Psyllid ID: psy6564

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MLATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPVVQTPDSVDANAISSKLSSDGVLSIQAPKKAVEGGAGERAIPVVQTTIDQRP
ccccccccccEEEEEEcccccccccEEEEEccEEEEEEEEEEEEccccEEEEEEEEEccccccccccccEEEEccccEEEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccEEEccccccccccc
ccEEEEccccEEEEEEcccccccEEEEEEEccEEEEEEcccccccccccEEHHHEEEEEccccccHHHEEEEcccccEEEEEccccccccccccEEEEEEEcccccHccccccccccccccccccccccccccccccEEEEEEEEccccc
MLATTAAEIEgtvnldvqqfkpeeidvkVVDKYIVVHakheersdqhgfisreftrrykipdsvdanaissklssdgvlsiqapkkaveagageraipvvqtpdsvdanaissklssdgvlsiqapkkaveggageraipvvqttidqrp
mlattaaeiegtvnldvqqfkpeeidvkvVDKYIVVhakheersdqhgfisreftrrykipDSVDANAISsklssdgvlsIQAPKKAVeagageraipvvqtpdsVDANAISsklssdgvlsiqapkkaveggageraipvvqttidqrp
MLATTAAEIEGTVNLDVQQFKPEEidvkvvdkyivvHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPVVQTPDSVDANAISSKLSSDGVLSIQAPKKAVEGGAGERAIPVVQTTIDQRP
**********GTVNLDVQQFKPEEIDVKVVDKYIVVHAKH*******GFISREFTRRYKI******************************************************************************************
*******EIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEE*****GFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQA*******************************************************************
MLATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPVVQTPDSVDANAISSKLSSDGVLSIQ**********GERAIPVVQTTIDQRP
*LATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPVVQTPD*******************************ERAIPVVQTTIDQ**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPVVQTPDSVDANAISSKLSSDGVLSIQAPKKAVEGGAGERAIPVVQTTIDQRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
P82147187 Protein lethal(2)essentia yes N/A 0.653 0.524 0.515 1e-24
P02510175 Alpha-crystallin B chain yes N/A 0.586 0.502 0.577 9e-24
P23928175 Alpha-crystallin B chain yes N/A 0.586 0.502 0.566 2e-23
Q9EPF3175 Alpha-crystallin B chain N/A N/A 0.586 0.502 0.566 2e-23
Q5ENY9175 Alpha-crystallin B chain N/A N/A 0.586 0.502 0.566 3e-23
P41316175 Alpha-crystallin B chain yes N/A 0.586 0.502 0.566 4e-23
P05811175 Alpha-crystallin B chain N/A N/A 0.586 0.502 0.555 4e-23
P15990196 Alpha-crystallin A chain N/A N/A 0.593 0.454 0.516 4e-23
Q5R9K0175 Alpha-crystallin B chain yes N/A 0.586 0.502 0.566 5e-23
P02511175 Alpha-crystallin B chain yes N/A 0.586 0.502 0.566 5e-23
>sp|P82147|L2EFL_DROME Protein lethal(2)essential for life OS=Drosophila melanogaster GN=l(2)efl PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 73/99 (73%), Gaps = 1/99 (1%)

Query: 13  VNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSK 72
           V LDVQQF P EI VKV DK+++V  KHEE+ D+HG++SR+F+RRY++P  V+ + ++S 
Sbjct: 81  VILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSS 140

Query: 73  LSSDGVLSIQAPKKAVEAGAGERAIPVVQT-PDSVDANA 110
           LSSDG+L+I+AP KA+     ER + + QT P S + NA
Sbjct: 141 LSSDGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDNA 179
Vital role in embryonic development.
Drosophila melanogaster (taxid: 7227)
>sp|P02510|CRYAB_BOVIN Alpha-crystallin B chain OS=Bos taurus GN=CRYAB PE=1 SV=2 Back     alignment and function description
>sp|P23928|CRYAB_RAT Alpha-crystallin B chain OS=Rattus norvegicus GN=Cryab PE=1 SV=1 Back     alignment and function description
>sp|Q9EPF3|CRYAB_SPAJD Alpha-crystallin B chain OS=Spalax judaei GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|Q5ENY9|CRYAB_SHEEP Alpha-crystallin B chain OS=Ovis aries GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|P41316|CRYAB_RABIT Alpha-crystallin B chain OS=Oryctolagus cuniculus GN=CRYAB PE=1 SV=1 Back     alignment and function description
>sp|P05811|CRYAB_MESAU Alpha-crystallin B chain OS=Mesocricetus auratus GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|P15990|CRYAA_SPAEH Alpha-crystallin A chain OS=Spalax ehrenbergi GN=CRYAA PE=3 SV=1 Back     alignment and function description
>sp|Q5R9K0|CRYAB_PONAB Alpha-crystallin B chain OS=Pongo abelii GN=CRYAB PE=2 SV=1 Back     alignment and function description
>sp|P02511|CRYAB_HUMAN Alpha-crystallin B chain OS=Homo sapiens GN=CRYAB PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
121543671193 putative small heat shock protein [Macon 0.6 0.466 0.688 4e-29
85816370182 heat shock protein 20.7 [Locusta migrato 0.686 0.565 0.592 9e-28
242005718205 protein lethal, putative [Pediculus huma 0.653 0.478 0.581 5e-27
242005722211 protein lethal, putative [Pediculus huma 0.653 0.464 0.581 5e-27
359843250182 heat shock protein 20.7 [Schistocerca gr 0.686 0.565 0.583 8e-27
301070150176 small heat shock protein [Spodoptera lit 0.6 0.511 0.644 1e-26
148743498185 heat shock protein hsp20.8 [Sesamia nona 0.6 0.486 0.611 1e-26
91718820187 heat shock protein Hsp20 [Liriomyza huid 0.586 0.470 0.625 4e-26
389611265178 lethal(2)essential for life protein, l2e 0.6 0.505 0.611 9e-26
70905468175 19.9 kDa small heat shock protein [Chori 0.6 0.514 0.611 1e-25
>gi|121543671|gb|ABM55532.1| putative small heat shock protein [Maconellicoccus hirsutus] Back     alignment and taxonomy information
 Score =  132 bits (332), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 62/90 (68%), Positives = 76/90 (84%)

Query: 13  VNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSK 72
           VNLDVQQFKPEE++VK+VD Y+VV  KHEER D+HG+ISR+FTRRYK+P +V+  AI+S 
Sbjct: 82  VNLDVQQFKPEEVNVKIVDDYLVVEGKHEERQDKHGYISRQFTRRYKLPQNVNLEAIASN 141

Query: 73  LSSDGVLSIQAPKKAVEAGAGERAIPVVQT 102
           LSSDG+LSI APKKA +  A E +IPVVQT
Sbjct: 142 LSSDGILSITAPKKAEKNEAKEISIPVVQT 171

Source: Maconellicoccus hirsutus

Species: Maconellicoccus hirsutus

Genus: Maconellicoccus

Family: Pseudococcidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|85816370|gb|ABC84494.1| heat shock protein 20.7 [Locusta migratoria] Back     alignment and taxonomy information
>gi|242005718|ref|XP_002423709.1| protein lethal, putative [Pediculus humanus corporis] gi|212506894|gb|EEB10971.1| protein lethal, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242005722|ref|XP_002423711.1| protein lethal, putative [Pediculus humanus corporis] gi|212506896|gb|EEB10973.1| protein lethal, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|359843250|gb|AEV89760.1| heat shock protein 20.7 [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|301070150|gb|ADK55521.1| small heat shock protein [Spodoptera litura] Back     alignment and taxonomy information
>gi|148743498|gb|ABC68342.2| heat shock protein hsp20.8 [Sesamia nonagrioides] Back     alignment and taxonomy information
>gi|91718820|gb|ABE57137.1| heat shock protein Hsp20 [Liriomyza huidobrensis] Back     alignment and taxonomy information
>gi|389611265|dbj|BAM19244.1| lethal(2)essential for life protein, l2efl [Papilio polytes] Back     alignment and taxonomy information
>gi|70905468|gb|AAZ14791.1| 19.9 kDa small heat shock protein [Choristoneura fumiferana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
UNIPROTKB|P02510175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.522 9.2e-20
UNIPROTKB|E2RNB6175 CRYAB "Uncharacterized protein 0.586 0.502 0.522 9.2e-20
UNIPROTKB|P05811175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.511 2.5e-19
UNIPROTKB|Q9EPF3175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.511 2.5e-19
RGD|2414175 Cryab "crystallin, alpha B" [R 0.586 0.502 0.511 2.5e-19
UNIPROTKB|E9PNH7106 CRYAB "Alpha-crystallin B chai 0.586 0.830 0.522 4e-19
UNIPROTKB|E9PR44174 CRYAB "Alpha-crystallin B chai 0.586 0.505 0.522 4e-19
UNIPROTKB|P02511175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.522 4e-19
UNIPROTKB|P41316175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.511 4e-19
UNIPROTKB|Q5ENY9175 CRYAB "Alpha-crystallin B chai 0.586 0.502 0.511 4e-19
UNIPROTKB|P02510 CRYAB "Alpha-crystallin B chain" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 9.2e-20, P = 9.2e-20
 Identities = 47/90 (52%), Positives = 59/90 (65%)

Query:    12 TVNLDVQQFKPEEXXXXXXXXXXXXHAKHEERSDQHGFISREFTRRYKIPDSVDANAISS 71
             +VNLDV+ F PEE            H KHEER D+HGFISREF R+Y+IP  VD  AI+S
Sbjct:    76 SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLAITS 135

Query:    72 KLSSDGVLSIQAPKKAVEAGAGERAIPVVQ 101
              LSSDGVL++  P+K  +A   ER IP+ +
Sbjct:   136 SLSSDGVLTVNGPRK--QASGPERTIPITR 163
GO:0032387 "negative regulation of intracellular transport" evidence=ISS
GO:0043066 "negative regulation of apoptotic process" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0042803 "protein homodimerization activity" evidence=ISS
GO:0060561 "apoptotic process involved in morphogenesis" evidence=IEA
GO:0051260 "protein homooligomerization" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0043154 "negative regulation of cysteine-type endopeptidase activity involved in apoptotic process" evidence=IEA
GO:0042542 "response to hydrogen peroxide" evidence=IEA
GO:0030018 "Z disc" evidence=IEA
GO:0010629 "negative regulation of gene expression" evidence=IEA
GO:0007517 "muscle organ development" evidence=IEA
GO:0007021 "tubulin complex assembly" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0002088 "lens development in camera-type eye" evidence=IEA
GO:0001666 "response to hypoxia" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005212 "structural constituent of eye lens" evidence=IEA
UNIPROTKB|E2RNB6 CRYAB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P05811 CRYAB "Alpha-crystallin B chain" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
UNIPROTKB|Q9EPF3 CRYAB "Alpha-crystallin B chain" [Nannospalax judaei (taxid:134510)] Back     alignment and assigned GO terms
RGD|2414 Cryab "crystallin, alpha B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PNH7 CRYAB "Alpha-crystallin B chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PR44 CRYAB "Alpha-crystallin B chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P02511 CRYAB "Alpha-crystallin B chain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P41316 CRYAB "Alpha-crystallin B chain" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ENY9 CRYAB "Alpha-crystallin B chain" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R9K0CRYAB_PONABNo assigned EC number0.56660.58660.5028yesN/A
Q05713CRYAB_CHICKNo assigned EC number0.53330.58660.5057yesN/A
Q7M2W6CRYAB_PIGNo assigned EC number0.55550.58660.5028yesN/A
P02510CRYAB_BOVINNo assigned EC number0.57770.58660.5028yesN/A
P02511CRYAB_HUMANNo assigned EC number0.56660.58660.5028yesN/A
P41316CRYAB_RABITNo assigned EC number0.56660.58660.5028yesN/A
P82147L2EFL_DROMENo assigned EC number0.51510.65330.5240yesN/A
P23927CRYAB_MOUSENo assigned EC number0.56660.58660.5028yesN/A
P23928CRYAB_RATNo assigned EC number0.56660.58660.5028yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 5e-38
cd0647883 cd06478, ACD_HspB4-5-6, Alpha-crystallin domain fo 5e-34
cd0649884 cd06498, ACD_alphaB-crystallin_HspB5, Alpha-crysta 3e-28
cd0649786 cd06497, ACD_alphaA-crystallin_HspB4, Alpha-crysta 6e-28
cd0647586 cd06475, ACD_HspB1_like, Alpha crystallin domain ( 6e-26
cd0647683 cd06476, ACD_HspB2_like, Alpha crystallin domain ( 4e-23
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 1e-22
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 3e-19
cd0647783 cd06477, ACD_HspB3_Like, Alpha crystallin domain ( 4e-19
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 2e-16
cd0648091 cd06480, ACD_HspB8_like, Alpha-crystallin domain ( 3e-15
cd0648187 cd06481, ACD_HspB9_like, Alpha crystallin domain ( 3e-10
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 7e-09
cd0647981 cd06479, ACD_HspB7_like, Alpha crystallin domain ( 9e-09
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 3e-07
cd0648287 cd06482, ACD_HspB10, Alpha crystallin domain (ACD) 3e-05
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information 
 Score =  124 bits (313), Expect = 5e-38
 Identities = 46/73 (63%), Positives = 61/73 (83%)

Query: 13 VNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSK 72
          V LDV+ FKPEE+ VKV D  +VV  KHEER D+HG++SREFTRRY++P+ VD ++++S 
Sbjct: 11 VTLDVKGFKPEELKVKVSDNKLVVEGKHEEREDEHGYVSREFTRRYQLPEGVDPDSVTSS 70

Query: 73 LSSDGVLSIQAPK 85
          LSSDGVL+I+APK
Sbjct: 71 LSSDGVLTIEAPK 83

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. Length = 83
>gnl|CDD|107233 cd06478, ACD_HspB4-5-6, Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>gnl|CDD|107246 cd06498, ACD_alphaB-crystallin_HspB5, Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>gnl|CDD|107245 cd06497, ACD_alphaA-crystallin_HspB4, Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>gnl|CDD|107230 cd06475, ACD_HspB1_like, Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>gnl|CDD|107231 cd06476, ACD_HspB2_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|107232 cd06477, ACD_HspB3_Like, Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|107235 cd06480, ACD_HspB8_like, Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>gnl|CDD|107236 cd06481, ACD_HspB9_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107234 cd06479, ACD_HspB7_like, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107237 cd06482, ACD_HspB10, Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.93
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.92
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.92
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.91
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.91
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.91
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.9
KOG3591|consensus173 99.89
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.88
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.88
PRK10743137 heat shock protein IbpA; Provisional 99.88
PRK11597142 heat shock chaperone IbpB; Provisional 99.88
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.88
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.87
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.87
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.86
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.86
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.84
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.82
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.8
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.55
KOG0710|consensus196 99.4
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.23
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.19
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.17
PRK10743137 heat shock protein IbpA; Provisional 99.16
PRK11597142 heat shock chaperone IbpB; Provisional 99.12
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.11
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.09
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.08
KOG3591|consensus173 99.04
COG0071146 IbpA Molecular chaperone (small heat shock protein 98.98
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 98.94
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 98.93
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 98.93
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 98.93
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 98.89
cd0646384 p23_like Proteins containing this p23_like domain 98.89
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 98.88
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 98.86
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 98.85
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 98.82
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 98.79
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.5
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 98.48
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 98.41
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 97.92
KOG0710|consensus196 97.87
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.82
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.64
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 97.45
cd0029880 ACD_sHsps_p23-like This domain family includes the 97.42
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.36
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.24
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 97.21
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.11
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.07
cd0646384 p23_like Proteins containing this p23_like domain 96.36
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.19
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 95.97
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 94.81
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 93.51
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 93.42
PF14913194 DPCD: DPCD protein family 93.37
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 93.29
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 92.24
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 91.1
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 90.8
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 89.08
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 88.99
KOG1309|consensus196 88.72
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 88.02
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 86.25
cd0646892 p23_CacyBP p23_like domain found in proteins simil 82.85
PF13349166 DUF4097: Domain of unknown function (DUF4097) 80.03
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information 
Probab=99.93  E-value=3.3e-25  Score=150.79  Aligned_cols=83  Identities=48%  Similarity=0.886  Sum_probs=77.6

Q ss_pred             eEEEcCCeEEEEEEeCCCCCCCeEEEEECCEEEEEEEEeeecCCCceEEEEEEEEEECCCCCCcCCcEEEecCCCEEEEE
Q psy6564           3 ATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLSIQ   82 (150)
Q Consensus         3 ~i~e~~~~~~v~~dlpG~~~edI~V~v~~~~L~I~g~~~~~~~~~~~~~r~f~r~~~LP~~vd~~~i~a~~~~dGvL~I~   82 (150)
                      .+.++++.|.|.++||||+++||+|++.++.|+|+|++....++.+|.+++|+|+|.||.+||+++|+|+|+.||+|+|+
T Consensus         4 ~v~e~~~~~~v~~dlpG~~~edi~V~v~~~~L~I~g~~~~~~~~~~~~~~ef~R~~~LP~~Vd~~~i~A~~~~dGvL~I~   83 (86)
T cd06497           4 EVRSDRDKFTIYLDVKHFSPEDLTVKVLDDYVEIHGKHSERQDDHGYISREFHRRYRLPSNVDQSAITCSLSADGMLTFS   83 (86)
T ss_pred             eEEEcCCEEEEEEECCCCCHHHeEEEEECCEEEEEEEEcceeCCCCEEEEEEEEEEECCCCCChHHeEEEeCCCCEEEEE
Confidence            57899999999999999999999999999999999998765566679889999999999999999999999679999999


Q ss_pred             eec
Q psy6564          83 APK   85 (150)
Q Consensus        83 ~pk   85 (150)
                      +||
T Consensus        84 ~PK   86 (86)
T cd06497          84 GPK   86 (86)
T ss_pred             ecC
Confidence            997

sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. Alpha crystallin, an abundant protein in the mammalian lens, is a large (700 kDa) heteropolymer composed of HspB4 and HspB5, generally in a molar ratio of HspB4:HspB5 of 3:1. Only trace amounts of HspB4 are found in tissues other than the lens. HspB5 does not belong to this group. Mutations inHspB4 have been associated with Autosomal Dominant Congenital Cataract (ADCC). The chaperone-like functions of HspB4 are considered important for maintaining lens transparency and preventing cataract.
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>KOG3591|consensus Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG0710|consensus Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>KOG3591|consensus Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>KOG0710|consensus Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF14913 DPCD: DPCD protein family Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>KOG1309|consensus Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>PF13349 DUF4097: Domain of unknown function (DUF4097) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3l1g_A96 Human Alphab Crystallin Length = 96 2e-20
2klr_A175 Solid-State Nmr Structure Of The Alpha-Crystallin D 2e-20
3n3e_A106 Zebrafish Alphaa Crystallin Length = 106 2e-19
3l1e_A106 Bovine Alphaa Crystallin Zinc Bound Length = 106 2e-19
3l1f_A103 Bovine Alphaa Crystallin Length = 103 2e-19
2wj7_A94 Human Alphab Crystallin Length = 94 3e-19
2y22_A94 Human Alphab-Crystallin Domain (Residues 67-157) Le 2e-18
2y1y_A90 Human Alphab Crystallin Acd(Residues 71-157) Length 2e-18
2y1z_A94 Human Alphab Crystallin Acd R120g Length = 94 4e-18
2wj5_A101 Rat Alpha Crystallin Domain Length = 101 2e-17
3q9p_A85 Hspb1 Fragment Length = 85 8e-13
>pdb|3L1G|A Chain A, Human Alphab Crystallin Length = 96 Back     alignment and structure 
Iteration: 1

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
Query: 12 TVNLDVQQFKPEEXXXXXXXXXXXXHAKHEERSDQHGFISREFTRRYKIPDSVDANAISS 71
          +VNLDV+ F PEE            H KHEER D+HGFISREF R+Y+IP  VD   I+S
Sbjct: 10 SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITS 69
Query: 72 KLSSDGVLSIQAPKKAVEAGAGERAIPV 99
           LSSDGVL++  P+K V     ER IP+
Sbjct: 70 SLSSDGVLTVNGPRKQV--SGPERTIPI 95
>pdb|2KLR|A Chain A, Solid-State Nmr Structure Of The Alpha-Crystallin Domain In Alphab- Crystallin Oligomers Length = 175 Back     alignment and structure
>pdb|3N3E|A Chain A, Zebrafish Alphaa Crystallin Length = 106 Back     alignment and structure
>pdb|3L1E|A Chain A, Bovine Alphaa Crystallin Zinc Bound Length = 106 Back     alignment and structure
>pdb|3L1F|A Chain A, Bovine Alphaa Crystallin Length = 103 Back     alignment and structure
>pdb|2WJ7|A Chain A, Human Alphab Crystallin Length = 94 Back     alignment and structure
>pdb|2Y22|A Chain A, Human Alphab-Crystallin Domain (Residues 67-157) Length = 94 Back     alignment and structure
>pdb|2Y1Y|A Chain A, Human Alphab Crystallin Acd(Residues 71-157) Length = 90 Back     alignment and structure
>pdb|2Y1Z|A Chain A, Human Alphab Crystallin Acd R120g Length = 94 Back     alignment and structure
>pdb|2WJ5|A Chain A, Rat Alpha Crystallin Domain Length = 101 Back     alignment and structure
>pdb|3Q9P|A Chain A, Hspb1 Fragment Length = 85 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 5e-37
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 1e-32
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 2e-32
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 4e-32
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 1e-31
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 4e-28
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 2e-23
1gme_A151 Heat shock protein 16.9B; small heat shock protein 6e-10
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 1e-09
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 4e-09
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 5e-06
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
 Score =  124 bits (312), Expect = 5e-37
 Identities = 51/91 (56%), Positives = 63/91 (69%), Gaps = 2/91 (2%)

Query: 13  VNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSK 72
           VNLDV+ F PEE+ VKV+   I VH KHEER D+HGFISREF R+Y+IP  VD   I+S 
Sbjct: 77  VNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSS 136

Query: 73  LSSDGVLSIQAPKKAVEAGAGERAIPVVQTP 103
           LSSDGVL++  P+K V     ER IP+ +  
Sbjct: 137 LSSDGVLTVNGPRKQVS--GPERTIPITREE 165
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.95
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.93
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.92
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.92
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.91
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.89
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.88
4fei_A102 Heat shock protein-related protein; stress respons 99.87
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.87
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.86
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.84
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.73
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.37
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.24
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.22
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.18
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.18
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.14
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.1
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.09
4fei_A102 Heat shock protein-related protein; stress respons 98.89
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 98.83
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 98.81
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 98.69
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.58
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.57
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.12
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.07
3igf_A374 ALL4481 protein; two-domained protein consisting o 97.01
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 96.72
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 96.7
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 96.17
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 96.16
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.15
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 96.13
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 96.0
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 95.94
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 95.64
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 94.33
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 87.71
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 86.53
2o30_A131 Nuclear movement protein; MCSG, structural genomic 84.23
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
Probab=99.95  E-value=8.9e-27  Score=163.00  Aligned_cols=101  Identities=44%  Similarity=0.786  Sum_probs=90.9

Q ss_pred             CeeEEEcCCeEEEEEEeCCCCCCCeEEEEECCEEEEEEEEeeecCCCceEEEEEEEEEECCCCCCcCCcEEEecCCCEEE
Q psy6564           1 MLATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQHGFISREFTRRYKIPDSVDANAISSKLSSDGVLS   80 (150)
Q Consensus         1 ~~~i~e~~~~~~v~~dlpG~~~edI~V~v~~~~L~I~g~~~~~~~~~~~~~r~f~r~~~LP~~vd~~~i~a~~~~dGvL~   80 (150)
                      +.+++|+++.|.|.++||||+++||+|+++++.|+|+|+++...++.+|.+++|+|+|.||.+||.++++|+|+.||+|+
T Consensus         4 ~~~i~e~~~~~~v~~dlPG~~~edi~V~v~~~~L~I~g~~~~~~~~~~~~~~eF~R~~~LP~~vd~~~i~A~~s~~GvL~   83 (106)
T 3l1e_A            4 ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLT   83 (106)
T ss_dssp             SEEEEECSSEEEEEEECTTSCGGGEEEEEETTEEEEEEEEEEEETTTEEEEEEEEEEEECCTTBCTTSCEEEECTTSEEE
T ss_pred             ceEEEEcCCEEEEEEECCCCChHHEEEEEECCEEEEEEEEccccCCCCEEEEEEEEEEECCCCcChhHcEEEECCCCEEE
Confidence            35789999999999999999999999999999999999988766677898999999999999999999999997799999


Q ss_pred             EEeecccccc--CCCceEEEeec
Q psy6564          81 IQAPKKAVEA--GAGERAIPVVQ  101 (150)
Q Consensus        81 I~~pk~~~~~--~~~~r~I~I~~  101 (150)
                      |++||..+..  ....|.|+|++
T Consensus        84 I~~PK~~~~~~~~~~~r~I~I~r  106 (106)
T 3l1e_A           84 FSGPKIPSGVDAGHSERAIPVSR  106 (106)
T ss_dssp             EEEEBCCCCTTTTSSSCCCCCCC
T ss_pred             EEEEccCcccccCCCCeEeeecC
Confidence            9999988752  23688888864
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 4e-08
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 5e-08
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

 Score = 47.5 bits (112), Expect = 4e-08
 Identities = 21/96 (21%), Positives = 42/96 (43%), Gaps = 10/96 (10%)

Query: 12  TVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSDQH--------GFISREFTRRYKIPDS 63
               D+   K EE+ V+V D  ++V +    +  +            S +F RR+++ + 
Sbjct: 55  VFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLED 114

Query: 64  VDANAISSKLSSDGVLSIQAPKKAVEAGAGERAIPV 99
                + + L  +GVL++  PK  V+     +AI +
Sbjct: 115 AKVEEVKAGL-ENGVLTVTVPKAEVKK-PEVKAIQI 148
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.87
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.83
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.14
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.1
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 97.86
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.2
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 95.79
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 95.39
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 94.08
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 89.48
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 86.91
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.87  E-value=1.1e-21  Score=136.57  Aligned_cols=95  Identities=22%  Similarity=0.277  Sum_probs=80.8

Q ss_pred             eeEEEcCCeEEEEEEeCCCCCCCeEEEEECCEEEEEEEEeeecC--CCceEE------EEEEEEEECCCCCCcCCcEEEe
Q psy6564           2 LATTAAEIEGTVNLDVQQFKPEEIDVKVVDKYIVVHAKHEERSD--QHGFIS------REFTRRYKIPDSVDANAISSKL   73 (150)
Q Consensus         2 ~~i~e~~~~~~v~~dlpG~~~edI~V~v~~~~L~I~g~~~~~~~--~~~~~~------r~f~r~~~LP~~vd~~~i~a~~   73 (150)
                      +++.+++++|.|.++||||+++||+|+++++.|+|+|++.....  ...+.+      +.|+|+|.||.++|.++++|.|
T Consensus        13 vdi~e~~~~~~i~~~lPG~~~edi~v~v~~~~l~I~~~~~~~~~~~~~~~~~~~~~~~~~f~r~~~lP~~vd~~~i~A~~   92 (115)
T d1shsa_          13 ISIIEGDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTIKLPATVKEENASAKF   92 (115)
T ss_dssp             EEEEECSSEEEEEEECTTCCGGGEEEEEETTEEEEEEECCCCCCCTTCEEEEECSCCCCEEEEEEECSSCBCGGGCEEEE
T ss_pred             eEEEEcCCEEEEEEECCCCCHHHEEEEEECCEEEEEEEeccccccccccEEEEeeecccceEEEEecCCceeecceEEEE
Confidence            68999999999999999999999999999999999998764332  222222      3899999999999999999999


Q ss_pred             cCCCEEEEEeeccccccCCCceEEEee
Q psy6564          74 SSDGVLSIQAPKKAVEAGAGERAIPVV  100 (150)
Q Consensus        74 ~~dGvL~I~~pk~~~~~~~~~r~I~I~  100 (150)
                       .||+|+|++||..+.   ..+.|.|+
T Consensus        93 -~nGvL~I~lpK~~~~---~~~~I~Ie  115 (115)
T d1shsa_          93 -ENGVLSVILPKAESS---IKKGINIE  115 (115)
T ss_dssp             -ETTEEEEEEEBCGGG---CCEECCCC
T ss_pred             -ECCEEEEEEEeCCCC---CCceeeeC
Confidence             899999999998655   46777663
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure