Psyllid ID: psy6552


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNAEKETI
ccccccHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccEEEEEEccEEEEEEcccccccHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHcccEEEEcccccccccEEccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccHHHHcccccHHHHHEEEEHHHHHHHHccccccEcHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccEEEEEEcccEEEEEEccHHccHHHHHHHHHHHHHccccEcHHHHHHHccccHHHHHHHHHHHHHcccEEEEcccccccEEEcHHHHHHHHccccccc
mrrragvgaiqKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASigvdplasrkGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKsrgkslqhqdiTNEDLLAAAKKLKIfgngfsiipigqgqylvqsipgelsldHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEgyawidtqspqehlywfpsLFTECMNAEKETI
mrrragvgaiqkqkleqekykdKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSrgkslqhqditnEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNAEKETI
MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNAEKETI
**********************************************************KDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECM*******
**RRAGVGAIQ*********************EQLSQHLNTFRDK********************HFQEMCASIGVDPLASR***WSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVK**G******DITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFT**********
**********QKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRL**********QDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNAEKETI
****AGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRG*****QDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNA*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQxxxxxxxxxxxxxxxxxxxxxYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNAEKETI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query254 2.2.26 [Sep-21-2011]
Q5U3V9258 Vacuolar-sorting protein yes N/A 0.952 0.937 0.544 5e-77
Q9CZ28258 Vacuolar-sorting protein yes N/A 0.960 0.945 0.54 8e-76
Q96H20258 Vacuolar-sorting protein yes N/A 0.960 0.945 0.54 1e-75
Q5RK19258 Vacuolar-sorting protein yes N/A 0.960 0.945 0.54 1e-75
Q5RJU0257 Vacuolar-sorting protein yes N/A 0.937 0.926 0.549 2e-75
Q5M759250 Vacuolar protein sorting- yes N/A 0.933 0.948 0.434 5e-53
Q54RC4246 Vacuolar-sorting protein yes N/A 0.944 0.975 0.440 2e-52
O94663252 Vacuolar-sorting protein yes N/A 0.925 0.932 0.320 1e-34
Q12483233 Vacuolar-sorting protein yes N/A 0.897 0.978 0.325 7e-29
Q9LIJ4120 Putative vacuolar protein no N/A 0.448 0.95 0.516 1e-26
>sp|Q5U3V9|SNF8_DANRE Vacuolar-sorting protein SNF8 OS=Danio rerio GN=snf8 PE=2 SV=2 Back     alignment and function desciption
 Score =  287 bits (735), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 187/248 (75%), Gaps = 6/248 (2%)

Query: 2   RRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDA 61
           RR  G GAI K+KL + KYK++G+ + E+Q+ Q+S+ L+TF+  LE FAS++K EI+K +
Sbjct: 3   RRGVGAGAIAKKKLAEAKYKERGSVLAEDQIAQMSKQLDTFKTHLEEFASKHKQEIRKSS 62

Query: 62  QFRRHFQEMCASIGVDPLASRKGFWS-LLGMGDFYYELSVQIVEVCLATNYKNGGLILLD 120
           QFR  FQEMCA+IGVDPLAS KGFWS +LG+GDFYYEL VQI+EVCLA  ++NGGLI LD
Sbjct: 63  QFRVQFQEMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLD 122

Query: 121 ELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLD 180
           EL  R++K RGK    QD++ +DL+ A KKLK  GNGF +IP+G G YLVQS+P EL++D
Sbjct: 123 ELHHRVLKGRGKFA--QDVSQDDLVRAIKKLKAMGNGFGMIPVG-GTYLVQSVPAELNMD 179

Query: 181 HSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFP 240
           H++VLQ   ++ + +++VS +   L W  ERA H LD +++EG AW+D+Q+  E  YW P
Sbjct: 180 HTVVLQ--LAEKKGYVTVSEIRESLKWEKERACHVLDHLLKEGLAWLDSQAAGEPQYWLP 237

Query: 241 SLFTECMN 248
           +LF+E ++
Sbjct: 238 ALFSELLS 245




Component of the ESCRT-II complex, which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.
Danio rerio (taxid: 7955)
>sp|Q9CZ28|SNF8_MOUSE Vacuolar-sorting protein SNF8 OS=Mus musculus GN=Snf8 PE=2 SV=1 Back     alignment and function description
>sp|Q96H20|SNF8_HUMAN Vacuolar-sorting protein SNF8 OS=Homo sapiens GN=SNF8 PE=1 SV=1 Back     alignment and function description
>sp|Q5RK19|SNF8_RAT Vacuolar-sorting protein SNF8 OS=Rattus norvegicus GN=Snf8 PE=1 SV=1 Back     alignment and function description
>sp|Q5RJU0|SNF8_XENTR Vacuolar-sorting protein SNF8 OS=Xenopus tropicalis GN=snf8 PE=2 SV=1 Back     alignment and function description
>sp|Q5M759|VP221_ARATH Vacuolar protein sorting-associated protein 22 homolog 1 OS=Arabidopsis thaliana GN=VP22-1 PE=2 SV=2 Back     alignment and function description
>sp|Q54RC4|SNF8_DICDI Vacuolar-sorting protein SNF8 OS=Dictyostelium discoideum GN=snf8 PE=3 SV=1 Back     alignment and function description
>sp|O94663|SNF8_SCHPO Vacuolar-sorting protein dot2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dot2 PE=3 SV=1 Back     alignment and function description
>sp|Q12483|SNF8_YEAST Vacuolar-sorting protein SNF8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF8 PE=1 SV=1 Back     alignment and function description
>sp|Q9LIJ4|VP222_ARATH Putative vacuolar protein sorting-associated protein 22 homolog 2 OS=Arabidopsis thaliana GN=VP22-2 PE=5 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
332024593251 Vacuolar-sorting protein SNF8 [Acromyrme 0.972 0.984 0.724 1e-107
380010929251 PREDICTED: vacuolar-sorting protein SNF8 0.972 0.984 0.716 1e-105
307167587251 Vacuolar-sorting protein SNF8 [Camponotu 0.972 0.984 0.712 1e-105
328788910251 PREDICTED: vacuolar-sorting protein SNF8 0.972 0.984 0.716 1e-105
307207318251 Vacuolar-sorting protein SNF8 [Harpegnat 0.972 0.984 0.708 1e-105
322796202250 hypothetical protein SINV_10899 [Solenop 0.972 0.988 0.700 1e-104
114051099249 ELL complex EAP30 subunit [Bombyx mori] 0.980 1.0 0.686 1e-103
357614605250 ELL complex EAP30 subunit [Danaus plexip 0.980 0.996 0.702 1e-103
345485615251 PREDICTED: vacuolar-sorting protein SNF8 0.972 0.984 0.716 1e-103
242247603249 ELL complex EAP30 subunit-like [Acyrthos 0.980 1.0 0.658 9e-99
>gi|332024593|gb|EGI64791.1| Vacuolar-sorting protein SNF8 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 214/247 (86%)

Query: 1   MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKD 60
           MRR+AGVGAIQKQKLEQEKY+DKGT IQENQ EQ+++H+ TFR  LE FAS+YKNEIKK+
Sbjct: 1   MRRKAGVGAIQKQKLEQEKYRDKGTEIQENQFEQMTKHMETFRVNLEEFASKYKNEIKKN 60

Query: 61  AQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLD 120
           AQFRR F EMCASIGVDPLAS KGFWS+LG+GDFYYEL+VQIVEVC+ATNYKNGGLI LD
Sbjct: 61  AQFRRQFTEMCASIGVDPLASGKGFWSVLGIGDFYYELAVQIVEVCMATNYKNGGLISLD 120

Query: 121 ELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLD 180
           ELRTRL+++RG+  +HQ+ITNEDLLAAAKKLKIFGNGFS++PIG+G++LVQSIPGELS+D
Sbjct: 121 ELRTRLIQARGRRKEHQEITNEDLLAAAKKLKIFGNGFSVVPIGRGKHLVQSIPGELSMD 180

Query: 181 HSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFP 240
           H+ VL Q +    A++S S+L  EL W  +RAQ ALD M++EG AW+D Q+  E LYWFP
Sbjct: 181 HTAVLSQASLSTNAYVSKSILCKELKWEEDRAQKALDHMMKEGLAWLDRQAKDETLYWFP 240

Query: 241 SLFTECM 247
           SLFT C+
Sbjct: 241 SLFTACI 247




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380010929|ref|XP_003689568.1| PREDICTED: vacuolar-sorting protein SNF8-like isoform 1 [Apis florea] gi|380010931|ref|XP_003689569.1| PREDICTED: vacuolar-sorting protein SNF8-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|307167587|gb|EFN61131.1| Vacuolar-sorting protein SNF8 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328788910|ref|XP_003251206.1| PREDICTED: vacuolar-sorting protein SNF8 [Apis mellifera] Back     alignment and taxonomy information
>gi|307207318|gb|EFN85068.1| Vacuolar-sorting protein SNF8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322796202|gb|EFZ18778.1| hypothetical protein SINV_10899 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|114051099|ref|NP_001040397.1| ELL complex EAP30 subunit [Bombyx mori] gi|95102746|gb|ABF51314.1| ELL complex EAP30 subunit isoform 1 [Bombyx mori] gi|411100662|gb|AFW03816.1| Vps22 [Bombyx mori] Back     alignment and taxonomy information
>gi|357614605|gb|EHJ69169.1| ELL complex EAP30 subunit [Danaus plexippus] Back     alignment and taxonomy information
>gi|345485615|ref|XP_003425304.1| PREDICTED: vacuolar-sorting protein SNF8-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242247603|ref|NP_001156166.1| ELL complex EAP30 subunit-like [Acyrthosiphon pisum] gi|239792933|dbj|BAH72744.1| ACYPI004419 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query254
FB|FBgn0260940254 lsn "larsen" [Drosophila melan 0.956 0.956 0.592 1.3e-77
ZFIN|ZDB-GENE-041114-117258 snf8 "SNF8, ESCRT-II complex s 0.960 0.945 0.548 3.7e-71
UNIPROTKB|Q08DR7258 SNF8 "Uncharacterized protein" 0.960 0.945 0.544 7.7e-71
UNIPROTKB|I3L6X7258 SNF8 "Uncharacterized protein" 0.960 0.945 0.544 1.6e-70
MGI|MGI:1343161258 Snf8 "SNF8, ESCRT-II complex s 0.960 0.945 0.54 2.1e-70
UNIPROTKB|Q96H20258 SNF8 "Vacuolar-sorting protein 0.960 0.945 0.54 3.3e-70
RGD|1310144258 Snf8 "SNF8, ESCRT-II complex s 0.960 0.945 0.54 3.3e-70
UNIPROTKB|E2RTF6258 SNF8 "Uncharacterized protein" 0.960 0.945 0.54 4.3e-70
UNIPROTKB|E1BZH7258 SNF8 "Uncharacterized protein" 0.960 0.945 0.532 1.8e-69
WB|WBGene00016167269 vps-22 [Caenorhabditis elegans 0.984 0.929 0.484 1.8e-64
FB|FBgn0260940 lsn "larsen" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 781 (280.0 bits), Expect = 1.3e-77, P = 1.3e-77
 Identities = 144/243 (59%), Positives = 190/243 (78%)

Query:     1 MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKD 60
             MRRR G+GAIQ+QKL  EKYKDKGT +QENQLEQ+++ +  FR KLE FA ++K +I+K+
Sbjct:     1 MRRRVGLGAIQQQKLAAEKYKDKGTDLQENQLEQMTKQMEVFRVKLEEFAMKHKEDIRKN 60

Query:    61 AQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLD 120
             +QFR+ FQEMCA+IGVDPLA+ KGFWS+LGMGDFYYEL VQ+VEVCLA N+K GGL+ LD
Sbjct:    61 SQFRKQFQEMCAAIGVDPLATGKGFWSVLGMGDFYYELGVQVVEVCLAANHKTGGLMELD 120

Query:   121 ELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLD 180
             +LR RL+ +RG+S  HQ+IT ED+L AAKKL IFGNGF +  +G+G+Y+VQSIPGELS++
Sbjct:   121 DLRRRLIAARGQSSVHQEITKEDILMAAKKLSIFGNGFVVHKLGKGKYIVQSIPGELSME 180

Query:   181 HSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFP 240
              + +L   ++  +  ++ S L  +L W+  RAQ +LD ++ EG  WID Q+  E  YWFP
Sbjct:   181 ETNILNAASNTEQGCVTQSQLIKDLGWTDYRAQQSLDKVLGEGLCWIDKQAGDEPAYWFP 240

Query:   241 SLF 243
             SLF
Sbjct:   241 SLF 243




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0045450 "bicoid mRNA localization" evidence=IMP
GO:0042981 "regulation of apoptotic process" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0008593 "regulation of Notch signaling pathway" evidence=IEP
GO:0010797 "regulation of multivesicular body size involved in endosome transport" evidence=IDA
ZFIN|ZDB-GENE-041114-117 snf8 "SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DR7 SNF8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6X7 SNF8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1343161 Snf8 "SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q96H20 SNF8 "Vacuolar-sorting protein SNF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1310144 Snf8 "SNF8, ESCRT-II complex subunit, homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTF6 SNF8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZH7 SNF8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00016167 vps-22 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CZ28SNF8_MOUSENo assigned EC number0.540.96060.9457yesN/A
O94663SNF8_SCHPONo assigned EC number0.32090.92510.9325yesN/A
Q5RK19SNF8_RATNo assigned EC number0.540.96060.9457yesN/A
Q96H20SNF8_HUMANNo assigned EC number0.540.96060.9457yesN/A
Q5U3V9SNF8_DANRENo assigned EC number0.54430.95270.9379yesN/A
Q12483SNF8_YEASTNo assigned EC number0.32510.89760.9785yesN/A
Q5RJU0SNF8_XENTRNo assigned EC number0.54910.93700.9260yesN/A
Q54RC4SNF8_DICDINo assigned EC number0.44080.94480.9756yesN/A
Q5M759VP221_ARATHNo assigned EC number0.43440.93300.948yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
pfam04157219 pfam04157, EAP30, EAP30/Vps36 family 9e-76
>gnl|CDD|217934 pfam04157, EAP30, EAP30/Vps36 family Back     alignment and domain information
 Score =  228 bits (584), Expect = 9e-76
 Identities = 100/225 (44%), Positives = 142/225 (63%), Gaps = 7/225 (3%)

Query: 5   AGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFR 64
            G+  I++ + EQ KY D G  +    LE L +    F + LESFA ++K+EIK + +FR
Sbjct: 1   VGIAGIERSREEQRKYNDLGLQLAFEDLEALMKQAKDFVELLESFAKKHKSEIKANPEFR 60

Query: 65  RHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRT 124
             FQ MCAS+GVDPLAS+KG   L G+GDFYYEL+VQIVE+CLAT  +NGG+I L +L  
Sbjct: 61  AQFQSMCASLGVDPLASKKG-SVLGGVGDFYYELAVQIVEICLATLKENGGIISLQDLYA 119

Query: 125 RLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIP-GELSLDHSL 183
              ++RG +   + ++ EDLL A KKL+  G GF ++ IG G  +VQS+P  ELS D + 
Sbjct: 120 LYNRARGGT---ELVSPEDLLKACKKLEKLGLGFKLVKIGSGVLVVQSVPKSELSEDQTK 176

Query: 184 VLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWID 228
           +L ++A +    ++ S L  +L WS  RA+  L+   +EG  W D
Sbjct: 177 IL-ELAEELG-GVTASELAEKLGWSIGRAKEVLEKAEKEGLLWRD 219


This family includes EAP30 as well as the Vps36 protein. Vps36 is involved in Golgi to endosome trafficking. EAP30 is a subunit of the ELL complex. The ELL is an 80-kDa RNA polymerase II transcription factor. ELL interacts with three other proteins to form the complex known as ELL complex. The ELL complex is capable of increasing that catalytic rate of transcription elongation, but is unable to repress initiation of transcription by RNA polymerase II as is the case of ELL. EAP30 is thought to lead to the derepression of ELL's transcriptional inhibitory activity. Length = 219

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 254
KOG3341|consensus249 100.0
PF04157223 EAP30: EAP30/Vps36 family; InterPro: IPR007286 EAP 100.0
KOG2760|consensus432 100.0
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 96.76
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 96.73
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 96.61
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 96.52
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 96.21
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 95.91
PRK00135188 scpB segregation and condensation protein B; Revie 95.31
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 95.13
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 95.05
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 94.7
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 94.66
PRK0933486 30S ribosomal protein S25e; Provisional 94.58
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 94.49
COG3355126 Predicted transcriptional regulator [Transcription 94.31
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 94.06
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 93.99
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 93.98
PHA02943165 hypothetical protein; Provisional 93.95
COG2345 218 Predicted transcriptional regulator [Transcription 93.52
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 93.31
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 93.16
PF0939765 Ftsk_gamma: Ftsk gamma domain; InterPro: IPR018541 93.09
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 92.97
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 92.88
PRK03573144 transcriptional regulator SlyA; Provisional 92.81
TIGR02147271 Fsuc_second hypothetical protein, TIGR02147. This 92.66
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 92.58
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 92.23
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 92.18
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 92.1
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 92.0
PRK11169164 leucine-responsive transcriptional regulator; Prov 91.88
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 91.78
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 91.76
COG2512258 Predicted membrane-associated trancriptional regul 91.74
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 91.32
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 91.06
PRK06266178 transcription initiation factor E subunit alpha; V 91.04
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 90.98
PF0910750 SelB-wing_3: Elongation factor SelB, winged helix 90.96
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 90.93
PF06163127 DUF977: Bacterial protein of unknown function (DUF 90.82
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 90.57
PRK10870176 transcriptional repressor MprA; Provisional 90.53
smart0084363 Ftsk_gamma This domain directs oriented DNA transl 90.51
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 90.5
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 90.4
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 90.37
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 90.22
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 90.21
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 89.98
PRK15466166 carboxysome structural protein EutK; Provisional 89.64
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 89.4
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 89.04
PF04079159 DUF387: Putative transcriptional regulators (Ypuh- 89.04
PRK13509 251 transcriptional repressor UlaR; Provisional 88.9
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 88.84
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 88.83
PF03965115 Penicillinase_R: Penicillinase repressor; InterPro 88.75
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 88.65
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 88.59
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 88.57
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 88.37
PRK13777185 transcriptional regulator Hpr; Provisional 88.08
PHA00738108 putative HTH transcription regulator 88.0
COG1414 246 IclR Transcriptional regulator [Transcription] 87.96
PRK03902142 manganese transport transcriptional regulator; Pro 87.67
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 87.57
PF05331114 DUF742: Protein of unknown function (DUF742); Inte 87.4
PRK11569 274 transcriptional repressor IclR; Provisional 87.25
COG1522154 Lrp Transcriptional regulators [Transcription] 86.83
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 86.7
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 86.6
COG3413215 Predicted DNA binding protein [General function pr 86.55
COG4565224 CitB Response regulator of citrate/malate metaboli 86.35
COG1846126 MarR Transcriptional regulators [Transcription] 85.78
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 85.52
PRK09954 362 putative kinase; Provisional 85.41
PRK00215 205 LexA repressor; Validated 84.98
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 84.93
TIGR02702 203 SufR_cyano iron-sulfur cluster biosynthesis transc 84.89
TIGR00281186 segregation and condensation protein B. Shown to b 84.66
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 84.55
PF14394171 DUF4423: Domain of unknown function (DUF4423) 84.43
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provis 84.15
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 84.09
PRK04424 185 fatty acid biosynthesis transcriptional regulator; 84.01
TIGR00498 199 lexA SOS regulatory protein LexA. LexA acts as a h 84.01
PRK11050152 manganese transport regulator MntR; Provisional 83.72
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 83.67
PF1373055 HTH_36: Helix-turn-helix domain 82.49
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 82.23
KOG1767|consensus110 82.21
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 81.98
PF04558164 tRNA_synt_1c_R1: Glutaminyl-tRNA synthetase, non-s 81.55
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 81.52
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 81.43
PRK10411 240 DNA-binding transcriptional activator FucR; Provis 81.09
PF09743272 DUF2042: Uncharacterized conserved protein (DUF204 80.94
PRK11014141 transcriptional repressor NsrR; Provisional 80.91
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 80.82
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 80.63
PRK102631355 DNA translocase FtsK; Provisional 80.45
PF1232477 HTH_15: Helix-turn-helix domain of alkylmercury ly 80.23
>KOG3341|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-80  Score=533.42  Aligned_cols=246  Identities=53%  Similarity=0.931  Sum_probs=239.6

Q ss_pred             CCcchhhHHHhccHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHcCCCccc
Q psy6552           1 MRRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLA   80 (254)
Q Consensus         1 mrR~vGi~~i~~~~~~~~~~~~~g~~l~~~~~~~L~~ql~~fk~~L~~FA~kh~~~I~~dp~fr~~f~~mc~~lGVdPl~   80 (254)
                      |||++|++||++.+ ...+|++.|+++.++|+.+|..||++|++.|++||+||+.+|++||+||++|+.||++|||||++
T Consensus         1 ~rrrvG~gAi~~~k-~~~ky~~~g~~l~e~Ql~q~~~Ql~~f~~~LeeFA~kH~~ei~knsqFR~~Fq~Mca~IGvDPla   79 (249)
T KOG3341|consen    1 MRRRVGLGAIQKKK-AAKKYKEVGTELAEQQLVQMSKQLEVFQEALEEFARKHKTEIRKNSQFRNQFQEMCASIGVDPLA   79 (249)
T ss_pred             CccchhhhHHhhHH-HHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHHHHHHHHHHcCCCccc
Confidence            89999999999997 89999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccc-ccccchhHHHHHHHHHHHhhhhhhhcCCceeHHHHHHHHHHhcCCCCCCCCCCHHHHHHHHHHhhhhCCCeE
Q psy6552          81 SRKGFWS-LLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFS  159 (254)
Q Consensus        81 s~kg~w~-~lg~gdfy~eLavqive~c~~~r~~nGGii~L~dl~~~~nr~Rg~~~~~~~IS~~Di~rA~~~L~~Lg~g~~  159 (254)
                      ++||||+ ++|+|||||||+|||+|+|+++.+.|||+|++.||..++.+.|+..+  +.||+||++||+++|++||+||.
T Consensus        80 s~kgfw~~~lgvgdFYYelgVqviEvC~at~~~nGGlislqel~~~l~~~R~~~~--e~vt~dD~lrAi~kLk~LG~gFe  157 (249)
T KOG3341|consen   80 SGKGFWAELLGVGDFYYELGVQVIEVCLATKHTNGGLISLQELCNHLLQRRKKDH--EAVTEDDLLRAIDKLKVLGSGFE  157 (249)
T ss_pred             cCcchHHHHhhhHHHHHHHhhHHHHHHHHhhcccCCeeeHHHHHHHHHHHhcccc--hhccHHHHHHHHHHhhccCCCeE
Confidence            9999999 99999999999999999999999999999999999999999998866  89999999999999999999999


Q ss_pred             EEEeCCceEEEEccCCCCChhHHHHHHHhhccCCCcccHHHHHHhcCCCHHHHHHHHHHHHHcCcEEEeCCCCCccccee
Q psy6552         160 IIPIGQGQYLVQSIPGELSLDHSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWF  239 (254)
Q Consensus       160 l~~~~sg~~vv~s~p~els~D~~~il~l~~~~~~g~vt~~~l~~~l~ws~~ra~~~L~~l~~~G~lwvD~q~~~e~~yw~  239 (254)
                      |++++ |+++|||+|.|||+||+.||++|+  ..||||.+.|.++++|+..||+.+|++|+.+|++|+|.|.++|..|||
T Consensus       158 v~~ig-gK~~vrSVP~ELn~Dht~ILela~--~~gyvt~s~l~~~l~We~~Ra~qaLe~lv~egL~WiD~q~g~e~~YW~  234 (249)
T KOG3341|consen  158 VIKIG-GKKLVRSVPTELNMDHTVILELAE--ILGYVTISLLKANLGWERSRAIQALEHLVKEGLAWIDLQAGDEAAYWF  234 (249)
T ss_pred             EEEec-CEEeeecCcchhcccHHHHHHHHH--hcCceeHHHHHHhccchHHHHHHHHHHHHhccceeeeccCCcceeeec
Confidence            99999 999999999999999999999999  569999999999999999999999999999999999999888999999


Q ss_pred             cccccCccccccc
Q psy6552         240 PSLFTECMNAEKE  252 (254)
Q Consensus       240 p~lf~~~~~~~~~  252 (254)
                      |++|...++++..
T Consensus       235 ps~~~~~~~q~~~  247 (249)
T KOG3341|consen  235 PSLFTDQYAQRSL  247 (249)
T ss_pred             hhhhhHHHhhhhh
Confidence            9999999888753



>PF04157 EAP30: EAP30/Vps36 family; InterPro: IPR007286 EAP30 is a subunit of the ELL complex Back     alignment and domain information
>KOG2760|consensus Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK00135 scpB segregation and condensation protein B; Reviewed Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF09397 Ftsk_gamma: Ftsk gamma domain; InterPro: IPR018541 This domain directs oriented DNA translocation and forms a winged helix structure [] Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>TIGR02147 Fsuc_second hypothetical protein, TIGR02147 Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09107 SelB-wing_3: Elongation factor SelB, winged helix ; InterPro: IPR015191 This entry represents a domain with a winged helix-type fold, which consists of a closed 3-helical bundle with a right-handed twist, and a small beta-sheet wing [] Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>smart00843 Ftsk_gamma This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK15466 carboxysome structural protein EutK; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PF04079 DUF387: Putative transcriptional regulators (Ypuh-like); InterPro: IPR005234 This family represents ScpB, which along with ScpA (IPR003768 from INTERPRO) interacts with SMC in vivo forming a complex that is required for chromosome condensation and segregation [, ] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PF05331 DUF742: Protein of unknown function (DUF742); InterPro: IPR007995 This family consists of several uncharacterised Streptomyces proteins as well as one from Mycobacterium tuberculosis Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>TIGR00281 segregation and condensation protein B Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF14394 DUF4423: Domain of unknown function (DUF4423) Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>KOG1767|consensus Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>PF04558 tRNA_synt_1c_R1: Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1 ; InterPro: IPR007639 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF09743 DUF2042: Uncharacterized conserved protein (DUF2042); InterPro: IPR018611 The ubiquitin fold modifier 1 (Ufm1) is the most recently discovered ubiquitin-like modifier whose conjugation (ufmylation) system is conserved in multicellular organisms Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
2zme_A258 Integrated Structural And Functional Model Of The H 1e-76
3cuq_A234 Integrated Structural And Functional Model Of The H 3e-69
1u5t_A233 Structure Of The Escrt-Ii Endosomal Trafficking Com 5e-30
>pdb|2ZME|A Chain A, Integrated Structural And Functional Model Of The Human Escrt-Ii Complex Length = 258 Back     alignment and structure

Iteration: 1

Score = 282 bits (722), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 135/250 (54%), Positives = 187/250 (74%), Gaps = 6/250 (2%) Query: 2 RRRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDA 61 RR G GAI K+KL + KYK++GT + E+QL Q+S+ L+ F+ LE FAS++K EI+K+ Sbjct: 3 RRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNP 62 Query: 62 QFRRHFQEMCASIGVDPLASRKGFWS-LLGMGDFYYELSVQIVEVCLATNYKNGGLILLD 120 +FR FQ+MCA+IGVDPLAS KGFWS +LG+GDFYYEL VQI+EVCLA ++NGGLI L+ Sbjct: 63 EFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLE 122 Query: 121 ELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLD 180 EL +++K RGK QD++ +DL+ A KKLK G GF IIP+G G YL+QS+P EL++D Sbjct: 123 ELHQQVLKGRGKF--AQDVSQDDLIRAIKKLKALGTGFGIIPVG-GTYLIQSVPAELNMD 179 Query: 181 HSLVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFP 240 H++VL Q+A KN +++VS + L W TERA+ L+ +++EG AW+D Q+P E YW P Sbjct: 180 HTVVL-QLAEKN-GYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLP 237 Query: 241 SLFTECMNAE 250 +LFT+ + E Sbjct: 238 ALFTDLYSQE 247
>pdb|3CUQ|A Chain A, Integrated Structural And Functional Model Of The Human Escrt-Ii Complex Length = 234 Back     alignment and structure
>pdb|1U5T|A Chain A, Structure Of The Escrt-Ii Endosomal Trafficking Complex Length = 233 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query254
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 1e-103
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu 1e-100
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 2e-22
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 8e-16
1u5t_B169 Defective in vacuolar protein sorting; VPS36P; ESC 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Length = 233 Back     alignment and structure
 Score =  298 bits (765), Expect = e-103
 Identities = 79/243 (32%), Positives = 123/243 (50%), Gaps = 13/243 (5%)

Query: 3   RRAGVGAIQKQKLEQEKYKDKGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQ 62
           ++ G+ A  + K    KY D   +I E Q  +L   L  F+++L  FA ++ +E++   +
Sbjct: 2   KQFGLAAFDELK--DGKYNDVNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPE 59

Query: 63  FRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDEL 122
           FR  F  MC+SIG+DPL+       L  + DFYYE+ ++++E+C  T   NGG+I   EL
Sbjct: 60  FRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQEL 119

Query: 123 RTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHS 182
                +         ++  +DL  +   LK     F I  I  G+  ++S+P EL+ D +
Sbjct: 120 EKVHFRKL-------NVGLDDLEKSIDMLKSLE-CFEIFQIR-GKKFLRSVPNELTSDQT 170

Query: 183 LVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSL 242
            +L+        + S+S+L   L W   R++ ALD MV  G  WID Q   E LYW PS 
Sbjct: 171 KILE--ICSILGYSSISLLKANLGWEAVRSKSALDEMVANGLLWIDYQGGAEALYWDPSW 228

Query: 243 FTE 245
            T 
Sbjct: 229 ITR 231


>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A Length = 234 Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Length = 218 Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566 Back     alignment and structure
>1u5t_B Defective in vacuolar protein sorting; VPS36P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 169 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu 100.0
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 100.0
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 100.0
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 100.0
1u5t_B169 Defective in vacuolar protein sorting; VPS36P; ESC 100.0
2jt1_A77 PEFI protein; solution structure, winged helix-tur 96.82
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 96.57
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 96.46
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 96.09
3i71_A68 Ethanolamine utilization protein EUTK; helix-turn- 96.07
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 96.0
1p6r_A82 Penicillinase repressor; transcription regulation, 95.84
1qbj_A81 Protein (double-stranded RNA specific adenosine D 95.82
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 95.64
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 95.28
2kko_A108 Possible transcriptional regulatory protein (possi 95.25
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 95.25
3jth_A98 Transcription activator HLYU; transcription factor 95.22
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 94.85
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 94.74
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 94.74
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 94.71
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 94.69
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 94.66
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 94.64
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 94.58
1ku9_A152 Hypothetical protein MJ223; putative transcription 94.58
3oop_A143 LIN2960 protein; protein structure initiative, PSI 94.52
3r0a_A123 Putative transcriptional regulator; structural gen 94.31
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 94.3
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 94.24
3bdd_A142 Regulatory protein MARR; putative multiple antibio 94.15
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 94.14
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 94.07
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 94.06
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 94.03
2pex_A153 Transcriptional regulator OHRR; transcription regu 94.02
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 94.0
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 93.98
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 93.93
1s3j_A155 YUSO protein; structural genomics, MARR transcript 93.93
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 93.9
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 93.89
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 93.86
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 93.85
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 93.84
1sfx_A109 Conserved hypothetical protein AF2008; structural 93.79
2gxg_A146 146AA long hypothetical transcriptional regulator; 93.77
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 93.75
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 93.71
3ech_A142 MEXR, multidrug resistance operon repressor; winge 93.69
3cjn_A162 Transcriptional regulator, MARR family; silicibact 93.67
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 93.63
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 93.6
3s2w_A159 Transcriptional regulator, MARR family; structural 93.58
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 93.54
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 93.5
2nnn_A140 Probable transcriptional regulator; structural gen 93.46
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 93.42
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 93.4
2nyx_A168 Probable transcriptional regulatory protein, RV14; 93.38
2hr3_A147 Probable transcriptional regulator; MCSG, structur 93.3
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 93.25
1z91_A147 Organic hydroperoxide resistance transcriptional; 93.23
2frh_A127 SARA, staphylococcal accessory regulator A; winged 93.23
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 93.1
3bja_A139 Transcriptional regulator, MARR family, putative; 93.04
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 92.98
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 92.95
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 92.82
3e6m_A161 MARR family transcriptional regulator; APC88769, s 92.76
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 92.76
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 92.76
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 92.75
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 92.74
1t6s_A162 Conserved hypothetical protein; A winged helix-tur 92.74
4aik_A151 Transcriptional regulator SLYA; transcription, tra 92.71
2oqg_A114 Possible transcriptional regulator, ARSR family P; 92.69
3nqo_A189 MARR-family transcriptional regulator; structural 92.58
3f6o_A118 Probable transcriptional regulator, ARSR family pr 92.51
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 92.45
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 92.43
2z99_A219 Putative uncharacterized protein; winged helix dom 92.42
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 92.42
2w25_A150 Probable transcriptional regulatory protein; trans 92.18
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 92.14
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 92.03
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 92.02
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 91.96
3boq_A160 Transcriptional regulator, MARR family; MARR famil 91.92
1okr_A123 MECI, methicillin resistance regulatory protein ME 91.91
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 91.85
2eth_A154 Transcriptional regulator, putative, MAR family; M 91.74
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 91.53
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 91.5
3f3x_A144 Transcriptional regulator, MARR family, putative; 91.49
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 91.31
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 91.06
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 91.05
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 91.03
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 91.0
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 90.99
2fxa_A207 Protease production regulatory protein HPR; protea 90.9
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 90.75
1lva_A258 Selenocysteine-specific elongation factor; winged- 90.62
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 90.59
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 90.54
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 90.25
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 90.16
2vxz_A165 Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py 89.99
3f6v_A151 Possible transcriptional regulator, ARSR family pr 89.94
2wte_A244 CSA3; antiviral protein, viral resistance, winged 89.82
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 89.79
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 89.35
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 88.75
2ve8_A73 FTSK, DNA translocase FTSK; nucleotide-binding, ch 88.49
1y0u_A96 Arsenical resistance operon repressor, putative; s 88.32
2pg4_A95 Uncharacterized protein; structural genomics, join 88.27
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 88.14
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 87.92
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 87.91
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 87.5
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 87.39
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 87.26
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 86.9
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 86.88
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 86.32
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 86.11
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 85.62
1mkm_A 249 ICLR transcriptional regulator; structural genomic 85.41
2h09_A155 Transcriptional regulator MNTR; transcription regu 85.18
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 85.06
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 84.93
2vn2_A128 DNAD, chromosome replication initiation protein; D 84.63
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 84.41
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 84.22
3iz6_V108 40S ribosomal protein S25 (S25E); eukaryotic ribos 84.2
1hsj_A487 Fusion protein consisting of staphylococcus access 83.94
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 83.88
3nw0_A238 Non-structural maintenance of chromosomes element 83.65
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 82.93
1yyv_A131 Putative transcriptional regulator; reductive meth 82.87
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 82.64
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 82.6
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 82.32
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 82.22
2fe3_A145 Peroxide operon regulator; oxidative stress regula 82.11
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 81.94
4fx0_A148 Probable transcriptional repressor protein; helix- 80.94
2g7u_A 257 Transcriptional regulator; ICLR family, structural 80.41
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 80.15
>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A Back     alignment and structure
Probab=100.00  E-value=1.1e-80  Score=547.67  Aligned_cols=221  Identities=54%  Similarity=1.002  Sum_probs=206.2

Q ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHcCCCcccCCCcccc-ccccchhHHHHHHHH
Q psy6552          24 GTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWS-LLGMGDFYYELSVQI  102 (254)
Q Consensus        24 g~~l~~~~~~~L~~ql~~fk~~L~~FA~kh~~~I~~dp~fr~~f~~mc~~lGVdPl~s~kg~w~-~lg~gdfy~eLavqi  102 (254)
                      |+++.++++++|++||++||++|++||+||+++|++||+||++|++||++||||||+++||||+ ++|+|||||||||||
T Consensus         1 g~~l~~~~~~~~~~Ql~~F~~~L~~FA~kH~~eI~~dp~fR~~F~~mc~siGVDPlas~kg~ws~~lG~gdfy~eLavqI   80 (234)
T 3cuq_A            1 GTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQI   80 (234)
T ss_dssp             ---------CTTHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCCTTSCTTSHHHHHHCHHHHHHHHHHHH
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCHHHHHHHHHHHHHcCCCcccCCcchhhhhcCcchHHHHHHHHH
Confidence            4568888999999999999999999999999999999999999999999999999999999999 999999999999999


Q ss_pred             HHHhhhhhhhcCCceeHHHHHHHHHHhcCCCCCCCCCCHHHHHHHHHHhhhhCCCeEEEEeCCceEEEEccCCCCChhHH
Q psy6552         103 VEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGELSLDHS  182 (254)
Q Consensus       103 ve~c~~~r~~nGGii~L~dl~~~~nr~Rg~~~~~~~IS~~Di~rA~~~L~~Lg~g~~l~~~~sg~~vv~s~p~els~D~~  182 (254)
                      +|+|.+||++|||||+|+||+|++||+||..+  ++|||+||+|||++|++||+||+|++|+ |++||||+|.|+|+||+
T Consensus        81 vEvC~~tr~~nGGli~L~el~~~~~r~Rg~~~--~~IS~dDi~rAik~L~~LG~g~~v~~~~-g~~~VqSvp~el~~D~~  157 (234)
T 3cuq_A           81 IEVCLALKHRNGGLITLEELHQQVLKGRGKFA--QDVSQDDLIRAIKKLKALGTGFGIIPVG-GTYLIQSVPAELNMDHT  157 (234)
T ss_dssp             HHHHHHHHHHHSSEEEHHHHHHHHHHTTTTCC--SSCCHHHHHHHHHHHGGGBTTCEEEEET-TEEEEECSCCCCCHHHH
T ss_pred             HHHHHHHHHhcCCeeEHHHHHHHHHHhcCCcc--CccCHHHHHHHHHHHHhcCCCeEEEEEC-CEEEEEeCCCccchHHH
Confidence            99999999999999999999999999999866  7999999999999999999999999999 99999999999999999


Q ss_pred             HHHHHhhccCCCcccHHHHHHhcCCCHHHHHHHHHHHHHcCcEEEeCCCCCcccceecccccCcccc
Q psy6552         183 LVLQQVASKNEAHISVSVLNNELNWSTERAQHALDFMVQEGYAWIDTQSPQEHLYWFPSLFTECMNA  249 (254)
Q Consensus       183 ~il~l~~~~~~g~vt~~~l~~~l~ws~~ra~~~L~~l~~~G~lwvD~q~~~e~~yw~p~lf~~~~~~  249 (254)
                      .||++|+  ..||||+++|++++||+++||+++|++|+++|++|||+|.++|+.|||||+|.+..++
T Consensus       158 ~vLela~--~~g~vt~~~L~~~l~W~~~Ra~~~L~~l~~~GllwvD~q~~ge~~Yw~P~lf~~~~~~  222 (234)
T 3cuq_A          158 VVLQLAE--KNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQ  222 (234)
T ss_dssp             HHHHHHT--TTSEECHHHHHHHHTCCHHHHHHHHHHHHHHTSCEEESSSSSSCEEECTTSSCCCCCC
T ss_pred             HHHHHHH--hcCcCcHHHHHHHhCCCHHHHHHHHHHHHhCCCEEEeCCCCCcceeecchhhcccccc
Confidence            9999999  6799999999999999999999999999999999999997678999999999976654



>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>1u5t_B Defective in vacuolar protein sorting; VPS36P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>1t6s_A Conserved hypothetical protein; A winged helix-turn-helix, structural genomics, BSGC structu by NIH, protein structure initiative, PSI; 1.95A {Chlorobium tepidum tls} SCOP: a.4.5.60 a.4.5.60 Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2z99_A Putative uncharacterized protein; winged helix domain, cell cycle, cell division, chromosome partition, cytoplasm; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1lva_A Selenocysteine-specific elongation factor; winged-helix, translation; 2.12A {Moorella thermoacetica} SCOP: a.4.5.35 a.4.5.35 a.4.5.35 a.4.5.35 PDB: 2uwm_A 2ply_A 1wsu_A Back     alignment and structure
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Back     alignment and structure
>2vxz_A Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>2ve8_A FTSK, DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, winged helix, bacterial cell division; HET: DNA; 1.4A {Pseudomonas aeruginosa} SCOP: a.4.5.67 PDB: 2ve9_A* 2j5o_A* Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>3iz6_V 40S ribosomal protein S25 (S25E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 254
d1u5ta1145 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 5e-64
d1u5ta268 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 2e-23
>d1u5ta1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Vacuolar sorting protein domain
domain: Vacuolar sorting protein SNF8
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  194 bits (495), Expect = 5e-64
 Identities = 47/153 (30%), Positives = 77/153 (50%), Gaps = 9/153 (5%)

Query: 24  GTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRK 83
             +I E Q  +L   L  F+++L  FA ++ +E++   +FR  F  MC+SIG+DPL+   
Sbjct: 2   NKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFD 61

Query: 84  GFWSLLGMGDFYYELSVQIVEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNED 143
               L  + DFYYE+ ++++E+C  T   NGG+I   EL     +          +  +D
Sbjct: 62  RDKHLFTVNDFYYEVCLKVIEICRQTKDMNGGVISFQELEKVHFRKLN-------VGLDD 114

Query: 144 LLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGE 176
           L  +   LK     F I  I  G+  ++S+P E
Sbjct: 115 LEKSIDMLKSLE-CFEIFQIR-GKKFLRSVPNE 145


>d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query254
d1u5ta1145 Vacuolar sorting protein SNF8 {Baker's yeast (Sacc 100.0
d1u5tb194 Vacuolar protein sorting-associated protein VPS36 99.88
d1u5ta268 Vacuolar sorting protein SNF8 {Baker's yeast (Sacc 99.88
d1u5tb275 Vacuolar protein sorting-associated protein VPS36 96.42
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 95.74
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 95.71
d1mkma175 Transcriptional regulator IclR, N-terminal domain 95.25
d2htja173 P fimbrial regulatory protein PapI {Escherichia co 95.01
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 95.0
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 94.88
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 94.67
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 94.6
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 94.58
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.49
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 94.33
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 94.31
d1okra_120 Methicillin resistance regulatory protein MecI {St 94.28
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 94.25
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 94.23
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 93.89
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 93.76
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 93.69
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 93.58
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 93.55
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.53
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 93.46
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 93.4
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 93.2
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 93.02
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 92.88
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 92.63
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 92.61
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 92.48
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 92.31
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 92.09
d1p6ra_82 Penicillinase repressor BlaI {Bacillus licheniform 92.04
d2ve8a167 DNA translocase FtsK {Pseudomonas aeruginosa [TaxI 91.84
d1z91a1137 Organic hydroperoxide resistance transcriptional r 91.84
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 91.83
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 91.63
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 91.48
d2j5pa169 DNA translocase FtsK {Escherichia coli [TaxId: 562 91.37
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 91.22
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 90.89
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 90.88
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 90.53
d2g9wa1122 Hypothetical protein Rv1846c {Mycobacterium tuberc 89.49
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 89.48
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 89.36
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 89.34
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 89.2
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 89.04
d1xmka173 Z-alpha domain of dsRNA-specific adenosine deamina 87.59
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 87.3
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 87.1
d1s6la160 Alkylmercury lyase MerB {Escherichia coli [TaxId: 86.58
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 86.4
d2p4wa1 194 Transcriptional regulatory protein PF1790 {Pyrococ 86.24
d1t6sa185 Segregation and condensation protein B, ScpB {Chlo 86.03
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 85.37
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 84.68
d2dk5a178 DNA-directed RNA polymerase III subunit RPC6, RPO3 84.35
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 83.73
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 83.68
d1hw1a174 Fatty acid responsive transcription factor FadR, N 83.14
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 80.93
>d1u5ta1 a.4.5.54 (A:20-164) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Vacuolar sorting protein domain
domain: Vacuolar sorting protein SNF8
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=1.2e-54  Score=353.18  Aligned_cols=145  Identities=32%  Similarity=0.589  Sum_probs=137.3

Q ss_pred             cccchHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCHHHHHHHHHHHHHcCCCcccCCCccccccccchhHHHHHHHH
Q psy6552          23 KGTSIQENQLEQLSQHLNTFRDKLESFASEYKNEIKKDAQFRRHFQEMCASIGVDPLASRKGFWSLLGMGDFYYELSVQI  102 (254)
Q Consensus        23 ~g~~l~~~~~~~L~~ql~~fk~~L~~FA~kh~~~I~~dp~fr~~f~~mc~~lGVdPl~s~kg~w~~lg~gdfy~eLavqi  102 (254)
                      +|++|.+.|+++|+.||++||+.|++||++|+++|++||+||++|++||++||||||++++++|+++|+|||||||||||
T Consensus         1 l~~~l~e~q~~ql~~QL~vF~~~L~~FA~kH~~eI~~np~FR~~F~~MC~~iGVDPLas~~~~~~~lg~gDFYyEL~VqI   80 (145)
T d1u5ta1           1 VNKTILEKQSVELRDQLMVFQERLVEFAKKHNSELQASPEFRSKFMHMCSSIGIDPLSLFDRDKHLFTVNDFYYEVCLKV   80 (145)
T ss_dssp             CCSHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTTTTTCHHHHHHHHHHHHHHTCCHHHHTTSSGGGTTHHHHHHHHHHHH
T ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHhhcCHHHHHHHHHHHHHhCCChhhcCCCccccccccchHHHHHHHH
Confidence            36789999999999999999999999999999999999999999999999999999999999777999999999999999


Q ss_pred             HHHhhhhhhhcCCceeHHHHHHHHHHhcCCCCCCCCCCHHHHHHHHHHhhhhCCCeEEEEeCCceEEEEccCCC
Q psy6552         103 VEVCLATNYKNGGLILLDELRTRLVKSRGKSLQHQDITNEDLLAAAKKLKIFGNGFSIIPIGQGQYLVQSIPGE  176 (254)
Q Consensus       103 ve~c~~~r~~nGGii~L~dl~~~~nr~Rg~~~~~~~IS~~Di~rA~~~L~~Lg~g~~l~~~~sg~~vv~s~p~e  176 (254)
                      +|+|++||+.|||||+|.||...+.|.       ..||.+||+||+++|++|| ||.+++++ |+++|+|+|.|
T Consensus        81 vEvC~~tr~~NGGli~l~el~~~~~~~-------~~is~dDi~rAi~~L~~Lg-G~~v~~ig-gk~~v~SVP~E  145 (145)
T d1u5ta1          81 IEICRQTKDMNGGVISFQELEKVHFRK-------LNVGLDDLEKSIDMLKSLE-CFEIFQIR-GKKFLRSVPNE  145 (145)
T ss_dssp             HHHHHHHTTTSSSCEEHHHHHHTTTTT-------TTCCHHHHHHHHHHHTTTC-CCCEEEET-TEEEECCSSSC
T ss_pred             HHHHHHhhhcCCCEeEHHHHHHHHHhh-------cCCCHHHHHHHHHhhcccC-CcEEEEEC-CEEEEEeCCCC
Confidence            999999999999999999998877765       3689999999999999996 99999999 99999999975



>d1u5tb1 a.4.5.54 (B:396-489) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u5tb2 a.4.5.54 (B:490-564) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2ve8a1 a.4.5.67 (A:745-811) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2j5pa1 a.4.5.67 (A:1261-1329) DNA translocase FtsK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t6sa1 a.4.5.60 (A:1-85) Segregation and condensation protein B, ScpB {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure