Psyllid ID: psy6441


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460----
MIQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTNTPAQLDGKSADVVTTSHHSIVNHSTANTPAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHFSAA
cHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHcHHHHHcccccccccccccccccccHHHHHcccccHHHHHHHHHcccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHcccccccHHHHHHHHHHHHHHcccccccccccccccccHHHccccHHHHccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEEEEEcccccccEEEEEccccccccHHHHHHHHHHHHccccHHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHEccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHEEEEEEEEcccccccEEEEEcccccHccHHHHHHHHHHHHccccHHHHHHHHcccccEEEccHHHHHHHHHHHHEEEEEccccccccEEEccccccEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccc
MIQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKelnidspqTILKIrklpntiirkdKDVARLTMFQEIELVLsqmpdghgsivngmenthlnsarlpfsvlgvsDMDRVKYLEEQLREASCLGDFEAVCELVSKGidinaqhdmnGWTALHWAAKRGQKDIVSYLLKHgadkslltskeetplalatkpevrillggepgvtintadlpivpnyiknepldprvndyqvsnqnrthqtnpvtanqnvvtTSHHsivnhsttntpaqldgksadvvtTSHHSivnhstantpaQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKelnidspqTILKIrklpntiirkdKDVARLTMFQEIELVLsqmpdghgsivngmenthlnsarlpfsakgvnnypsihntkitrfctrtteeipvcgvhdplgslqgendiipgledhfsaa
miqklvlkvriaqdmdddFIEIELNRLTELTYYSLLNICCKELnidspqtilkirklpntiirkdKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADkslltskeetplalatkpevriLLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQnrthqtnpvtanqNVVTTSHHSIVNhsttntpaqldGKSADVVTTSHHSivnhstantpaqLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELnidspqtilkirklpntiirkdKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHFSAA
MIQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTNTPAQLDGKSADVVTTSHHSIVNHSTANTPAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHFSAA
****LVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLT*****PLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNE****************************************************************V*******PAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQ****************
*IQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTNTPAQLDGKSADVVTTSHHSIVNHSTANTPAQLDELVLK*********DFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLS****************HLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHF***
MIQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTNTPAQLDGKSADVVTTSHHSIVNHSTANTPAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHFSAA
*IQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQ*************************************************IVNHSTANTPAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIP*L*D*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQKLVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTNTPAQLDGKSADVVTTSHHSIVNHSTANTPAQLDELVLKVRIAQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPNTIIRKDKDVARLTMFQEIELVLSQMPDGHGSIVNGMENTHLNSARLPFSAKGVNNYPSIHNTKITRFCTRTTEEIPVCGVHDPLGSLQGENDIIPGLEDHFSAA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query464 2.2.26 [Sep-21-2011]
Q6AI12368 Ankyrin repeat domain-con yes N/A 0.232 0.293 0.445 6e-23
Q5SUE8363 Ankyrin repeat domain-con yes N/A 0.232 0.297 0.443 1e-22
Q108U1475 Ankyrin repeat, SAM and b no N/A 0.155 0.151 0.460 8e-08
Q07DZ7474 Ankyrin repeat, SAM and b no N/A 0.155 0.151 0.460 3e-07
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.144 0.017 0.470 5e-07
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.144 0.016 0.470 5e-07
Q07E30475 Ankyrin repeat, SAM and b N/A N/A 0.140 0.136 0.454 9e-07
Q07E43476 Ankyrin repeat, SAM and b N/A N/A 0.148 0.144 0.428 1e-06
Q8VD46475 Ankyrin repeat, SAM and b no N/A 0.140 0.136 0.439 1e-06
Q00PJ3475 Ankyrin repeat, SAM and b N/A N/A 0.140 0.136 0.454 1e-06
>sp|Q6AI12|ANR40_HUMAN Ankyrin repeat domain-containing protein 40 OS=Homo sapiens GN=ANKRD40 PE=1 SV=2 Back     alignment and function desciption
 Score =  109 bits (272), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 53/119 (44%), Positives = 75/119 (63%), Gaps = 11/119 (9%)

Query: 119 KYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHG 178
           K  +E+LREA+ LGD   V +LV  G+D+N+Q+++NGWT LHWA KR    +VSYLLK G
Sbjct: 8   KEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVVSYLLKSG 67

Query: 179 ADKSLLTSKEETPLALATKPEVRILLGGEPGVTI-----------NTADLPIVPNYIKN 226
           ADK +LT+K E P+ L ++ E+R ++G E                  ++LP VPNY+ N
Sbjct: 68  ADKEILTTKGEMPVQLTSRREIRKIMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLAN 126





Homo sapiens (taxid: 9606)
>sp|Q5SUE8|ANR40_MOUSE Ankyrin repeat domain-containing protein 40 OS=Mus musculus GN=Ankrd40 PE=1 SV=1 Back     alignment and function description
>sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 Back     alignment and function description
>sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
52345894345 ankyrin repeat domain 40 [Xenopus (Silur 0.564 0.759 0.373 2e-45
260808919305 hypothetical protein BRAFLDRAFT_199979 [ 0.571 0.868 0.389 3e-44
196000518320 hypothetical protein TRIADDRAFT_53777 [T 0.476 0.690 0.401 7e-44
291238845252 PREDICTED: ankyrin repeat-containing pro 0.459 0.845 0.420 7e-43
268370146260 ankyrin repeat domain 40 [Nasonia vitrip 0.534 0.953 0.373 1e-42
71895839351 ankyrin repeat domain-containing protein 0.566 0.749 0.364 2e-42
348562179364 PREDICTED: ankyrin repeat domain-contain 0.558 0.711 0.36 2e-42
241802305248 ankyrin repeat-containing protein [Ixode 0.469 0.879 0.405 9e-42
344285839367 PREDICTED: ankyrin repeat domain-contain 0.564 0.713 0.350 3e-41
355668498363 ankyrin repeat domain 40 [Mustela putori 0.564 0.721 0.350 3e-41
>gi|52345894|ref|NP_001004991.1| ankyrin repeat domain 40 [Xenopus (Silurana) tropicalis] gi|49522502|gb|AAH75561.1| ankyrin repeat domain 40 [Xenopus (Silurana) tropicalis] gi|89266679|emb|CAJ81427.1| ankyrin repeat domain 40 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
 Score =  189 bits (481), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 172/327 (52%), Gaps = 65/327 (19%)

Query: 121 LEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGAD 180
           +EE LREA+ LGD E V +L+  G ++N+Q+++NGWT LHWA KR    +VS+LL+ GAD
Sbjct: 1   MEEGLREAAALGDLEEVQKLLRCGANVNSQNEINGWTCLHWACKRNHLHVVSFLLEAGAD 60

Query: 181 KSLLTSKEETPLALATKPEVRILLG---GEPGVTINTADLPIVPNYIKNEPLDPRVNDYQ 237
           + +LTSK E P+ L +K +++ LLG    E   T   ++LP VPNY+ N P       + 
Sbjct: 61  EDILTSKGERPVQLTSKKDIKRLLGVEEPETEETKPDSELPFVPNYLANPPFP---YSFS 117

Query: 238 VSNQNRTHQTNPVTANQNVVTTSHHSIVNHSTTN-------------------------- 271
             N ++     P++ N    T  H ++ + S +N                          
Sbjct: 118 RENTDKEPSAAPLSENGTSCTQPHLAVTHSSLSNGMENVCISTSSTSEDPLPALFFNRDV 177

Query: 272 -----------------TPAQLDGKS--ADVVTTSHHSIVNHS----------TANTPAQ 302
                            +PA    +S  + V  + HH  VN            T   P+ 
Sbjct: 178 HVAPDCALSPVQSGPVCSPAVPPNRSLFSPVSNSHHHGSVNAGPMQVFQPFFFTGAFPSN 237

Query: 303 LDELVLKVRI--AQDMDDDFIEIELNRLTELTYYSLLNICCKELNIDSPQTILKIRKLPN 360
           + ELVLKVRI  +   D+DFIE+E++R  ELTY  LL +CC EL + SP+ + KIRKLPN
Sbjct: 238 MKELVLKVRIQCSATGDNDFIEVEMDR-QELTYRELLRVCCVELKV-SPENVEKIRKLPN 295

Query: 361 TIIRKDKDVARLTMFQEIELVLSQMPD 387
           T++RKDKDVARL  FQE+ELVL    D
Sbjct: 296 TMLRKDKDVARLQDFQELELVLRNSAD 322




Source: Xenopus (Silurana) tropicalis

Species: Xenopus (Silurana) tropicalis

Genus: Xenopus

Family: Pipidae

Order: Anura

Class: Amphibia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260808919|ref|XP_002599254.1| hypothetical protein BRAFLDRAFT_199979 [Branchiostoma floridae] gi|229284531|gb|EEN55266.1| hypothetical protein BRAFLDRAFT_199979 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|196000518|ref|XP_002110127.1| hypothetical protein TRIADDRAFT_53777 [Trichoplax adhaerens] gi|190588251|gb|EDV28293.1| hypothetical protein TRIADDRAFT_53777 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|291238845|ref|XP_002739336.1| PREDICTED: ankyrin repeat-containing protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|268370146|ref|NP_001161255.1| ankyrin repeat domain 40 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|71895839|ref|NP_001026702.1| ankyrin repeat domain-containing protein 40 [Gallus gallus] gi|53131996|emb|CAG31863.1| hypothetical protein RCJMB04_12j7 [Gallus gallus] Back     alignment and taxonomy information
>gi|348562179|ref|XP_003466888.1| PREDICTED: ankyrin repeat domain-containing protein 40-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|241802305|ref|XP_002414525.1| ankyrin repeat-containing protein [Ixodes scapularis] gi|215508736|gb|EEC18190.1| ankyrin repeat-containing protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|344285839|ref|XP_003414667.1| PREDICTED: ankyrin repeat domain-containing protein 40 [Loxodonta africana] Back     alignment and taxonomy information
>gi|355668498|gb|AER94211.1| ankyrin repeat domain 40 [Mustela putorius furo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query464
MGI|MGI:1918702363 Ankrd40 "ankyrin repeat domain 0.271 0.347 0.413 1.4e-44
UNIPROTKB|Q6AI12368 ANKRD40 "Ankyrin repeat domain 0.239 0.301 0.448 2.8e-43
WB|WBGene00011270 489 R31.2c [Caenorhabditis elegans 0.282 0.267 0.335 3.5e-07
UNIPROTKB|Q108U1475 ASZ1 "Ankyrin repeat, SAM and 0.155 0.151 0.460 5.5e-07
UNIPROTKB|Q5ZIZ1172 PPP1R12A "Protein phosphatase 0.185 0.5 0.384 7.4e-07
UNIPROTKB|I3LPC2444 ANKRD11 "Uncharacterized prote 0.209 0.218 0.355 1e-06
MGI|MGI:1921318475 Asz1 "ankyrin repeat, SAM and 0.469 0.458 0.261 1.2e-06
UNIPROTKB|E1C390130 DYSFIP1 "Uncharacterized prote 0.142 0.507 0.432 1.3e-06
UNIPROTKB|G3MY56159 PPP1R27 "Uncharacterized prote 0.168 0.490 0.4 1.3e-06
ZFIN|ZDB-GENE-050208-136418 gabpb2b "GA repeat binding pro 0.394 0.437 0.270 1.6e-06
MGI|MGI:1918702 Ankrd40 "ankyrin repeat domain 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 1.4e-44, Sum P(2) = 1.4e-44
 Identities = 57/138 (41%), Positives = 86/138 (62%)

Query:   119 KYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHG 178
             K  +E+LREA+ LGD   V +LV  G+D+N+Q+++NGWT LHWA KR    +VSYLL+ G
Sbjct:     8 KEQQERLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHGQVVSYLLQSG 67

Query:   179 ADKSLLTSKEETPLALATKPEVRILLGGE--------PGVTINTADLPIVPNYIKNEPLD 230
             AD+ +LT+K E P+ L ++ E+R ++G E        P +    ++LP VPNY+ N P  
Sbjct:    68 ADREILTTKGEMPVQLTSRREIRKIMGVEEADEEEEIPQLK-KESELPFVPNYLAN-PAF 125

Query:   231 PRVNDYQVSNQNRTHQTN 248
             P +  Y  + ++ T   N
Sbjct:   126 PFI--YTPAAEDSTQLQN 141


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q6AI12 ANKRD40 "Ankyrin repeat domain-containing protein 40" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00011270 R31.2c [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q108U1 ASZ1 "Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1" [Loxodonta africana (taxid:9785)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIZ1 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LPC2 ANKRD11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1921318 Asz1 "ankyrin repeat, SAM and basic leucine zipper domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C390 DYSFIP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3MY56 PPP1R27 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-136 gabpb2b "GA repeat binding protein, beta 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-13
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 9e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
smart0024830 smart00248, ANK, ankyrin repeats 9e-06
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-05
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 6e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.003
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 69.7 bits (171), Expect = 1e-14
 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 125 LREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLL 184
           L  A+  G  E V  L+ KG D+NA+ D +G T LH AA+ G  D+V  LLKHGAD +  
Sbjct: 44  LHLAAKNGHLEIVKLLLEKGADVNAR-DKDGNTPLHLAARNGNLDVVKLLLKHGADVNAR 102

Query: 185 TSKEETPLALATK 197
                TPL LA K
Sbjct: 103 DKDGRTPLHLAAK 115


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 464
KOG4412|consensus226 99.94
KOG4412|consensus226 99.92
PHA02791284 ankyrin-like protein; Provisional 99.89
PHA02874434 ankyrin repeat protein; Provisional 99.89
PHA02791284 ankyrin-like protein; Provisional 99.89
KOG0509|consensus 600 99.88
PHA03100480 ankyrin repeat protein; Provisional 99.88
PHA02875413 ankyrin repeat protein; Provisional 99.88
PHA02878477 ankyrin repeat protein; Provisional 99.87
PHA02875413 ankyrin repeat protein; Provisional 99.87
PHA02878477 ankyrin repeat protein; Provisional 99.87
PHA03100480 ankyrin repeat protein; Provisional 99.86
KOG0509|consensus 600 99.86
PHA02946446 ankyin-like protein; Provisional 99.85
PHA02874434 ankyrin repeat protein; Provisional 99.85
PHA03095471 ankyrin-like protein; Provisional 99.85
PHA02859209 ankyrin repeat protein; Provisional 99.85
PHA02859209 ankyrin repeat protein; Provisional 99.85
PHA02876682 ankyrin repeat protein; Provisional 99.84
KOG0508|consensus 615 99.84
PHA02946446 ankyin-like protein; Provisional 99.83
PHA03095471 ankyrin-like protein; Provisional 99.83
PHA02741169 hypothetical protein; Provisional 99.82
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.82
KOG0510|consensus 929 99.81
KOG0508|consensus 615 99.81
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.81
PHA02798489 ankyrin-like protein; Provisional 99.8
KOG0514|consensus452 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.79
PHA02798489 ankyrin-like protein; Provisional 99.79
KOG0510|consensus 929 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.78
PHA02989494 ankyrin repeat protein; Provisional 99.78
PHA02876682 ankyrin repeat protein; Provisional 99.78
KOG0512|consensus228 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.77
PLN03192823 Voltage-dependent potassium channel; Provisional 99.77
PHA02917 661 ankyrin-like protein; Provisional 99.77
PHA02795437 ankyrin-like protein; Provisional 99.76
PHA02917 661 ankyrin-like protein; Provisional 99.76
PLN03192823 Voltage-dependent potassium channel; Provisional 99.75
KOG4177|consensus 1143 99.75
PHA02989494 ankyrin repeat protein; Provisional 99.74
KOG0502|consensus296 99.73
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.73
PHA02795437 ankyrin-like protein; Provisional 99.72
KOG4177|consensus 1143 99.71
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.7
KOG0195|consensus448 99.7
PHA02743166 Viral ankyrin protein; Provisional 99.7
PHA02736154 Viral ankyrin protein; Provisional 99.68
KOG0502|consensus296 99.67
PHA02741169 hypothetical protein; Provisional 99.67
KOG0512|consensus228 99.67
KOG0505|consensus527 99.65
KOG0195|consensus448 99.65
PHA02730 672 ankyrin-like protein; Provisional 99.65
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.64
KOG0507|consensus 854 99.63
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.62
KOG0514|consensus452 99.62
KOG4214|consensus117 99.6
PHA02884300 ankyrin repeat protein; Provisional 99.56
PHA02730 672 ankyrin-like protein; Provisional 99.53
PHA02792631 ankyrin-like protein; Provisional 99.52
KOG0505|consensus527 99.51
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
PHA02792 631 ankyrin-like protein; Provisional 99.48
KOG0507|consensus 854 99.47
KOG3676|consensus 782 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.42
KOG3676|consensus 782 99.4
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.4
KOG0515|consensus752 99.39
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.34
KOG1710|consensus396 99.31
KOG4369|consensus 2131 99.29
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.29
KOG4369|consensus 2131 99.27
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.25
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.22
KOG4214|consensus117 99.17
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.16
KOG0515|consensus752 99.03
KOG1710|consensus396 98.98
KOG0783|consensus 1267 98.83
PF1360630 Ank_3: Ankyrin repeat 98.72
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.68
KOG0818|consensus 669 98.53
KOG0506|consensus622 98.49
KOG0818|consensus 669 98.47
KOG0506|consensus622 98.47
PF1360630 Ank_3: Ankyrin repeat 98.45
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.43
KOG0783|consensus 1267 98.4
KOG0705|consensus749 98.35
KOG0782|consensus1004 98.34
KOG0522|consensus 560 98.26
KOG0511|consensus 516 98.22
KOG0705|consensus749 98.1
KOG0782|consensus1004 98.06
KOG0522|consensus 560 98.01
KOG0521|consensus785 97.98
KOG2384|consensus223 97.9
KOG0520|consensus975 97.9
KOG0521|consensus785 97.74
KOG2384|consensus223 97.62
KOG0511|consensus 516 97.54
KOG2505|consensus591 97.26
KOG3609|consensus 822 97.22
KOG0520|consensus975 97.13
KOG3609|consensus 822 97.07
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.99
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.2
KOG2505|consensus591 94.5
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.03
>KOG4412|consensus Back     alignment and domain information
Probab=99.94  E-value=1.6e-27  Score=217.02  Aligned_cols=165  Identities=25%  Similarity=0.241  Sum_probs=148.0

Q ss_pred             cCCCCCcchhhhhhcCChhhhhcchhhcCCCcccccchhhhHHHHHHhcCCHHHHHHHHHC-CCCcccccCCCCCcHHHH
Q psy6441          83 QMPDGHGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSK-GIDINAQHDMNGWTALHW  161 (464)
Q Consensus        83 ~~~~g~TpLh~Aa~~G~~~iVk~LL~~~ga~~~~~d~~G~TpLh~Aa~~G~~eiVk~LL~~-Gadvn~~dd~~G~TpLH~  161 (464)
                      .+.+|+|||||||..|+.++|.+|+...+..++.+|..||||||.||..|+.++|+.|+.+ |+|+|+.+. .|.|||||
T Consensus        34 ~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn-~G~T~LHy  112 (226)
T KOG4412|consen   34 DDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTN-GGQTCLHY  112 (226)
T ss_pred             ccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecC-CCcceehh
Confidence            3459999999999999999999999877999999999999999999999999999999999 999999966 99999999


Q ss_pred             HHHcCCHHHHHHHHHCCCCCCCCCCCCCchhHhhc---cHHHHHHHhCCCCCcccCCCCCCCcccccCCCCcHHHHHHHH
Q psy6441         162 AAKRGQKDIVSYLLKHGADKSLLTSKEETPLALAT---KPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQV  238 (464)
Q Consensus       162 Aa~~G~~eiv~lLL~~GAdin~~D~~G~TPLh~A~---~~~i~~LL~~~~~~~~~~~~~~~tpl~laa~~~h~a~~~~l~  238 (464)
                      |+..|..+|+++|+++||.++++|..|.||||-|+   +..++++|...+...+..+..|+||++++--.+|.++.-.|+
T Consensus       113 AagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~al~e~~~d~a~lLV  192 (226)
T KOG4412|consen  113 AAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHALAEGHPDVAVLLV  192 (226)
T ss_pred             hhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHHHhccCchHHHHHH
Confidence            99999999999999999999999999999999996   668888887666666778889999999996667888888888


Q ss_pred             hCCCCCCCCC
Q psy6441         239 SNQNRTHQTN  248 (464)
Q Consensus       239 sn~~~~~~~~  248 (464)
                      +.++......
T Consensus       193 ~~gAd~~~ed  202 (226)
T KOG4412|consen  193 RAGADTDRED  202 (226)
T ss_pred             Hhccceeecc
Confidence            7775554443



>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-08
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-07
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-07
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 6e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 6e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 6e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 7e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 7e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-06
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 1e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 8e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-05
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-05
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-05
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 5e-05
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-05
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 1e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-04
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-04
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 5e-04
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 57.8 bits (138), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 40/96 (41%), Positives = 54/96 (56%), Gaps = 7/96 (7%) Query: 125 LREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLL 184 L A+ G E V L+SKG D+NA+ D +G T LH+AAK G K+IV L+ GAD + Sbjct: 41 LHYAAKEGHKEIVKLLISKGADVNAK-DSDGRTPLHYAAKEGHKEIVKLLISKGADVNAK 99 Query: 185 TSKEETPLALATKPE----VRILLGGEPGVTINTAD 216 S TPL A K V++L+ G +NT+D Sbjct: 100 DSDGRTPLHYAAKEGHKEIVKLLI--SKGADVNTSD 133
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query464
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-04
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-14
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-16
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-13
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-11
2rfa_A232 Transient receptor potential cation channel subfa 2e-13
2rfa_A232 Transient receptor potential cation channel subfa 5e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 8e-10
2rfa_A232 Transient receptor potential cation channel subfa 8e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-10
2etb_A256 Transient receptor potential cation channel subfam 4e-10
2etb_A256 Transient receptor potential cation channel subfam 4e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2etb_A256 Transient receptor potential cation channel subfam 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 8e-10
2pnn_A273 Transient receptor potential cation channel subfa 7e-09
2pnn_A273 Transient receptor potential cation channel subfa 3e-08
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-06
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
 Score = 81.5 bits (202), Expect = 4e-19
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 12/91 (13%)

Query: 118 VKYLEEQ-----------LREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRG 166
              L  +           L EA+  G  + V  L++ G D+ A+ D NG T LH AA+ G
Sbjct: 10  SSGLVPRGSHMGSDLGKKLLEAARAGQDDEVRILMANGADVAAK-DKNGSTPLHLAARNG 68

Query: 167 QKDIVSYLLKHGADKSLLTSKEETPLALATK 197
             ++V  LL+ GAD        +T   ++  
Sbjct: 69  HLEVVKLLLEAGADVXAQDKFGKTAFDISID 99


>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.93
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.92
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.92
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.92
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.92
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
2pnn_A273 Transient receptor potential cation channel subfa 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.91
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
2rfa_A232 Transient receptor potential cation channel subfa 99.91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.91
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.9
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.9
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.9
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.9
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.9
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.9
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.9
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.9
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.89
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.89
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.89
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3hra_A201 Ankyrin repeat family protein; structural protein; 99.89
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.88
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
2etb_A256 Transient receptor potential cation channel subfam 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.87
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.87
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.86
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.86
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.86
2pnn_A273 Transient receptor potential cation channel subfa 99.86
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.82
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.82
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.78
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.78
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.78
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.78
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.77
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.77
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.76
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.72
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.71
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.66
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.62
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.94  E-value=3.1e-27  Score=216.46  Aligned_cols=154  Identities=26%  Similarity=0.256  Sum_probs=127.4

Q ss_pred             cchhhhhhcCChhhhhcchhhcCCCcccccchhhhHHHHHHhcCCHHHHHHHHHCCCCcccccCCCCCcHHHHHHHcCCH
Q psy6441          89 GSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQK  168 (464)
Q Consensus        89 TpLh~Aa~~G~~~iVk~LL~~~ga~~~~~d~~G~TpLh~Aa~~G~~eiVk~LL~~Gadvn~~dd~~G~TpLH~Aa~~G~~  168 (464)
                      ++|+.||+.|+.++|+.|++. |++++.+|..|+||||+|+..++.+++++|+++|++++.++. .|+||||+|+..|+.
T Consensus         6 ~~L~~Aa~~G~~~~v~~Ll~~-Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~-~g~TpLh~A~~~g~~   83 (169)
T 4gpm_A            6 KRLIEAAENGNKDRVKDLIEN-GADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDS-DGRTPLHHAAENGHK   83 (169)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHT-TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHTTCH
T ss_pred             HHHHHHHHcCCHHHHHHHHHC-CCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhcc-CCCCHHHHHHHcCCH
Confidence            358889999999999999988 899999999999999999999999999999999999998854 899999999999999


Q ss_pred             HHHHHHHHCCCCCCCCCCCCCchhHhhc---cHHHHHHHhCCCCCcccCCCCCCCcccccCCCCcHHHHHHHHhCCCCC
Q psy6441         169 DIVSYLLKHGADKSLLTSKEETPLALAT---KPEVRILLGGEPGVTINTADLPIVPNYIKNEPLDPRVNDYQVSNQNRT  244 (464)
Q Consensus       169 eiv~lLL~~GAdin~~D~~G~TPLh~A~---~~~i~~LL~~~~~~~~~~~~~~~tpl~laa~~~h~a~~~~l~sn~~~~  244 (464)
                      +++++|+++|+++|.+|.+|+||||+|+   +.+++++|...+......+..+.||+++|...++.++.++|+++++..
T Consensus        84 ~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~iv~~Ll~~GA~i  162 (169)
T 4gpm_A           84 EVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQGGWL  162 (169)
T ss_dssp             HHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHTC----
T ss_pred             HHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCc
Confidence            9999999999999999999999999986   567777774443333455677889999999889999999888776543



>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 464
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.004
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-12
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 75.0 bits (183), Expect = 3e-15
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 125 LREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQKDIVSYLLKHGADKSLL 184
           L  AS +G    V  L+ +G   N   ++   T LH AA+ G  ++  YLL++ A  +  
Sbjct: 4   LHVASFMGHLPIVKNLLQRGASPNVS-NVKVETPLHMAARAGHTEVAKYLLQNKAKVNAK 62

Query: 185 TSKEETPLALATK 197
              ++TPL  A +
Sbjct: 63  AKDDQTPLHCAAR 75


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query464
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.9
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.86
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.86
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.85
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.85
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.83
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.82
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.81
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.81
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.8
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.8
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.8
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.8
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.79
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.78
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.77
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.77
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.73
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.73
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.72
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.71
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.69
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.62
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.91  E-value=5.7e-26  Score=193.60  Aligned_cols=115  Identities=25%  Similarity=0.267  Sum_probs=109.1

Q ss_pred             CcchhhhhhcCChhhhhcchhhcCCCcccccchhhhHHHHHHhcCCHHHHHHHHHCCCCcccccCCCCCcHHHHHHHcCC
Q psy6441          88 HGSIVNGMENTHLNSARLPFSVLGVSDMDRVKYLEEQLREASCLGDFEAVCELVSKGIDINAQHDMNGWTALHWAAKRGQ  167 (464)
Q Consensus        88 ~TpLh~Aa~~G~~~iVk~LL~~~ga~~~~~d~~G~TpLh~Aa~~G~~eiVk~LL~~Gadvn~~dd~~G~TpLH~Aa~~G~  167 (464)
                      .|||++|++.|+.++|++|++. |++++.++..|+||||+|+..|+.+++++|+++|+++|.+|. .|+||||+|+.+|+
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~-g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~-~g~tpLh~A~~~~~   80 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAK-GEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDK-HHITPLLSAVYEGH   80 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTT-TCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSS-SCSCHHHHHHTTTC
T ss_pred             ChHHHHHHHCCCHHHHHHHHHh-hhccccccccccccccccccccccccccccccccceeeeccc-ccccchhhhhhcCc
Confidence            4799999999999999999999 999999999999999999999999999999999999999954 99999999999999


Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCchhHhhccHHHHHHH
Q psy6441         168 KDIVSYLLKHGADKSLLTSKEETPLALATKPEVRILL  204 (464)
Q Consensus       168 ~eiv~lLL~~GAdin~~D~~G~TPLh~A~~~~i~~LL  204 (464)
                      .+++++|+++|+|++.+|..|+||||+|.+..+..+|
T Consensus        81 ~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~~~~i~~LL  117 (118)
T d1myoa_          81 VSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALL  117 (118)
T ss_dssp             CHHHHHHHTTCCCSSSSSSSTCCCCCTCSSTTTGGGG
T ss_pred             hhhhhhhhcccccceeeCCCCCCHHHHHhHHHHHHhc
Confidence            9999999999999999999999999999876666655



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure