG  +N  D QG+ PL+ AT LGHT QVCL LK  A+QH  D  G +PL++AVE AN
Sbjct: 652 LLQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAAN 711

Query: 180 ADIVTL 185
           ADIVTL
Sbjct: 712 ADIVTL 717




GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6).
Mus musculus (taxid: 10090)
>sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=2 SV=1 Back     alignment and function description
>sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 Back     alignment and function description
>sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q15027|ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ACAP1 PE=1 SV=1 Back     alignment and function description
>sp|A5PK26|ACAP1_BOVIN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ACAP1 PE=2 SV=1 Back     alignment and function description
>sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q8K2H4|ACAP1_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Acap1 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
350401296 910 PREDICTED: arf-GAP with coiled-coil, ANK 0.664 0.135 0.731 7e-47
383857513 916 PREDICTED: arf-GAP with coiled-coil, ANK 0.664 0.134 0.731 1e-46
328782537 912 PREDICTED: arf-GAP with coiled-coil, ANK 0.664 0.134 0.723 1e-46
380021290 912 PREDICTED: arf-GAP with coiled-coil, ANK 0.664 0.134 0.723 2e-46
340723352 910 PREDICTED: arf-GAP with coiled-coil, ANK 0.664 0.135 0.723 7e-46
332022484 920 Arf-GAP with coiled-coil, ANK repeat and 0.664 0.133 0.699 8e-46
307192436 868 Centaurin-beta-2 [Harpegnathos saltator] 0.664 0.141 0.691 1e-43
242025396 827 Centaurin-beta, putative [Pediculus huma 0.940 0.210 0.524 2e-43
322790746 867 hypothetical protein SINV_11581 [Solenop 0.664 0.141 0.611 3e-42
193603667 740 PREDICTED: arf-GAP with coiled-coil, ANK 0.681 0.170 0.626 7e-42
>gi|350401296|ref|XP_003486112.1| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  192 bits (487), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 90/123 (73%), Positives = 104/123 (84%)

Query: 63  DLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLIL 122
           +L PE+LLY+A+  HNLPVMC ALA GA K WTN ND  R  LHQA+I  SVM+CEYLIL
Sbjct: 733 NLHPEMLLYKAAAAHNLPVMCAALAAGADKSWTNVNDRGRNALHQAIISGSVMSCEYLIL 792

Query: 123 NGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADI 182
           NG +INC DA GKTPLYLATELGHT+QVCLLLKH+ADQHI D SGV+PL++AV++ANADI
Sbjct: 793 NGARINCQDADGKTPLYLATELGHTAQVCLLLKHRADQHIEDESGVKPLSIAVKEANADI 852

Query: 183 VTL 185
           VTL
Sbjct: 853 VTL 855




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383857513|ref|XP_003704249.1| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328782537|ref|XP_392754.3| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380021290|ref|XP_003694502.1| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|340723352|ref|XP_003400054.1| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332022484|gb|EGI62791.1| Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307192436|gb|EFN75652.1| Centaurin-beta-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242025396|ref|XP_002433110.1| Centaurin-beta, putative [Pediculus humanus corporis] gi|212518651|gb|EEB20372.1| Centaurin-beta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322790746|gb|EFZ15490.1| hypothetical protein SINV_11581 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|193603667|ref|XP_001947780.1| PREDICTED: arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
UNIPROTKB|F1NGZ5834 ACAP3 "Uncharacterized protein 0.729 0.161 0.503 5.4e-32
FB|FBgn0039056828 CenB1A "Centaurin beta 1A" [Dr 0.670 0.149 0.564 2.2e-30
UNIPROTKB|I3LE47484 ACAP2 "Uncharacterized protein 0.675 0.258 0.544 3e-30
UNIPROTKB|I3LBU5474 ACAP2 "Uncharacterized protein 0.681 0.265 0.539 3.8e-30
UNIPROTKB|J9NV32660 ACAP2 "Uncharacterized protein 0.681 0.190 0.547 8.7e-30
UNIPROTKB|F1PAC1782 ACAP2 "Uncharacterized protein 0.681 0.161 0.547 1.4e-29
MGI|MGI:1925868770 Acap2 "ArfGAP with coiled-coil 0.681 0.163 0.539 2.2e-29
RGD|1562939770 Acap2 "ArfGAP with coiled-coil 0.681 0.163 0.539 2.2e-29
UNIPROTKB|Q5FVC7770 Acap2 "Arf-GAP with coiled-coi 0.681 0.163 0.539 2.2e-29
UNIPROTKB|F1MZ03780 ACAP2 "Uncharacterized protein 0.681 0.161 0.539 2.9e-29
UNIPROTKB|F1NGZ5 ACAP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 360 (131.8 bits), Expect = 5.4e-32, P = 5.4e-32
 Identities = 68/135 (50%), Positives = 96/135 (71%)

Query:    51 LHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVI 110
             + Q    + D+ +L P LL+Y+A+   NLP+M  ALA GA  +W N  D+++T L QAV+
Sbjct:   652 IEQEASDLEDLRELHPGLLIYKAAQARNLPLMAEALAHGAEVNWVNDEDENKTPLVQAVM 711

Query:   111 GNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEP 170
             G S++ACE+L+ NG  +N  D++G+ PL+ AT +GHT QVCL LK  A+QH VDS G +P
Sbjct:   712 GGSLIACEFLLQNGADVNQKDSRGRAPLHHATYMGHTGQVCLFLKRGANQHAVDSDGQDP 771

Query:   171 LTLAVEKANADIVTL 185
             L++AV+ ANADIVTL
Sbjct:   772 LSIAVQAANADIVTL 786


GO:0005543 "phospholipid binding" evidence=IEA
GO:0008060 "ARF GTPase activator activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0032312 "regulation of ARF GTPase activity" evidence=IEA
FB|FBgn0039056 CenB1A "Centaurin beta 1A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|I3LE47 ACAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LBU5 ACAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV32 ACAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAC1 ACAP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1925868 Acap2 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1562939 Acap2 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FVC7 Acap2 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZ03 ACAP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZQK5ACAP2_MOUSENo assigned EC number0.53960.55670.1337yesN/A
Q5FVC7ACAP2_RATNo assigned EC number0.53960.55670.1337yesN/A
Q6IVG4ACAP2_RABITNo assigned EC number0.53960.55670.1323yesN/A
Q15057ACAP2_HUMANNo assigned EC number0.53960.55670.1323yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-07
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-05
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-04
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-04
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 72.0 bits (177), Expect = 1e-16
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 2/117 (1%)

Query: 69  LLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKIN 128
            L+ A++  +L V+   L  GA  D    ++D RT LH A     +   + L+  G  +N
Sbjct: 10  PLHLAASNGHLEVVKLLLENGA--DVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVN 67

Query: 129 CPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL 185
             D  G TPL+LA   G+   V LLLKH AD +  D  G  PL LA +  + ++V L
Sbjct: 68  ARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKL 124


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG4412|consensus226 100.0
KOG4412|consensus226 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791 284 ankyrin-like protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA03095 471 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA03100 480 ankyrin repeat protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
PHA02989 494 ankyrin repeat protein; Provisional 99.97
PHA02798 489 ankyrin-like protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA02876 682 ankyrin repeat protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA03095 471 ankyrin-like protein; Provisional 99.96
KOG0509|consensus 600 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
KOG0510|consensus 929 99.96
PHA02876 682 ankyrin repeat protein; Provisional 99.96
KOG0508|consensus 615 99.96
KOG0508|consensus 615 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.96
PHA02798 489 ankyrin-like protein; Provisional 99.96
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.95
KOG0514|consensus452 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.95
PHA02743166 Viral ankyrin protein; Provisional 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.95
KOG4177|consensus 1143 99.95
KOG0510|consensus 929 99.94
PHA02730 672 ankyrin-like protein; Provisional 99.93
PHA02741169 hypothetical protein; Provisional 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.92
PHA02795 437 ankyrin-like protein; Provisional 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
PHA02741169 hypothetical protein; Provisional 99.91
KOG0502|consensus296 99.91
PHA02884 300 ankyrin repeat protein; Provisional 99.91
KOG0502|consensus296 99.91
KOG4177|consensus 1143 99.91
PHA02736154 Viral ankyrin protein; Provisional 99.91
PHA02884 300 ankyrin repeat protein; Provisional 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.9
KOG0512|consensus228 99.9
PHA02792 631 ankyrin-like protein; Provisional 99.9
KOG0505|consensus 527 99.89
KOG0512|consensus228 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
KOG0195|consensus 448 99.86
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.85
KOG0195|consensus 448 99.85
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.85
KOG0507|consensus 854 99.83
KOG0505|consensus 527 99.83
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.82
PHA02792 631 ankyrin-like protein; Provisional 99.82
KOG0507|consensus 854 99.81
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.81
KOG4214|consensus117 99.81
KOG3676|consensus 782 99.8
KOG0514|consensus452 99.74
KOG3676|consensus 782 99.71
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.7
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.69
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.68
KOG4214|consensus117 99.67
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.67
KOG4369|consensus 2131 99.65
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.63
KOG1710|consensus 396 99.61
KOG1710|consensus 396 99.59
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.58
KOG0515|consensus752 99.58
KOG4369|consensus 2131 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.54
KOG0515|consensus752 99.46
KOG0818|consensus 669 99.44
KOG0783|consensus 1267 99.18
PF1360630 Ank_3: Ankyrin repeat 99.14
KOG0818|consensus 669 99.14
PF1360630 Ank_3: Ankyrin repeat 99.1
KOG0506|consensus622 99.1
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.09
KOG0506|consensus622 99.08
KOG0782|consensus1004 99.07
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.99
KOG0782|consensus1004 98.98
KOG0783|consensus 1267 98.89
KOG0705|consensus749 98.85
KOG0521|consensus785 98.79
KOG0522|consensus 560 98.76
KOG0522|consensus 560 98.75
KOG0511|consensus 516 98.69
KOG0705|consensus749 98.55
KOG2384|consensus223 98.52
KOG3609|consensus 822 98.46
KOG0511|consensus 516 98.46
KOG0521|consensus785 98.42
KOG3609|consensus 822 98.38
KOG2384|consensus 223 98.38
KOG0520|consensus 975 98.19
KOG2505|consensus 591 98.1
KOG0520|consensus 975 97.89
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.59
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.58
KOG2505|consensus591 97.04
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.85
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.22
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.21
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.81
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.38
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.45
>KOG4412|consensus Back     alignment and domain information
Probab=100.00  E-value=8.8e-39  Score=203.13  Aligned_cols=156  Identities=23%  Similarity=0.228  Sum_probs=143.4

Q ss_pred             CCCCCC-CCchHHHHHHhcCChHHHHHHH-HcCCCCCCCCCCCCCchhhHHhhccCCcccCCCchhHHHHHHhcCCHHHH
Q psy6300           5 DDVSDL-SPELLLYRASTVHNLPVMCHAL-ALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVM   82 (185)
Q Consensus         5 ~~~~~~-~g~~~l~~A~~~g~~~~~~~ll-~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~   82 (185)
                      .++++. +|.|||||||..|+.+++.+|+ +.+..++.++.                     .|.+|||+|+..|+.+++
T Consensus        30 L~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDd---------------------aGWtPlhia~s~g~~evV   88 (226)
T KOG4412|consen   30 LNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDD---------------------AGWTPLHIAASNGNDEVV   88 (226)
T ss_pred             hhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccc---------------------cCCchhhhhhhcCcHHHH
Confidence            345555 8999999999999999999988 56677777766                     999999999999999999


Q ss_pred             HHHHHc-CCCCCCCCCCCCCChHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHhCCHHHHHHHHhCCCCCC
Q psy6300          83 CHALAL-GASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQH  161 (185)
Q Consensus        83 ~~ll~~-~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~g~~~~  161 (185)
                      +.|+.+ +++++..  +..|.|+||+|+..|..++.++|++.|+.++.+|.+|.||||-|+..|..+++++|+..|+.+|
T Consensus        89 k~Ll~r~~advna~--tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n  166 (226)
T KOG4412|consen   89 KELLNRSGADVNAT--TNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLN  166 (226)
T ss_pred             HHHhcCCCCCccee--cCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCC
Confidence            999988 8999886  7899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCcHHHHHHHhCCcccc
Q psy6300         162 IVDSSGVEPLTLAVEKANADIV  183 (185)
Q Consensus       162 ~~~~~~~t~l~~A~~~~~~~~~  183 (185)
                      ..|+.|+||||.|...|+.+..
T Consensus       167 ~qDk~G~TpL~~al~e~~~d~a  188 (226)
T KOG4412|consen  167 TQDKYGFTPLHHALAEGHPDVA  188 (226)
T ss_pred             cccccCccHHHHHHhccCchHH
Confidence            9999999999999888887654



>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 8e-27
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 9e-27
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 9e-27
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-09
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-08
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-08
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-08
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-08
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 9e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 3e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-07
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 6e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-07
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 7e-07
3eu9_A 240 The Ankyrin Repeat Domain Of Huntingtin Interacting 1e-06
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 4e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 6e-06
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 7e-06
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 2e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 2e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-05
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 9e-05
1qym_A 227 X-Ray Structure Of Human Gankyrin Length = 227 1e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
1uoh_A 226 Human Gankyrin Length = 226 1e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-04
2dvw_A 231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 3e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 4e-04
3aji_A 231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-04
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 8e-27, Method: Compositional matrix adjust. Identities = 64/128 (50%), Positives = 80/128 (62%), Gaps = 1/128 (0%) Query: 59 NDVSDLSPELLLYRAST-VHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMAC 117 D+ L P LL+RAS +LP M ALA GA +W N D+ T L QA NS++AC Sbjct: 192 EDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLAC 251 Query: 118 EYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEK 177 E+L+ NG +N D+ G+ PL+ AT LGHT CL LK AD DS G +PLT+A+E Sbjct: 252 EFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMET 311 Query: 178 ANADIVTL 185 ANADIVTL Sbjct: 312 ANADIVTL 319
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-30
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-27
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-23
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-14
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-19
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-08
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-09
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-14
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-14
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-13
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-15
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-14
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 9e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-12
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-09
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-09
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 1e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-13
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-07
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 8e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-07
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-05
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-13
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-14
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-11
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-13
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-13
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-12
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-10
3v30_A 172 DNA-binding protein rfxank; structural genomics co 1e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-10
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-12
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-09
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 5e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-12
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-09
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-07
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-13
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-08
2y1l_E 169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-12
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-11
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 8e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-06
3hra_A 201 Ankyrin repeat family protein; structural protein; 1e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-12
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-12
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-07
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 6e-05
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 3e-12
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-12
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-10
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-12
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-11
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 1e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-10
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 6e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-11
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-08
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-04
2pnn_A273 Transient receptor potential cation channel subfa 4e-11
2pnn_A 273 Transient receptor potential cation channel subfa 3e-07
2pnn_A273 Transient receptor potential cation channel subfa 4e-07
2pnn_A273 Transient receptor potential cation channel subfa 1e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-10
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
2rfa_A232 Transient receptor potential cation channel subfa 3e-10
2rfa_A232 Transient receptor potential cation channel subfa 4e-10
2rfa_A 232 Transient receptor potential cation channel subfa 7e-10
2rfa_A232 Transient receptor potential cation channel subfa 2e-09
2rfa_A232 Transient receptor potential cation channel subfa 8e-08
2rfa_A 232 Transient receptor potential cation channel subfa 3e-04
2etb_A256 Transient receptor potential cation channel subfam 4e-08
2etb_A256 Transient receptor potential cation channel subfam 6e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-07
2etb_A 256 Transient receptor potential cation channel subfam 2e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
3jxi_A 260 Vanilloid receptor-related osmotically activated p 6e-04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
 Score =  112 bits (280), Expect = 4e-30
 Identities = 57/117 (48%), Positives = 72/117 (61%)

Query: 69  LLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKIN 128
           L   +    +LP M  ALA GA  +W N   D+ T L QA   NS++ACE+L+ NG  +N
Sbjct: 203 LFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAANSLLACEFLLQNGANVN 262

Query: 129 CPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVTL 185
             D+ G+ PL+ AT LGHT   CL LK  AD    DS G +PLT+A+E ANADIVTL
Sbjct: 263 QADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTL 319


>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 100.0
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.98
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.97
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.95
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.95
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.95
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.94
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.94
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.94
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.92
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.92
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.9
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.88
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.86
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=2.7e-38  Score=208.67  Aligned_cols=149  Identities=30%  Similarity=0.350  Sum_probs=143.5

Q ss_pred             hHHHHHHhcCChHHHHHHHHcCCCCCCCCCCCCCchhhHHhhccCCcccCCCchhHHHHHHhcCCHHHHHHHHHcCCCCC
Q psy6300          14 LLLYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGVNDVSDLSPELLLYRASTVHNLPVMCHALALGASKD   93 (185)
Q Consensus        14 ~~l~~A~~~g~~~~~~~ll~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~   93 (185)
                      ++|+.||+.|+.+++++|++.|++++.++.                     .|.|||++|+..++.++++++++.|.+++
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~---------------------~g~t~l~~a~~~~~~~~~~~ll~~gad~~   64 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIENGADVNASDS---------------------DGRTPLHHAAENGHKEVVKLLISKGADVN   64 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHTTCCTTCCCT---------------------TSCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             HHHHHHHHcCCHHHHHHHHHCCCCCCCcCC---------------------CCCCHHHHHHHcCCHHHHHHHHhcccchh
Confidence            579999999999999999999999998887                     99999999999999999999999999998


Q ss_pred             CCCCCCCCChHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHhCCHHHHHHHHhCCCCCCCCCCCCCcHHHH
Q psy6300          94 WTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHIVDSSGVEPLTL  173 (185)
Q Consensus        94 ~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~  173 (185)
                      .+  +..|.||||+|+..|+.+++++|++.|++++..|..|+||||+|+..++.+++++|++.|++++.++..|.|||++
T Consensus        65 ~~--d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~  142 (169)
T 4gpm_A           65 AK--DSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDL  142 (169)
T ss_dssp             CC--CTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHH
T ss_pred             hh--ccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHH
Confidence            76  8899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCcccccC
Q psy6300         174 AVEKANADIVTL  185 (185)
Q Consensus       174 A~~~~~~~~~~~  185 (185)
                      |+..|+.+++++
T Consensus       143 A~~~g~~~iv~~  154 (169)
T 4gpm_A          143 AREHGNEEVVKL  154 (169)
T ss_dssp             HHHTTCHHHHHH
T ss_pred             HHHcCCHHHHHH
Confidence            999999998863



>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-13
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-11
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-10
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-05
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-09
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.004
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.004
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.8 bits (154), Expect = 6e-13
 Identities = 23/83 (27%), Positives = 37/83 (44%)

Query: 103 TYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQVCLLLKHKADQHI 162
           T LH A     +   + L+  G   N  + + +TPL++A   GHT     LL++KA  + 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 163 VDSSGVEPLTLAVEKANADIVTL 185
                  PL  A    + ++V L
Sbjct: 62  KAKDDQTPLHCAARIGHTNMVKL 84


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 100.0
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 100.0
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.98
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.96
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.96
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.96
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.88
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.79
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.7e-35  Score=200.46  Aligned_cols=178  Identities=20%  Similarity=0.161  Sum_probs=154.0

Q ss_pred             CCCCCCCCCCchHHHHHHhcCChHHHHHHHHcCCCCCCCCCCCCCc-------------hhhHHhhccCCcccCCCchhH
Q psy6300           3 ATDDVSDLSPELLLYRASTVHNLPVMCHALALGASKDWTNPNDDHR-------------TYLHQAVIGVNDVSDLSPELL   69 (185)
Q Consensus         3 ~~~~~~~~~g~~~l~~A~~~g~~~~~~~ll~~g~~~~~~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~~   69 (185)
                      ++++.+|..|+||||+|+..|+.++++++++.+............+             +++...+.+.+ ..+..|.||
T Consensus        28 ~~~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~Ll~~~~d~~-~~d~~g~tp  106 (223)
T d1uoha_          28 SLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVN-AVNQNGCTP  106 (223)
T ss_dssp             GGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCSCCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTT-CCCTTCCCH
T ss_pred             CcCcCcCCCCCCHHHHHHHhhhhcccccccccccccccccccccccccccccccccchhHHHhccCceeE-eeCCCCCch
Confidence            4577899999999999999999999999999988776665544333             22233333333 345589999


Q ss_pred             HHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCCChHHHHHHhcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHhCCHHH
Q psy6300          70 LYRASTVHNLPVMCHALALGASKDWTNPNDDHRTYLHQAVIGNSVMACEYLILNGLKINCPDAQGKTPLYLATELGHTSQ  149 (185)
Q Consensus        70 l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~A~~~~~~~~  149 (185)
                      ||+|+..|+.+++++|+++|.+++..  +..|.||||.++..+..+++++|...+.+++..|..|.||||+|+..++.++
T Consensus       107 L~~A~~~~~~e~~~~Ll~~g~d~~~~--~~~~~t~L~~a~~~~~~~~~~~L~~~~~~i~~~d~~g~TpL~~Aa~~g~~~~  184 (223)
T d1uoha_         107 LHYAASKNRHEIAVMLLEGGANPDAK--DHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEE  184 (223)
T ss_dssp             HHHHHHHTCHHHHHHHHHTTCCTTCC--CTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCTTCCCHHHHHHHTTCHHH
T ss_pred             hhHHHHcCCHHHHHHHHHCCCCCCCc--CCCCCccchhhhhcCCcchhhhhccccceeeeccCCCCceeccccccCcHHH
Confidence            99999999999999999999999876  7889999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCCCCCCCCCCCCcHHHHHHHhCCccccc
Q psy6300         150 VCLLLKHKADQHIVDSSGVEPLTLAVEKANADIVT  184 (185)
Q Consensus       150 v~~Ll~~g~~~~~~~~~~~t~l~~A~~~~~~~~~~  184 (185)
                      +++|++.|++++.+|.+|+||||+|. .|+.++++
T Consensus       185 v~~LL~~Gad~~~~d~~g~tpl~~A~-~~~~~i~~  218 (223)
T d1uoha_         185 AKLLVSQGASIYIENKEEKTPLQVAK-GGLGLILK  218 (223)
T ss_dssp             HHHHHHTTCCSCCCCTTSCCHHHHCC-TTHHHHHH
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHH-CCCHHHHh
Confidence            99999999999999999999999984 57776664



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure