Psyllid ID: psy6625

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70------
Protein Sequence
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQK
Secondary Structure (PSIPRED)
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccEEEEccEEEEEEEEcc
Secondary Structure Prediction (SSPRO)
cccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccHcEccccccccccccEEEEEccEEEEEEEEEc
Coil and Loop (DISEMBL)
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYfssqmvpslalctttskpmminnnTVEIGVLVQK
Flexible Loop (DISEMBL)
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALctttskpmminnNTVEIGVLVQK
Low Complexity Region (SEG)
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQK
Disordered region (IsUnstruct)
***************************IQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVL***
Disordered Region (DISOPRED)
******************************AKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQ*
Disordered Region (DISEMBL)
************LARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQK
Disordered Region (DISPRO)
****************KQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQK
Transmembrane Helix (TMHMM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
TM Helix, Signal Peptide (MEMSAT_SVM)
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
TM Helix, Signal Peptide (Phobius)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIGVLVQK
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	76	2.2.26 [Sep-21-2011]
P38404	354	Guanine nucleotide-bindin	N/A	N/A	0.526	0.112	0.975	2e-15
P10825	354	Guanine nucleotide-bindin	N/A	N/A	0.526	0.112	0.85	4e-13
P30683	354	Guanine nucleotide-bindin	N/A	N/A	0.526	0.112	0.85	1e-12
P51877	354	Guanine nucleotide-bindin	N/A	N/A	0.526	0.112	0.85	1e-12
P51875	354	Guanine nucleotide-bindin	yes	N/A	0.526	0.112	0.85	1e-12
P59215	354	Guanine nucleotide-bindin	yes	N/A	0.526	0.112	0.85	1e-12
P59216	354	Guanine nucleotide-bindin	N/A	N/A	0.526	0.112	0.85	1e-12
P08239	354	Guanine nucleotide-bindin	yes	N/A	0.526	0.112	0.85	1e-12
P09471	354	Guanine nucleotide-bindin	yes	N/A	0.526	0.112	0.85	2e-12
P18872	354	Guanine nucleotide-bindin	no	N/A	0.526	0.112	0.85	2e-12

>sp|P38404|GNAO_LOCMI Guanine nucleotide-binding protein G(o) subunit alpha OS=Locusta migratoria PE=3 SV=1

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/40 (97%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDG+QAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGLQAAKDIKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear.
Locusta migratoria (taxid: 7004)

>sp|P10825|GNAO_XENLA Guanine nucleotide-binding protein G(o) subunit alpha OS=Xenopus laevis GN=gna0 PE=2 SV=5

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSKQIEKNLKEDG+ AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKQIEKNLKEDGVTAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear.

Xenopus laevis (taxid: 8355)

>sp|P30683|GNAO_LYMST Guanine nucleotide-binding protein G(o) subunit alpha OS=Lymnaea stagnalis PE=2 SV=3

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAA+ RSK IEKNLKEDG+QAAKDIKLLLLG
Sbjct: 1  MGCTLSAEERAAMERSKAIEKNLKEDGMQAAKDIKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear.

Lymnaea stagnalis (taxid: 6523)

>sp|P51877|GNAO_HELTI Guanine nucleotide-binding protein G(o) subunit alpha OS=Helisoma trivolvis PE=2 SV=2

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAA+ RSK IEKNLKEDG+QAAKDIKLLLLG
Sbjct: 1  MGCTLSAEERAAMERSKAIEKNLKEDGMQAAKDIKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear.

Helisoma trivolvis (taxid: 283763)

>sp|P51875|GNAO_CAEEL Guanine nucleotide-binding protein G(o) subunit alpha OS=Caenorhabditis elegans GN=goa-1 PE=1 SV=3

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC MS EERAAL RS+ IEKNLKEDG+QAAKDIKLLLLG
Sbjct: 1  MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Polarity determinants (par genes) may regulate lin-5/gpr-1/gpr-2/goa-1 locally to create the asymmetric forces that drive spindle movement.

Caenorhabditis elegans (taxid: 6239)

>sp|P59215|GNAO_RAT Guanine nucleotide-binding protein G(o) subunit alpha OS=Rattus norvegicus GN=Gnao1 PE=1 SV=2

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.

Rattus norvegicus (taxid: 10116)

>sp|P59216|GNAO_CRILO Guanine nucleotide-binding protein G(o) subunit alpha OS=Cricetulus longicaudatus GN=GNAO1 PE=2 SV=2

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.

Cricetulus longicaudatus (taxid: 10030)

>sp|P08239|GNAO_BOVIN Guanine nucleotide-binding protein G(o) subunit alpha OS=Bos taurus GN=GNAO1 PE=1 SV=4

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.

Bos taurus (taxid: 9913)

>sp|P09471|GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens GN=GNAO1 PE=1 SV=4

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.

Homo sapiens (taxid: 9606)

>sp|P18872|GNAO_MOUSE Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus GN=Gnao1 PE=1 SV=3

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct: 1  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Stimulated by RGS14. The G(o) protein function is not clear.

Mus musculus (taxid: 10090)

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Length	Definition	Q cover	H cover	Identity	E-value
Query	76
307202997	52	Guanine nucleotide-binding protein G(o)	0.631	0.923	0.895	7e-16
322795754	83	hypothetical protein SINV_09461 [Solenop	0.75	0.686	0.736	2e-14
391338008	338	PREDICTED: guanine nucleotide-binding pr	0.526	0.118	1.0	3e-14
391338006	354	PREDICTED: guanine nucleotide-binding pr	0.526	0.112	1.0	3e-14
383852541	330	PREDICTED: guanine nucleotide-binding pr	0.526	0.121	1.0	4e-14
307176763	354	Guanine nucleotide-binding protein G(o)	0.526	0.112	1.0	4e-14
242015524	356	Guanine nucleotide-binding protein G(O)	0.526	0.112	1.0	4e-14
383852539	354	PREDICTED: guanine nucleotide-binding pr	0.526	0.112	1.0	4e-14
216548700	354	guanine nucleotide-binding protein G(o)	0.526	0.112	1.0	4e-14
350418330	354	PREDICTED: guanine nucleotide-binding pr	0.526	0.112	1.0	4e-14

>gi|307202997|gb|EFN82213.1| Guanine nucleotide-binding protein G(o) subunit alpha [Harpegnathos saltator]

 Score = 87.8 bits (216), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/48 (89%), Positives = 45/48 (93%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMV 48
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGE++ S  V
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEFYDSVCV 48

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322795754|gb|EFZ18433.1| hypothetical protein SINV_09461 [Solenopsis invicta]

 Score = 83.2 bits (204), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/57 (73%), Positives = 47/57 (82%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTT 57
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG  +  Q++   ++C   
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGFEYELQIILLNSMCRNV 57

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|391338008|ref|XP_003743354.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 2 [Metaseiulus occidentalis]

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Metaseiulus occidentalis

Species: Metaseiulus occidentalis

Genus: Metaseiulus

Family: Phytoseiidae

Order: Mesostigmata

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|391338006|ref|XP_003743353.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 1 [Metaseiulus occidentalis]

 Score = 82.4 bits (202), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Metaseiulus occidentalis

Species: Metaseiulus occidentalis

Genus: Metaseiulus

Family: Phytoseiidae

Order: Mesostigmata

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852541|ref|XP_003701785.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 2 [Megachile rotundata]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307176763|gb|EFN66163.1| Guanine nucleotide-binding protein G(o) subunit alpha [Camponotus floridanus]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242015524|ref|XP_002428403.1| Guanine nucleotide-binding protein G(O) subunit alpha, putative [Pediculus humanus corporis] gi|212513015|gb|EEB15665.1| Guanine nucleotide-binding protein G(O) subunit alpha, putative [Pediculus humanus corporis]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383852539|ref|XP_003701784.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 1 [Megachile rotundata]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|216548700|ref|NP_001135854.1| guanine nucleotide-binding protein G(o) subunit alpha [Nasonia vitripennis]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350418330|ref|XP_003491826.1| PREDICTED: guanine nucleotide-binding protein G(o) subunit alpha-like isoform 1 [Bombus impatiens]

 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/40 (100%), Positives = 40/40 (100%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG
Sbjct: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	76
FB|FBgn0001122	354	Galphao "G protein alpha o sub	0.526	0.112	0.875	3.4e-12
UNIPROTKB|F1RF18	353	GNAO1 "Uncharacterized protein	0.526	0.113	0.85	4.4e-12
UNIPROTKB|P08239	354	GNAO1 "Guanine nucleotide-bind	0.526	0.112	0.85	4.4e-12
UNIPROTKB|E2RLG2	354	GNAO1 "Uncharacterized protein	0.526	0.112	0.85	4.4e-12
UNIPROTKB|P09471	354	GNAO1 "Guanine nucleotide-bind	0.526	0.112	0.85	4.4e-12
MGI|MGI:95775	354	Gnao1 "guanine nucleotide bind	0.526	0.112	0.85	4.4e-12
RGD|628732	354	Gnao1 "guanine nucleotide bind	0.526	0.112	0.85	4.4e-12
WB|WBGene00001648	354	goa-1 [Caenorhabditis elegans	0.526	0.112	0.85	5.7e-12
UNIPROTKB|P51875	354	goa-1 "Guanine nucleotide-bind	0.526	0.112	0.85	5.7e-12
ZFIN|ZDB-GENE-040426-1757	354	gnao1a "guanine nucleotide bin	0.526	0.112	0.85	7.3e-12

FB|FBgn0001122 Galphao "G protein alpha o subunit" [Drosophila melanogaster (taxid:7227)]

 Score = 169 (64.5 bits), Expect = 3.4e-12, P = 3.4e-12
 Identities = 35/40 (87%), Positives = 37/40 (92%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGCA SAEERAA ARS+ IE+NLKEDGIQAAKDIKLLLLG
Sbjct:     1 MGCAQSAEERAAAARSRLIERNLKEDGIQAAKDIKLLLLG 40

GO:0005834 "heterotrimeric G-protein complex" evidence=ISS;IBA;NAS

GO:0003924 "GTPase activity" evidence=ISS;IBA;NAS

GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISS;NAS

GO:0007507 "heart development" evidence=TAS

GO:0006184 "GTP catabolic process" evidence=IEA

GO:0016055 "Wnt receptor signaling pathway" evidence=IMP

GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP

GO:0019991 "septate junction assembly" evidence=IMP

GO:0060857 "establishment of glial blood-brain barrier" evidence=IMP

GO:0030866 "cortical actin cytoskeleton organization" evidence=IMP

GO:0007419 "ventral cord development" evidence=IMP

GO:0008356 "asymmetric cell division" evidence=IMP

GO:0005886 "plasma membrane" evidence=IDA

GO:0050916 "sensory perception of sweet taste" evidence=IMP

GO:0005525 "GTP binding" evidence=IDA

GO:0045886 "negative regulation of synaptic growth at neuromuscular junction" evidence=IMP

GO:0042595 "behavioral response to starvation" evidence=IMP

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA

GO:0001664 "G-protein coupled receptor binding" evidence=IBA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA

GO:0004871 "signal transducer activity" evidence=IBA

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA

UNIPROTKB|F1RF18 GNAO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0008016 "regulation of heart contraction" evidence=IEA

GO:0007626 "locomotory behavior" evidence=IEA

GO:0007212 "dopamine receptor signaling pathway" evidence=IEA

GO:0005622 "intracellular" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0004871 "signal transducer activity" evidence=IEA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IEA

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IEA

GO:0003924 "GTPase activity" evidence=IEA

UNIPROTKB|P08239 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Bos taurus (taxid:9913)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0031821 "G-protein coupled serotonin receptor binding" evidence=ISS

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=ISS

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=ISS

GO:0007212 "dopamine receptor signaling pathway" evidence=ISS

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=ISS

GO:0005834 "heterotrimeric G-protein complex" evidence=ISS

GO:0004871 "signal transducer activity" evidence=ISS

GO:0003924 "GTPase activity" evidence=ISS

GO:0008016 "regulation of heart contraction" evidence=IEA

GO:0007626 "locomotory behavior" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

UNIPROTKB|E2RLG2 GNAO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0005525 "GTP binding" evidence=IEA

GO:0004871 "signal transducer activity" evidence=IEA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IEA

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IEA

GO:0003924 "GTPase activity" evidence=IEA

UNIPROTKB|P09471 GNAO1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Homo sapiens (taxid:9606)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0046872 "metal ion binding" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0007568 "aging" evidence=IEA

GO:0007626 "locomotory behavior" evidence=IEA

GO:0008016 "regulation of heart contraction" evidence=IEA

GO:0030900 "forebrain development" evidence=IEA

GO:0031175 "neuron projection development" evidence=IEA

GO:0031852 "mu-type opioid receptor binding" evidence=IEA

GO:0034097 "response to cytokine stimulus" evidence=IEA

GO:0042493 "response to drug" evidence=IEA

GO:0042542 "response to hydrogen peroxide" evidence=IEA

GO:0043005 "neuron projection" evidence=IEA

GO:0043278 "response to morphine" evidence=IEA

GO:0043547 "positive regulation of GTPase activity" evidence=IEA

GO:0051430 "corticotropin-releasing hormone receptor 1 binding" evidence=IEA

GO:0051926 "negative regulation of calcium ion transport" evidence=IEA

GO:0003924 "GTPase activity" evidence=IBA

GO:0004871 "signal transducer activity" evidence=IBA

GO:0005834 "heterotrimeric G-protein complex" evidence=IBA

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA

GO:0007212 "dopamine receptor signaling pathway" evidence=IBA

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA

GO:0031821 "G-protein coupled serotonin receptor binding" evidence=IBA

GO:0006936 "muscle contraction" evidence=TAS

GO:0005886 "plasma membrane" evidence=TAS

MGI|MGI:95775 Gnao1 "guanine nucleotide binding protein, alpha O" [Mus musculus (taxid:10090)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003924 "GTPase activity" evidence=ISO;IDA;IBA;TAS

GO:0004871 "signal transducer activity" evidence=IBA

GO:0005515 "protein binding" evidence=IPI

GO:0005525 "GTP binding" evidence=ISO;IMP

GO:0005622 "intracellular" evidence=IDA

GO:0005834 "heterotrimeric G-protein complex" evidence=IBA;TAS

GO:0006184 "GTP catabolic process" evidence=IDA;TAS

GO:0007165 "signal transduction" evidence=IEA

GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISO;IMP;TAS

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA

GO:0007212 "dopamine receptor signaling pathway" evidence=IMP

GO:0007568 "aging" evidence=ISO

GO:0007626 "locomotory behavior" evidence=IMP

GO:0008016 "regulation of heart contraction" evidence=IMP

GO:0009987 "cellular process" evidence=IMP

GO:0010243 "response to organic nitrogen" evidence=ISO

GO:0016020 "membrane" evidence=ISO;TAS

GO:0019001 "guanyl nucleotide binding" evidence=IEA

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA

GO:0031821 "G-protein coupled serotonin receptor binding" evidence=ISO;IBA

GO:0031852 "mu-type opioid receptor binding" evidence=ISO

GO:0032403 "protein complex binding" evidence=ISO

GO:0032794 "GTPase activating protein binding" evidence=ISO

GO:0043005 "neuron projection" evidence=ISO

GO:0043234 "protein complex" evidence=ISO

GO:0043547 "positive regulation of GTPase activity" evidence=ISO

GO:0046872 "metal ion binding" evidence=IEA

GO:0051430 "corticotropin-releasing hormone receptor 1 binding" evidence=ISO

GO:0051926 "negative regulation of calcium ion transport" evidence=ISO

RGD|628732 Gnao1 "guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O" [Rattus norvegicus (taxid:10116)]

 Score = 168 (64.2 bits), Expect = 4.4e-12, P = 4.4e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLG 40

GO:0003924 "GTPase activity" evidence=ISO;IDA;IBA

GO:0004871 "signal transducer activity" evidence=IBA

GO:0005515 "protein binding" evidence=IPI

GO:0005525 "GTP binding" evidence=ISO;IDA

GO:0005622 "intracellular" evidence=ISO

GO:0005834 "heterotrimeric G-protein complex" evidence=IBA

GO:0006184 "GTP catabolic process" evidence=ISO

GO:0007186 "G-protein coupled receptor signaling pathway" evidence=ISO;IMP

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA

GO:0007212 "dopamine receptor signaling pathway" evidence=ISO;IBA

GO:0007568 "aging" evidence=IDA

GO:0007626 "locomotory behavior" evidence=IEA;ISO

GO:0008016 "regulation of heart contraction" evidence=IEA;ISO

GO:0009987 "cellular process" evidence=ISO

GO:0010243 "response to organic nitrogen" evidence=IDA

GO:0014070 "response to organic cyclic compound" evidence=IEP

GO:0016020 "membrane" evidence=IDA

GO:0019003 "GDP binding" evidence=TAS

GO:0030900 "forebrain development" evidence=IEP

GO:0031175 "neuron projection development" evidence=IEP

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA

GO:0031821 "G-protein coupled serotonin receptor binding" evidence=IPI

GO:0031852 "mu-type opioid receptor binding" evidence=IPI

GO:0032403 "protein complex binding" evidence=IPI

GO:0032794 "GTPase activating protein binding" evidence=IPI

GO:0034097 "response to cytokine stimulus" evidence=IEP

GO:0042493 "response to drug" evidence=IEP

GO:0042542 "response to hydrogen peroxide" evidence=IEP

GO:0043005 "neuron projection" evidence=IDA

GO:0043234 "protein complex" evidence=IDA

GO:0043278 "response to morphine" evidence=IEP

GO:0043547 "positive regulation of GTPase activity" evidence=IMP

GO:0046872 "metal ion binding" evidence=IEA

GO:0051430 "corticotropin-releasing hormone receptor 1 binding" evidence=IPI

GO:0051926 "negative regulation of calcium ion transport" evidence=IMP

WB|WBGene00001648 goa-1 [Caenorhabditis elegans (taxid:6239)]

 Score = 167 (63.8 bits), Expect = 5.7e-12, P = 5.7e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC MS EERAAL RS+ IEKNLKEDG+QAAKDIKLLLLG
Sbjct:     1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLG 40

GO:0004871 "signal transducer activity" evidence=IEA

GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA

GO:0019001 "guanyl nucleotide binding" evidence=IEA

GO:0005525 "GTP binding" evidence=IEA

GO:0005634 "nucleus" evidence=IEA

GO:0005737 "cytoplasm" evidence=IEA

GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP

GO:0018991 "oviposition" evidence=IMP

GO:0040011 "locomotion" evidence=IMP

GO:0000003 "reproduction" evidence=IMP

GO:0040035 "hermaphrodite genitalia development" evidence=IMP

GO:0040013 "negative regulation of locomotion" evidence=IMP

GO:0007052 "mitotic spindle organization" evidence=IMP

GO:0007067 "mitosis" evidence=IMP

GO:0040007 "growth" evidence=IMP

GO:0002119 "nematode larval development" evidence=IMP

GO:0007212 "dopamine receptor signaling pathway" evidence=IMP

GO:0032094 "response to food" evidence=IMP

GO:0043051 "regulation of pharyngeal pumping" evidence=IGI

GO:0040012 "regulation of locomotion" evidence=IMP

GO:0005938 "cell cortex" evidence=IDA

GO:0046662 "regulation of oviposition" evidence=IMP

GO:0003924 "GTPase activity" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0060259 "regulation of feeding behavior" evidence=IMP

GO:0006184 "GTP catabolic process" evidence=IDA

UNIPROTKB|P51875 goa-1 "Guanine nucleotide-binding protein G(o) subunit alpha" [Caenorhabditis elegans (taxid:6239)]

 Score = 167 (63.8 bits), Expect = 5.7e-12, P = 5.7e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC MS EERAAL RS+ IEKNLKEDG+QAAKDIKLLLLG
Sbjct:     1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLG 40

GO:0005515 "protein binding" evidence=IPI

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA

GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA

GO:0005834 "heterotrimeric G-protein complex" evidence=IBA

GO:0004871 "signal transducer activity" evidence=IBA

GO:0003924 "GTPase activity" evidence=IBA

GO:0001664 "G-protein coupled receptor binding" evidence=IBA

ZFIN|ZDB-GENE-040426-1757 gnao1a "guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, a" [Danio rerio (taxid:7955)]

 Score = 166 (63.5 bits), Expect = 7.3e-12, P = 7.3e-12
 Identities = 34/40 (85%), Positives = 36/40 (90%)

Query:     1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
             MGC +SAEERAAL RSK IEKNLKEDGI AAKD+KLLLLG
Sbjct:     1 MGCTLSAEERAALDRSKAIEKNLKEDGITAAKDVKLLLLG 40

GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IEA;IBA

GO:0003924 "GTPase activity" evidence=IEA;IBA

GO:0004871 "signal transducer activity" evidence=IEA;IBA

GO:0007165 "signal transduction" evidence=IEA

GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IEA;IBA

GO:0005525 "GTP binding" evidence=IEA

GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA

GO:0019001 "guanyl nucleotide binding" evidence=IEA

GO:0006184 "GTP catabolic process" evidence=IEA;IBA

GO:0031821 "G-protein coupled serotonin receptor binding" evidence=IBA

GO:0007212 "dopamine receptor signaling pathway" evidence=IBA

GO:0005834 "heterotrimeric G-protein complex" evidence=IBA

GO:0000166 "nucleotide binding" evidence=IEA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P16378	GNAO_DROME	No assigned EC number	0.875	0.5263	0.1129	yes	N/A
P38403	GNAI3_CAVPO	No assigned EC number	0.65	0.5263	0.1129	yes	N/A
P38404	GNAO_LOCMI	No assigned EC number	0.975	0.5263	0.1129	N/A	N/A
P08239	GNAO_BOVIN	No assigned EC number	0.85	0.5263	0.1129	yes	N/A
P09471	GNAO_HUMAN	No assigned EC number	0.85	0.5263	0.1129	yes	N/A
P51875	GNAO_CAEEL	No assigned EC number	0.85	0.5263	0.1129	yes	N/A
P59215	GNAO_RAT	No assigned EC number	0.85	0.5263	0.1129	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Length	Definition	E-value
Query	76
smart00275	342	smart00275, G_alpha, G protein alpha subunit	4e-05

>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit

 Score = 39.1 bits (92), Expect = 4e-05
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 14 ARSKQIEKNLKEDGIQAAKDIKLLLLG 40
           R+K+IEK L+E+  +  +++KLLLLG
Sbjct: 2  RRNKEIEKQLEEERKKKKREVKLLLLG 28

Subunit of G proteins that contains the guanine nucleotide binding site. Length = 342

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	76
KOG0085|consensus	359		99.75
KOG0082|consensus	354		99.65
KOG0099|consensus	379		99.5
smart00275	342	G_alpha G protein alpha subunit. Subunit of G prot	99.47
PF00503	389	G-alpha: G-protein alpha subunit; InterPro: IPR001	99.31
cd00066	317	G-alpha G protein alpha subunit. The alpha subunit	98.9
PF08477	119	Miro: Miro-like protein; InterPro: IPR013684 Mitoc	97.56
cd04113	161	Rab4 Rab4 subfamily. Rab4 has been implicated in n	97.36
cd01878	204	HflX HflX subfamily. A distinct conserved domain w	97.33
TIGR00231	161	small_GTP small GTP-binding protein domain. This m	97.3
PRK08118	167	topology modulation protein; Reviewed	97.29
cd04155	173	Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f	97.28
cd01860	163	Rab5_related Rab5-related subfamily. This subfamil	97.26
PRK07261	171	topology modulation protein; Provisional	97.22
cd00154	159	Rab Rab family. Rab GTPases form the largest famil	97.21
COG0563	178	Adk Adenylate kinase and related kinases [Nucleoti	97.18
PF13207	121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	97.15
cd04138	162	H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras,	97.09
cd04123	162	Rab21 Rab21 subfamily. The localization and functi	97.08
smart00175	164	RAB Rab subfamily of small GTPases. Rab GTPases ar	97.08
cd00157	171	Rho Rho (Ras homology) family. Members of the Rho	97.02
PF01926	116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	97.02
cd01862	172	Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th	97.01
smart00173	164	RAS Ras subfamily of RAS small GTPases. Similar in	97.0
cd04115	170	Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u	96.97
cd04119	168	RJL RJL (RabJ-Like) subfamily. RJLs are found in m	96.96
PF13479	213	AAA_24: AAA domain	96.95
cd04139	164	RalA_RalB RalA/RalB subfamily. The Ral (Ras-like)	96.94
cd01869	166	Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev	96.93
PRK06217	183	hypothetical protein; Validated	96.92
PF00025	175	Arf: ADP-ribosylation factor family The prints ent	96.91
cd04154	173	Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are	96.91
PF00071	162	Ras: Ras family; InterPro: IPR001806 Small GTPases	96.91
KOG0074|consensus	185		96.89
cd04164	157	trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein	96.87
cd04135	174	Tc10 TC10 subfamily. TC10 is a Rho family protein	96.86
cd00879	190	Sar1 Sar1 subfamily. Sar1 is an essential componen	96.86
cd04163	168	Era Era subfamily. Era (E. coli Ras-like protein)	96.85
cd01892	169	Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr	96.82
COG1100	219	GTPase SAR1 and related small G proteins [General	96.81
cd01895	174	EngA2 EngA2 subfamily. This CD represents the seco	96.81
cd04136	163	Rap_like Rap-like subfamily. The Rap subfamily con	96.8
cd04106	162	Rab23_lke Rab23-like subfamily. Rab23 is a member	96.79
cd04146	165	RERG_RasL11_like RERG/RasL11-like subfamily. RERG	96.79
cd00876	160	Ras Ras family. The Ras family of the Ras superfam	96.79
PF13555	62	AAA_29: P-loop containing region of AAA domain	96.79
cd01864	165	Rab19 Rab19 subfamily. Rab19 proteins are associat	96.74
cd01868	165	Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a	96.73
PF00005	137	ABC_tran: ABC transporter This structure is on hol	96.73
cd04175	164	Rap1 Rap1 subgroup. The Rap1 subgroup is part of t	96.72
cd04150	159	Arf1_5_like Arf1-Arf5-like subfamily. This subfami	96.71
cd01861	161	Rab6 Rab6 subfamily. Rab6 is involved in microtubu	96.7
cd04132	187	Rho4_like Rho4-like subfamily. Rho4 is a GTPase th	96.69
cd01863	161	Rab18 Rab18 subfamily. Mammalian Rab18 is implicat	96.67
cd04145	164	M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf	96.67
PLN03108	210	Rab family protein; Provisional	96.63
cd04129	187	Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that	96.61
cd04101	164	RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove	96.6
cd04140	165	ARHI_like ARHI subfamily. ARHI (A Ras homolog memb	96.6
cd01867	167	Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp	96.59
cd03264	211	ABC_drug_resistance_like ABC-type multidrug transp	96.59
cd01865	165	Rab3 Rab3 subfamily. The Rab3 subfamily contains R	96.58
cd04177	168	RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the	96.57
cd01428	194	ADK Adenylate kinase (ADK) catalyzes the reversibl	96.56
PF13671	143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	96.56
PTZ00133	182	ADP-ribosylation factor; Provisional	96.56
cd00878	158	Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik	96.55
cd04114	169	Rab30 Rab30 subfamily. Rab30 appears to be associa	96.54
cd01853	249	Toc34_like Toc34-like (Translocon at the Outer-env	96.53
cd04153	174	Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a	96.53
cd04124	161	RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily	96.53
cd04112	191	Rab26 Rab26 subfamily. First identified in rat pan	96.51
PF00735	281	Septin: Septin; InterPro: IPR000038 Septins consti	96.51
cd04107	201	Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38	96.51
cd04176	163	Rap2 Rap2 subgroup. The Rap2 subgroup is part of t	96.5
PF05729	166	NACHT: NACHT domain	96.5
PLN00223	181	ADP-ribosylation factor; Provisional	96.5
cd04122	166	Rab14 Rab14 subfamily. Rab14 GTPases are localized	96.5
cd03226	205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	96.47
cd04160	167	Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote	96.46
TIGR01359	183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	96.46
TIGR01351	210	adk adenylate kinases. Adenylate kinase (EC 2.7.4.	96.46
cd03263	220	ABC_subfamily_A The ABCA subfamily mediates the tr	96.45
PF00004	132	AAA: ATPase family associated with various cellula	96.44
cd04116	170	Rab9 Rab9 subfamily. Rab9 is found in late endosom	96.41
cd03265	220	ABC_DrrA DrrA is the ATP-binding protein component	96.39
PRK03839	180	putative kinase; Provisional	96.37
cd04158	169	ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor	96.37
cd01870	175	RhoA_like RhoA-like subfamily. The RhoA subfamily	96.37
PRK13543	214	cytochrome c biogenesis protein CcmA; Provisional	96.36
PF13238	129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	96.35
cd04127	180	Rab27A Rab27a subfamily. The Rab27a subfamily cons	96.35
smart00178	184	SAR Sar1p-like members of the Ras-family of small	96.34
PRK14242	253	phosphate transporter ATP-binding protein; Provisi	96.34
cd04151	158	Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t	96.34
cd04141	172	Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p	96.31
PRK14532	188	adenylate kinase; Provisional	96.31
TIGR02322	179	phosphon_PhnN phosphonate metabolism protein/1,5-b	96.31
smart00177	175	ARF ARF-like small GTPases; ARF, ADP-ribosylation	96.31
smart00382	148	AAA ATPases associated with a variety of cellular	96.3
PTZ00369	189	Ras-like protein; Provisional	96.3
cd01866	168	Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg	96.3
PRK14530	215	adenylate kinase; Provisional	96.29
cd04149	168	Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor	96.29
PRK13949	169	shikimate kinase; Provisional	96.26
cd04137	180	RheB Rheb (Ras Homolog Enriched in Brain) subfamil	96.26
cd00877	166	Ran Ran (Ras-related nuclear proteins) /TC4 subfam	96.26
PRK14256	252	phosphate ABC transporter ATP-binding protein; Pro	96.25
PRK10418	254	nikD nickel transporter ATP-binding protein NikD;	96.25
cd04125	188	RabA_like RabA-like subfamily. RabA was first iden	96.24
cd04110	199	Rab35 Rab35 subfamily. Rab35 is one of several Rab	96.24
cd01876	170	YihA_EngB The YihA (EngB) subfamily. This subfamil	96.24
cd04118	193	Rab24 Rab24 subfamily. Rab24 is distinct from othe	96.23
PRK08233	182	hypothetical protein; Provisional	96.23
PTZ00132	215	GTP-binding nuclear protein Ran; Provisional	96.21
cd04117	161	Rab15 Rab15 subfamily. Rab15 colocalizes with the	96.21
TIGR03598	179	GTPase_YsxC ribosome biogenesis GTP-binding protei	96.2
PRK00454	196	engB GTP-binding protein YsxC; Reviewed	96.19
TIGR03263	180	guanyl_kin guanylate kinase. Members of this famil	96.17
cd04156	160	ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su	96.16
TIGR01360	188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	96.15
PRK10078	186	ribose 1,5-bisphosphokinase; Provisional	96.14
cd03292	214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	96.13
cd01893	166	Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr	96.12
cd03219	236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	96.12
cd01874	175	Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas	96.11
PRK00279	215	adk adenylate kinase; Reviewed	96.11
TIGR00235	207	udk uridine kinase. Model contains a number of lon	96.11
PRK14260	259	phosphate ABC transporter ATP-binding protein; Pro	96.08
cd04134	189	Rho3 Rho3 subfamily. Rho3 is a member of the Rho f	96.07
cd03262	213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	96.06
cd03253	236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	96.06
cd03266	218	ABC_NatA_sodium_exporter NatA is the ATPase compon	96.05
cd01850	276	CDC_Septin CDC/Septin. Septins are a conserved fam	96.05
PRK14531	183	adenylate kinase; Provisional	96.05
cd04109	215	Rab28 Rab28 subfamily. First identified in maize,	96.05
TIGR03410	230	urea_trans_UrtE urea ABC transporter, ATP-binding	96.05
cd00881	189	GTP_translation_factor GTP translation factor fami	96.04
PRK14255	252	phosphate ABC transporter ATP-binding protein; Pro	96.04
PRK11147	635	ABC transporter ATPase component; Reviewed	96.04
cd03234	226	ABCG_White The White subfamily represents ABC tran	96.03
TIGR03771	223	anch_rpt_ABC anchored repeat-type ABC transporter,	96.03
PRK13634	290	cbiO cobalt transporter ATP-binding subunit; Provi	96.03
cd01130	186	VirB11-like_ATPase Type IV secretory pathway compo	96.03
cd03255	218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	96.03
PRK13644	274	cbiO cobalt transporter ATP-binding subunit; Provi	96.02
cd00882	157	Ras_like_GTPase Ras-like GTPase superfamily. The R	96.02
cd04159	159	Arl10_like Arl10-like subfamily. Arl9/Arl10 was id	96.02
cd04130	173	Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive	96.01
PRK10744	260	pstB phosphate transporter ATP-binding protein; Pr	96.01
cd01120	165	RecA-like_NTPases RecA-like NTPases. This family i	96.01
TIGR02315	243	ABC_phnC phosphonate ABC transporter, ATP-binding	96.0
cd03301	213	ABC_MalK_N The N-terminal ATPase domain of the mal	96.0
cd02021	150	GntK Gluconate kinase (GntK) catalyzes the phospho	95.99
cd04152	183	Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i	95.99
PRK09270	229	nucleoside triphosphate hydrolase domain-containin	95.98
PRK13695	174	putative NTPase; Provisional	95.98
PRK11629	233	lolD lipoprotein transporter ATP-binding subunit;	95.98
TIGR02211	221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	95.97
PRK09452	375	potA putrescine/spermidine ABC transporter ATPase	95.96
TIGR01313	163	therm_gnt_kin carbohydrate kinase, thermoresistant	95.96
PRK13642	277	cbiO cobalt transporter ATP-binding subunit; Provi	95.95
COG4619	223	ABC-type uncharacterized transport system, ATPase	95.94
cd03232	192	ABC_PDR_domain2 The pleiotropic drug resistance-li	95.94
PTZ00088	229	adenylate kinase 1; Provisional	95.93
TIGR00972	247	3a0107s01c2 phosphate ABC transporter, ATP-binding	95.93
cd03243	202	ABC_MutS_homologs The MutS protein initiates DNA m	95.93
cd00009	151	AAA The AAA+ (ATPases Associated with a wide varie	95.93
PRK14239	252	phosphate transporter ATP-binding protein; Provisi	95.92
PRK14238	271	phosphate transporter ATP-binding protein; Provisi	95.92
PF10662	143	PduV-EutP: Ethanolamine utilisation - propanediol	95.92
PRK14527	191	adenylate kinase; Provisional	95.92
cd04108	170	Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr	95.92
cd03251	234	ABCC_MsbA MsbA is an essential ABC transporter, cl	95.92
cd04161	167	Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (	95.92
cd03281	213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	95.91
cd02023	198	UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.	95.91
TIGR02673	214	FtsE cell division ATP-binding protein FtsE. This	95.9
TIGR01277	213	thiQ thiamine ABC transporter, ATP-binding protein	95.9
PRK13540	200	cytochrome c biogenesis protein CcmA; Provisional	95.9
PRK14259	269	phosphate ABC transporter ATP-binding protein; Pro	95.89
cd03269	210	ABC_putative_ATPase This subfamily is involved in	95.89
PRK13652	277	cbiO cobalt transporter ATP-binding subunit; Provi	95.88
cd03214	180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	95.88
cd04111	211	Rab39 Rab39 subfamily. Found in eukaryotes, Rab39	95.87
cd03224	222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	95.87
cd04144	190	Ras2 Ras2 subfamily. The Ras2 subfamily, found exc	95.86
PRK14266	250	phosphate ABC transporter ATP-binding protein; Pro	95.86
cd03221	144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	95.86
TIGR00960	216	3a0501s02 Type II (General) Secretory Pathway (IIS	95.86
TIGR02770	230	nickel_nikD nickel import ATP-binding protein NikD	95.85
TIGR03608	206	L_ocin_972_ABC putative bacteriocin export ABC tra	95.85
PLN03071	219	GTP-binding nuclear protein Ran; Provisional	95.85
cd03256	241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	95.85
KOG0073|consensus	185		95.85
cd03230	173	ABC_DR_subfamily_A This family of ATP-binding prot	95.85
cd03283	199	ABC_MutS-like MutS-like homolog in eukaryotes. The	95.84
cd00880	163	Era_like Era (E. coli Ras-like protein)-like. This	95.84
PRK14269	246	phosphate ABC transporter ATP-binding protein; Pro	95.83
cd04104	197	p47_IIGP_like p47 (47-kDa) family. The p47 GTPase	95.83
COG4639	168	Predicted kinase [General function prediction only	95.83
smart00174	174	RHO Rho (Ras homology) subfamily of Ras-like small	95.83
cd04103	158	Centaurin_gamma Centaurin gamma. The centaurins (a	95.83
PRK14247	250	phosphate ABC transporter ATP-binding protein; Pro	95.83
PRK15093	330	antimicrobial peptide ABC transporter ATP-binding	95.83
PRK11701	258	phnK phosphonate C-P lyase system protein PhnK; Pr	95.82
PRK11300	255	livG leucine/isoleucine/valine transporter ATP-bin	95.82
cd03293	220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	95.82
cd03218	232	ABC_YhbG The ABC transporters belonging to the Yhb	95.81
cd03290	218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	95.81
cd01871	174	Rac1_like Rac1-like subfamily. The Rac1-like subfa	95.81
PRK10584	228	putative ABC transporter ATP-binding protein YbbA;	95.8
cd03261	235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	95.8
cd03254	229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	95.8
cd04157	162	Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub	95.79
PF07728	139	AAA_5: AAA domain (dynein-related subfamily); Inte	95.79
PRK14251	251	phosphate ABC transporter ATP-binding protein; Pro	95.79
cd03259	213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	95.78
PRK00300	205	gmk guanylate kinase; Provisional	95.76
PRK05800	170	cobU adenosylcobinamide kinase/adenosylcobinamide-	95.76
PRK11264	250	putative amino-acid ABC transporter ATP-binding pr	95.75
PRK09544	251	znuC high-affinity zinc transporter ATPase; Review	95.75
cd00227	175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	95.75
TIGR02324	224	CP_lyasePhnL phosphonate C-P lyase system protein	95.75
cd03252	237	ABCC_Hemolysin The ABC-transporter hemolysin B is	95.74
PRK02496	184	adk adenylate kinase; Provisional	95.74
TIGR03719	552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	95.74
cd03247	178	ABCC_cytochrome_bd The CYD subfamily implicated in	95.73
PRK10771	232	thiQ thiamine transporter ATP-binding subunit; Pro	95.73
cd04121	189	Rab40 Rab40 subfamily. This subfamily contains Rab	95.73
PRK11248	255	tauB taurine transporter ATP-binding subunit; Prov	95.73
TIGR02528	142	EutP ethanolamine utilization protein, EutP. This	95.72
TIGR01978	243	sufC FeS assembly ATPase SufC. SufC is part of the	95.72
PRK11614	237	livF leucine/isoleucine/valine transporter ATP-bin	95.72
cd03258	233	ABC_MetN_methionine_transporter MetN (also known a	95.72
cd03248	226	ABCC_TAP TAP, the Transporter Associated with Anti	95.72
cd03225	211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	95.72
cd03228	171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	95.71
cd03296	239	ABC_CysA_sulfate_importer Part of the ABC transpor	95.71
cd03246	173	ABCC_Protease_Secretion This family represents the	95.7
PRK14528	186	adenylate kinase; Provisional	95.7
PF13521	163	AAA_28: AAA domain; PDB: 1LW7_A.	95.69
cd03257	228	ABC_NikE_OppD_transporters The ABC transporter sub	95.69
PF00350	168	Dynamin_N: Dynamin family; InterPro: IPR001401 Mem	95.69
cd03223	166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	95.68
PRK14237	267	phosphate transporter ATP-binding protein; Provisi	95.68
PF13304	303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	95.67
PRK14270	251	phosphate ABC transporter ATP-binding protein; Pro	95.67
PRK13638	271	cbiO cobalt transporter ATP-binding subunit; Provi	95.66
TIGR02323	253	CP_lyasePhnK phosphonate C-P lyase system protein	95.66
cd03249	238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	95.65
PRK05480	209	uridine/cytidine kinase; Provisional	95.65
PRK10247	225	putative ABC transporter ATP-binding protein YbbL;	95.65
cd00820	107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	95.64
cd03267	236	ABC_NatA_like Similar in sequence to NatA, this is	95.64
PRK11124	242	artP arginine transporter ATP-binding subunit; Pro	95.63
cd03295	242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	95.63
cd03236	255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	95.62
TIGR03411	242	urea_trans_UrtD urea ABC transporter, ATP-binding	95.62
smart00534	185	MUTSac ATPase domain of DNA mismatch repair MUTS f	95.62
PF07931	174	CPT: Chloramphenicol phosphotransferase-like prote	95.62
cd00267	157	ABC_ATPase ABC (ATP-binding cassette) transporter	95.61
PRK14250	241	phosphate ABC transporter ATP-binding protein; Pro	95.61
cd03369	207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	95.59
PRK09473	330	oppD oligopeptide transporter ATP-binding componen	95.58
cd01875	191	RhoG RhoG subfamily. RhoG is a GTPase with high se	95.58
PF04548	212	AIG1: AIG1 family; InterPro: IPR006703 This entry	95.58
PRK14526	211	adenylate kinase; Provisional	95.58
PRK14243	264	phosphate transporter ATP-binding protein; Provisi	95.57
PRK10575	265	iron-hydroxamate transporter ATP-binding subunit;	95.57
cd03272	243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	95.56
cd01131	198	PilT Pilus retraction ATPase PilT. PilT is a nucle	95.56
cd02025	220	PanK Pantothenate kinase (PanK) catalyzes the phos	95.55
PRK10908	222	cell division protein FtsE; Provisional	95.54
PRK15056	272	manganese/iron transporter ATP-binding protein; Pr	95.54
PRK13650	279	cbiO cobalt transporter ATP-binding subunit; Provi	95.54
COG1126	240	GlnQ ABC-type polar amino acid transport system, A	95.53
PRK13549	506	xylose transporter ATP-binding subunit; Provisiona	95.53
cd03235	213	ABC_Metallic_Cations ABC component of the metal-ty	95.52
PRK11831	269	putative ABC transporter ATP-binding protein YrbF;	95.51
PRK14264	305	phosphate ABC transporter ATP-binding protein; Pro	95.51
cd03216	163	ABC_Carb_Monos_I This family represents the domain	95.51
cd03229	178	ABC_Class3 This class is comprised of all BPD (Bin	95.49
cd03268	208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	95.49
PRK14245	250	phosphate ABC transporter ATP-binding protein; Pro	95.49
PRK13651	305	cobalt transporter ATP-binding subunit; Provisiona	95.49
cd03215	182	ABC_Carb_Monos_II This family represents domain II	95.49
TIGR03864	236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	95.49
PHA02530	300	pseT polynucleotide kinase; Provisional	95.48
PRK06762	166	hypothetical protein; Provisional	95.48
cd00544	169	CobU Adenosylcobinamide kinase / adenosylcobinamid	95.48
PRK09580	248	sufC cysteine desulfurase ATPase component; Review	95.48
cd04147	198	Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v	95.47
PLN03118	211	Rab family protein; Provisional	95.47
cd03244	221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	95.47
cd03260	227	ABC_PstB_phosphate_transporter Phosphate uptake is	95.46
TIGR01189	198	ccmA heme ABC exporter, ATP-binding protein CcmA.	95.46
TIGR02868	529	CydC thiol reductant ABC exporter, CydC subunit. T	95.46
cd03280	200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	95.46
cd02019	69	NK Nucleoside/nucleotide kinase (NK) is a protein	95.46
PRK13539	207	cytochrome c biogenesis protein CcmA; Provisional	95.46
PRK15177	213	Vi polysaccharide export ATP-binding protein VexC;	95.45
PRK13541	195	cytochrome c biogenesis protein CcmA; Provisional	95.44
cd03245	220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	95.44
PRK14274	259	phosphate ABC transporter ATP-binding protein; Pro	95.44
PRK00089	292	era GTPase Era; Reviewed	95.44
PRK13641	287	cbiO cobalt transporter ATP-binding subunit; Provi	95.43
PRK13646	286	cbiO cobalt transporter ATP-binding subunit; Provi	95.43
TIGR00436	270	era GTP-binding protein Era. Era is an essential G	95.42
PRK14236	272	phosphate transporter ATP-binding protein; Provisi	95.42
cd03297	214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	95.41
PRK13548	258	hmuV hemin importer ATP-binding subunit; Provision	95.41
TIGR01184	230	ntrCD nitrate transport ATP-binding subunits C and	95.4
PRK11231	255	fecE iron-dicitrate transporter ATP-binding subuni	95.39
PRK10636	638	putative ABC transporter ATP-binding protein; Prov	95.39
cd03238	176	ABC_UvrA The excision repair protein UvrA; Nucleot	95.38
cd03213	194	ABCG_EPDR ABCG transporters are involved in eye pi	95.37
PRK13538	204	cytochrome c biogenesis protein CcmA; Provisional	95.36
cd03237	246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	95.36
PRK13645	289	cbiO cobalt transporter ATP-binding subunit; Provi	95.36
PRK14248	268	phosphate ABC transporter ATP-binding protein; Pro	95.35
TIGR03005	252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	95.35
cd03279	213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	95.34
PRK04213	201	GTP-binding protein; Provisional	95.33
cd04143	247	Rhes_like Rhes_like subfamily. This subfamily incl	95.33
PRK14265	274	phosphate ABC transporter ATP-binding protein; Pro	95.33
cd03294	269	ABC_Pro_Gly_Bertaine This family comprises the gly	95.32
COG1116	248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	95.31
PRK14241	258	phosphate transporter ATP-binding protein; Provisi	95.31
PRK13649	280	cbiO cobalt transporter ATP-binding subunit; Provi	95.3
cd03298	211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	95.3
PRK14273	254	phosphate ABC transporter ATP-binding protein; Pro	95.3
PRK14261	253	phosphate ABC transporter ATP-binding protein; Pro	95.29
cd03278	197	ABC_SMC_barmotin Barmotin is a tight junction-asso	95.29
PRK09984	262	phosphonate/organophosphate ester transporter subu	95.29
PRK09493	240	glnQ glutamine ABC transporter ATP-binding protein	95.29
PF03029	238	ATP_bind_1: Conserved hypothetical ATP binding pro	95.29
PRK14240	250	phosphate transporter ATP-binding protein; Provisi	95.29
PRK13546	264	teichoic acids export protein ATP-binding subunit;	95.26
cd03220	224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	95.26
PRK14235	267	phosphate transporter ATP-binding protein; Provisi	95.26
COG1122	235	CbiO ABC-type cobalt transport system, ATPase comp	95.26
PRK11000	369	maltose/maltodextrin transporter ATP-binding prote	95.25
TIGR03740	223	galliderm_ABC gallidermin-class lantibiotic protec	95.25
cd01855	190	YqeH YqeH. YqeH is an essential GTP-binding protei	95.25
PRK10895	241	lipopolysaccharide ABC transporter ATP-binding pro	95.25
TIGR01166	190	cbiO cobalt transport protein ATP-binding subunit.	95.25
cd03217	200	ABC_FeS_Assembly ABC-type transport system involve	95.24
PRK13639	275	cbiO cobalt transporter ATP-binding subunit; Provi	95.24
PRK14267	253	phosphate ABC transporter ATP-binding protein; Pro	95.24
PRK11176	582	lipid transporter ATP-binding/permease protein; Pr	95.23
TIGR02769	265	nickel_nikE nickel import ATP-binding protein NikE	95.23
PRK00131	175	aroK shikimate kinase; Reviewed	95.22
PRK14253	249	phosphate ABC transporter ATP-binding protein; Pro	95.21
PF13191	185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	95.21
cd04128	182	Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi	95.21
PRK11607	377	potG putrescine transporter ATP-binding subunit; P	95.21
PRK09825	176	idnK D-gluconate kinase; Provisional	95.2
cd00071	137	GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.	95.2
PRK14268	258	phosphate ABC transporter ATP-binding protein; Pro	95.19
TIGR00968	237	3a0106s01 sulfate ABC transporter, ATP-binding pro	95.19
PRK10253	265	iron-enterobactin transporter ATP-binding protein;	95.18
PRK13640	282	cbiO cobalt transporter ATP-binding subunit; Provi	95.18
PLN03110	216	Rab GTPase; Provisional	95.18
cd03222	177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	95.18
PRK14262	250	phosphate ABC transporter ATP-binding protein; Pro	95.16
PRK11247	257	ssuB aliphatic sulfonates transport ATP-binding su	95.15
TIGR02524	358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	95.14
CHL00131	252	ycf16 sulfate ABC transporter protein; Validated	95.13
PRK13632	271	cbiO cobalt transporter ATP-binding subunit; Provi	95.11
cd01898	170	Obg Obg subfamily. The Obg nucleotide binding prot	95.1
PRK13648	269	cbiO cobalt transporter ATP-binding subunit; Provi	95.1
cd04131	178	Rnd Rnd subfamily. The Rnd subfamily contains Rnd1	95.1
PRK13635	279	cbiO cobalt transporter ATP-binding subunit; Provi	95.1
PRK14244	251	phosphate ABC transporter ATP-binding protein; Pro	95.1
cd03250	204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	95.1
PLN02674	244	adenylate kinase	95.1
PRK15064	530	ABC transporter ATP-binding protein; Provisional	95.1
PRK13647	274	cbiO cobalt transporter ATP-binding subunit; Provi	95.1
PRK13637	287	cbiO cobalt transporter ATP-binding subunit; Provi	95.07
PRK10762	501	D-ribose transporter ATP binding protein; Provisio	95.06
cd01897	168	NOG NOG1 is a nucleolar GTP-binding protein presen	95.06
PRK09087	226	hypothetical protein; Validated	95.05
cd04148	221	RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki	95.04
PRK10419	268	nikE nickel transporter ATP-binding protein NikE;	95.04
COG3839	338	MalK ABC-type sugar transport systems, ATPase comp	95.04
KOG2655|consensus	366		95.03
TIGR03574	249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	95.01
PRK14275	286	phosphate ABC transporter ATP-binding protein; Pro	95.01
TIGR00450	442	mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE	95.0
PLN02200	234	adenylate kinase family protein	95.0
cd04172	182	Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE	95.0
PRK15112	267	antimicrobial peptide ABC system ATP-binding prote	94.99
TIGR03269	520	met_CoM_red_A2 methyl coenzyme M reductase system,	94.99
PRK11819	556	putative ABC transporter ATP-binding protein; Revi	94.99
COG1120	258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	94.99
cd03288	257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	94.98
TIGR02788	308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.97
TIGR03238	504	dnd_assoc_3 dnd system-associated protein 3. cereu	94.97
PRK14257	329	phosphate ABC transporter ATP-binding protein; Pro	94.97
PRK13643	288	cbiO cobalt transporter ATP-binding subunit; Provi	94.95
TIGR01288	303	nodI ATP-binding ABC transporter family nodulation	94.94
PRK14252	265	phosphate ABC transporter ATP-binding protein; Pro	94.94
cd03231	201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	94.93
PRK13633	280	cobalt transporter ATP-binding subunit; Provisiona	94.92
cd03273	251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	94.92
TIGR03873	256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	94.9
PRK03695	248	vitamin B12-transporter ATPase; Provisional	94.9
PRK13547	272	hmuV hemin importer ATP-binding subunit; Provision	94.89
PRK13764	602	ATPase; Provisional	94.89
PRK05057	172	aroK shikimate kinase I; Reviewed	94.88
PRK14272	252	phosphate ABC transporter ATP-binding protein; Pro	94.88
PRK10938	490	putative molybdenum transport ATP-binding protein	94.86
cd04126	220	Rab20 Rab20 subfamily. Rab20 is one of several Rab	94.86
cd03233	202	ABC_PDR_domain1 The pleiotropic drug resistance (P	94.84
cd04102	202	RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove	94.84
PF01443	234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	94.81
TIGR03265	353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	94.81
PRK14271	276	phosphate ABC transporter ATP-binding protein; Pro	94.81
cd04162	164	Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9	94.8
COG0488	530	Uup ATPase components of ABC transporters with dup	94.8
TIGR01188	302	drrA daunorubicin resistance ABC transporter ATP-b	94.8
PRK11288	501	araG L-arabinose transporter ATP-binding protein;	94.8
cd01852	196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	94.79
COG4598	256	HisP ABC-type histidine transport system, ATPase c	94.79
cd03299	235	ABC_ModC_like Archeal protein closely related to M	94.78
PRK10619	257	histidine/lysine/arginine/ornithine transporter su	94.78
PRK13636	283	cbiO cobalt transporter ATP-binding subunit; Provi	94.78
cd02026	273	PRK Phosphoribulokinase (PRK) is an enzyme involve	94.78
PRK14254	285	phosphate ABC transporter ATP-binding protein; Pro	94.78
PF00485	194	PRK: Phosphoribulokinase / Uridine kinase family;	94.77
TIGR02782	299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.76
PRK13631	320	cbiO cobalt transporter ATP-binding subunit; Provi	94.76
PRK15134	529	microcin C ABC transporter ATP-binding protein Yej	94.76
TIGR02142	354	modC_ABC molybdenum ABC transporter, ATP-binding p	94.75
PRK15064	530	ABC transporter ATP-binding protein; Provisional	94.74
PLN03073	718	ABC transporter F family; Provisional	94.73
cd02022	179	DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2	94.71
PTZ00301	210	uridine kinase; Provisional	94.7
PRK14529	223	adenylate kinase; Provisional	94.68
PRK11144	352	modC molybdate transporter ATP-binding protein; Pr	94.66
cd03240	204	ABC_Rad50 The catalytic domains of Rad50 are simil	94.66
COG1117	253	PstB ABC-type phosphate transport system, ATPase c	94.66
PRK06893	229	DNA replication initiation factor; Validated	94.65
smart00763	361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	94.65
cd04142	198	RRP22 RRP22 subfamily. RRP22 (Ras-related protein	94.65
TIGR03719	552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	94.63
PRK08727	233	hypothetical protein; Validated	94.62
COG1136	226	SalX ABC-type antimicrobial peptide transport syst	94.61
cd03300	232	ABC_PotA_N PotA is an ABC-type transporter and the	94.61
cd03291	282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	94.6
COG5019	373	CDC3 Septin family protein [Cell division and chro	94.59
PRK04182	180	cytidylate kinase; Provisional	94.59
cd02028	179	UMPK_like Uridine monophosphate kinase_like (UMPK_	94.57
cd03114	148	ArgK-like The function of this protein family is u	94.56
PRK13947	171	shikimate kinase; Provisional	94.55
TIGR02982	220	heterocyst_DevA ABC exporter ATP-binding subunit,	94.55
PRK01184	184	hypothetical protein; Provisional	94.55
cd01857	141	HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t	94.55
TIGR01618	220	phage_P_loop phage nucleotide-binding protein. Thi	94.53
PRK11153	343	metN DL-methionine transporter ATP-binding subunit	94.5
TIGR02204	576	MsbA_rel ABC transporter, permease/ATP-binding pro	94.49
PF00009	188	GTP_EFTU: Elongation factor Tu GTP binding domain;	94.49
PF13481	193	AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C.	94.49
PRK13851	344	type IV secretion system protein VirB11; Provision	94.47
cd02027	149	APSK Adenosine 5'-phosphosulfate kinase (APSK) cat	94.47
COG2884	223	FtsE Predicted ATPase involved in cell division [C	94.44
PF00406	151	ADK: Adenylate kinase; InterPro: IPR000850 Adenyla	94.43
PF04665	241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	94.42
PRK14249	251	phosphate ABC transporter ATP-binding protein; Pro	94.4
PRK14263	261	phosphate ABC transporter ATP-binding protein; Pro	94.4
PRK10261	623	glutathione transporter ATP-binding protein; Provi	94.39
TIGR03015	269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	94.39
PRK08356	195	hypothetical protein; Provisional	94.38
PRK11819	556	putative ABC transporter ATP-binding protein; Revi	94.37
cd04133	176	Rop_like Rop subfamily. The Rop (Rho-related prote	94.37
PRK05642	234	DNA replication initiation factor; Validated	94.37
PRK11174	588	cysteine/glutathione ABC transporter membrane/ATP-	94.32
PF00437	270	T2SE: Type II/IV secretion system protein; InterPr	94.32
TIGR01186	363	proV glycine betaine/L-proline transport ATP bindi	94.3
PRK06620	214	hypothetical protein; Validated	94.3
TIGR00150	133	HI0065_YjeE ATPase, YjeE family. Members of this f	94.28
PRK10522	547	multidrug transporter membrane component/ATP-bindi	94.27
PRK05541	176	adenylylsulfate kinase; Provisional	94.25
PF01580	205	FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00	94.25
cd03284	216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	94.25
PRK10790	592	putative multidrug transporter membrane\ATP-bindin	94.25
TIGR01613	304	primase_Cterm phage/plasmid primase, P4 family, C-	94.24
COG1855	604	ATPase (PilT family) [General function prediction	94.24
cd03282	204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	94.23
cd01887	168	IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo	94.23
PRK00889	175	adenylylsulfate kinase; Provisional	94.22
cd01123	235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	94.21
COG0572	218	Udk Uridine kinase [Nucleotide transport and metab	94.21
PF13476	202	AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V	94.21
TIGR02633	500	xylG D-xylose ABC transporter, ATP-binding protein	94.18
PRK10938	490	putative molybdenum transport ATP-binding protein	94.17
PRK10261	623	glutathione transporter ATP-binding protein; Provi	94.15
PRK12339	197	2-phosphoglycerate kinase; Provisional	94.15
PRK15079	331	oligopeptide ABC transporter ATP-binding protein O	94.14

>KOG0085|consensus

Probab=99.75  E-value=7.5e-19  Score=132.23  Aligned_cols=58  Identities=31%  Similarity=0.427  Sum_probs=55.8

Q ss_pred             CCccCCHHHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcc
Q psy6625           1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus         1 MGcc~S~ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      |.||+|++++++.+.+.+|+++|+++++..+++.||||||+||||||||.+||+|+-.
T Consensus         7 ~~cclsee~ke~~ri~~eierql~rdkk~arrelkllllgtgesgkstfikqmriihg   64 (359)
T KOG0085|consen    7 MCCCLSEEEKEAARINQEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG   64 (359)
T ss_pred             hHhhCcHhHHHHHHHHHHHHHHHHHHhHhhhhhheeeeecCCCcchhhHHHHHHhhhc
Confidence            6799999999999999999999999999999999999999999999999999999864

>KOG0082|consensus

Probab=99.65  E-value=5.7e-17  Score=124.26  Aligned_cols=59  Identities=39%  Similarity=0.479  Sum_probs=55.5

Q ss_pred             CCccCCHHHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhccc
Q psy6625           1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus         1 MGcc~S~ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      |||+.|.++.++..++++||++++++++...+.+||||||+|||||||+++||.|+...
T Consensus         1 MG~~~s~e~~~~~~~~~~I~~~l~~~~~~~~~~iKlLLLGageSGKSTI~KQmkilh~~   59 (354)
T KOG0082|consen    1 MGCICSAEEKEQVKRSKEIDKQLKKEKKKEKKIIKLLLLGAGESGKSTIVKQMKILHGD   59 (354)
T ss_pred             CCcccCchhhhcchhhhhhhHHHHHHHHhhhhheeeeeecCCCCchHHHHHHHHHHhcC
Confidence            89999988888888999999999999999999999999999999999999999998765

>KOG0099|consensus

Probab=99.50  E-value=8.9e-15  Score=111.41  Aligned_cols=57  Identities=33%  Similarity=0.352  Sum_probs=51.5

Q ss_pred             CCccCCH-------HHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhc
Q psy6625           1 MGCAMSA-------EERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus         1 MGcc~S~-------ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ||||++.       +.+++.+.|+.|++++.+++..+..++||||||||||||||+++||+|.-
T Consensus         1 m~~~~~k~~~~~~~~~~~q~~~s~~i~~ql~~~k~~~~aThrlLLLGagESGKsTIvKQMRILH   64 (379)
T KOG0099|consen    1 MGCLGSKKTEDQRAEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILH   64 (379)
T ss_pred             CCcccCCChhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHhHHhheeccccccchhhhhhhheee
Confidence            7899864       25578889999999999999999999999999999999999999999853

>smart00275 G_alpha G protein alpha subunit

Probab=99.47  E-value=2.8e-14  Score=107.42  Aligned_cols=47  Identities=30%  Similarity=0.358  Sum_probs=43.4

Q ss_pred             HhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          14 ARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        14 ~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +.|++||++|++++++..+++||||||+||||||||++||+++-...
T Consensus         2 ~~~~~Id~~l~~~~~~~~~~~klLLLG~geSGKSTi~KQmril~~~g   48 (342)
T smart00275        2 RRNKEIEKQLEEERKKKKREVKLLLLGAGESGKSTILKQMRILHGDG   48 (342)
T ss_pred             cchHHHHHHHHHhHHHhhcchheeeeecCCCcchhHHHHHHHhhcCC
Confidence            46889999999999999999999999999999999999999987654

Subunit of G proteins that contains the guanine nucleotide binding site

>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []

Probab=99.31  E-value=1.9e-12  Score=97.53  Aligned_cols=52  Identities=25%  Similarity=0.316  Sum_probs=46.2

Q ss_pred             HHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625           9 ERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus         9 e~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ++++...+..|++++..+++...+.+||||||+||||||||++|+.++....
T Consensus        34 ~~~~~~~~~~~~~~l~~~~~~~~~~~kiLLLG~geSGKSTi~KQ~ril~~~~   85 (389)
T PF00503_consen   34 EKEQKKRSDDIDRQLEKDKKRSKREIKILLLGSGESGKSTILKQMRILYGPG   85 (389)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEESTTSSHHHHHHHHHHHHST-
T ss_pred             HHHHHHhhHHHHHHHHHHHHhhhccceEEEECCCCcchhhHHHHHHHHhCCC
Confidence            4456778999999999999999999999999999999999999999987654

G proteins and their receptors (GPCRs) form one of the most prevalent signalling systems in mammalian cells, regulating systems as diverse as sensory perception, cell growth and hormonal regulation []. At the cell surface, the binding of ligands such as hormones and neurotransmitters to a GPCR activates the receptor by causing a conformational change, which in turn activates the bound G protein on the intracellular-side of the membrane. The activated receptor promotes the exchange of bound GDP for GTP on the G protein alpha subunit. GTP binding changes the conformation of switch regions within the alpha subunit, which allows the bound trimeric G protein (inactive) to be released from the receptor, and to dissociate into active alpha subunit (GTP-bound) and beta/gamma dimer. The alpha subunit and the beta/gamma dimer go on to activate distinct downstream effectors, such as adenylyl cyclase, phosphodiesterases, phospholipase C, and ion channels. These effectors in turn regulate the intracellular concentrations of secondary messengers, such as cAMP, diacylglycerol, sodium or calcium cations, which ultimately lead to a physiological response, usually via the downstream regulation of gene transcription. The cycle is completed by the hydrolysis of alpha subunit-bound GTP to GDP, resulting in the re-association of the alpha and beta/gamma subunits and their binding to the receptor, which terminates the signal []. The length of the G protein signal is controlled by the duration of the GTP-bound alpha subunit, which can be regulated by RGS (regulator of G protein signalling) proteins (IPR000342 from INTERPRO) or by covalent modifications []. There are several isoforms of each subunit, many of which have splice variants, which together can make up hundreds of combinations of G proteins. The specific combination of subunits in heterotrimeric G proteins affects not only which receptor it can bind to, but also which downstream target is affected, providing the means to target specific physiological processes in response to specific external stimuli [, ]. G proteins carry lipid modifications on one or more of their subunits to target them to the plasma membrane and to contribute to protein interactions. This family consists of the G protein alpha subunit, which acts as a weak GTPase. G protein classes are defined based on the sequence and function of their alpha subunits, which in mammals fall into four main categories: G(S)alpha, G(Q)alpha, G(I)alpha and G(12)alpha; there are also fungal and plant classes of alpha subunits. The alpha subunit consists of two domains: a GTP-binding domain and a helical insertion domain (IPR011025 from INTERPRO). The GTP-binding domain is homologous to Ras-like small GTPases, and includes switch regions I and II, which change conformation during activation. The switch regions are loops of alpha-helices with conformations sensitive to guanine nucleotides. The helical insertion domain is inserted into the GTP-binding domain before switch region I and is unique to heterotrimeric G proteins. This helical insertion domain functions to sequester the guanine nucleotide at the interface with the GTP-binding domain and must be displaced to enable nucleotide dissociation.; GO: 0004871 signal transducer activity, 0019001 guanyl nucleotide binding, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 3QI2_B 3QE0_A 2IK8_A 2OM2_A 2GTP_B 2XNS_B 3ONW_B 1KJY_A 2EBC_A 1Y3A_B ....

>cd00066 G-alpha G protein alpha subunit

Probab=98.90  E-value=5.3e-10  Score=83.13  Aligned_cols=27  Identities=26%  Similarity=0.172  Sum_probs=24.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +||||||+||||||||++||+++-..+
T Consensus         1 ~klLlLG~geSGKSTi~KQmril~~~g   27 (317)
T cd00066           1 VKLLLLGAGESGKSTILKQMKILHGDG   27 (317)
T ss_pred             CeEEEecCCCccHHHHHHHHHHhcCCC
Confidence            589999999999999999999987654

The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute.

>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases

Probab=97.56  E-value=8.1e-05  Score=45.99  Aligned_cols=25  Identities=20%  Similarity=0.242  Sum_probs=21.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      |++++|...||||||++++|--...
T Consensus         1 kI~V~G~~g~GKTsLi~~l~~~~~~   25 (119)
T PF08477_consen    1 KIVVLGDSGVGKTSLIRRLCGGEFP   25 (119)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHSS--
T ss_pred             CEEEECcCCCCHHHHHHHHhcCCCc
Confidence            7899999999999999999965543

They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.

>cd04113 Rab4 Rab4 subfamily

Probab=97.36  E-value=0.00019  Score=46.27  Aligned_cols=23  Identities=9%  Similarity=0.173  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|++++|.+++|||||++++...
T Consensus         1 ~ki~v~G~~~vGKTsli~~l~~~   23 (161)
T cd04113           1 FKFIIIGSSGTGKSCLLHRFVEN   23 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhC
Confidence            58999999999999999998643

Rab4 has been implicated in numerous functions within the cell. It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A. Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane. It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p

>cd01878 HflX HflX subfamily

Probab=97.33  E-value=0.00045  Score=46.75  Aligned_cols=24  Identities=17%  Similarity=-0.050  Sum_probs=21.1

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+++++|.+.||||||++.++-
T Consensus        40 ~~~~I~iiG~~g~GKStLl~~l~~   63 (204)
T cd01878          40 GIPTVALVGYTNAGKSTLFNALTG   63 (204)
T ss_pred             CCCeEEEECCCCCCHHHHHHHHhc
Confidence            358999999999999999988763

A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily. The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear. HflX is widespread, but not universally represented in all three superkingdoms.

>TIGR00231 small_GTP small GTP-binding protein domain

Probab=97.30  E-value=0.00013  Score=44.78  Aligned_cols=24  Identities=17%  Similarity=0.218  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|++++|..+||||||+.++..-
T Consensus         1 ~~ki~~~G~~~~GKstl~~~l~~~   24 (161)
T TIGR00231         1 EIKIVIVGDPNVGKSTLLNRLLGN   24 (161)
T ss_pred             CeEEEEECCCCCCHHHHHHHHhCC
Confidence            369999999999999999988643

This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.

>PRK08118 topology modulation protein; Reviewed

Probab=97.29  E-value=0.00016  Score=49.35  Aligned_cols=27  Identities=22%  Similarity=0.261  Sum_probs=24.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ||++.|.++|||||+++.++-...-|.
T Consensus         3 rI~I~G~~GsGKSTlak~L~~~l~~~~   29 (167)
T PRK08118          3 KIILIGSGGSGKSTLARQLGEKLNIPV   29 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCCc
Confidence            789999999999999999998877663

>cd04155 Arl3 Arl3 subfamily

Probab=97.28  E-value=0.0002  Score=46.64  Aligned_cols=26  Identities=15%  Similarity=0.231  Sum_probs=23.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+|++++|..+||||||+.+++--
T Consensus        12 ~~~~~v~i~G~~g~GKStLl~~l~~~   37 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQLASE   37 (173)
T ss_pred             CCccEEEEEccCCCCHHHHHHHHhcC
Confidence            44789999999999999999999864

Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension. In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form. The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector. Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2). It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery. In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.

>cd01860 Rab5_related Rab5-related subfamily

Probab=97.26  E-value=0.00015  Score=46.55  Aligned_cols=24  Identities=25%  Similarity=0.344  Sum_probs=21.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|++++|.++||||||+++++--
T Consensus         1 ~~ki~v~G~~~~GKSsli~~l~~~   24 (163)
T cd01860           1 QFKLVLLGDSSVGKSSLVLRFVKN   24 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHcC
Confidence            479999999999999999988754

This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways. In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo

>PRK07261 topology modulation protein; Provisional

Probab=97.22  E-value=0.00022  Score=48.61  Aligned_cols=26  Identities=19%  Similarity=0.178  Sum_probs=22.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      |+++.|.++||||||++.++-...-|
T Consensus         2 ri~i~G~~GsGKSTla~~l~~~~~~~   27 (171)
T PRK07261          2 KIAIIGYSGSGKSTLARKLSQHYNCP   27 (171)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHhCCC
Confidence            78999999999999999998766544

>cd00154 Rab Rab family

Probab=97.21  E-value=0.00042  Score=43.10  Aligned_cols=24  Identities=17%  Similarity=0.239  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +|++++|..+||||||+.+++--.
T Consensus         1 ~~i~~~G~~~~GKStl~~~l~~~~   24 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLRFVDGK   24 (159)
T ss_pred             CeEEEECCCCCCHHHHHHHHHhCc
Confidence            589999999999999999886443

Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide di

>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]

Probab=97.18  E-value=0.00018  Score=50.12  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ||++||+++|||||+++.+.-.
T Consensus         2 riiilG~pGaGK~T~A~~La~~   23 (178)
T COG0563           2 RILILGPPGAGKSTLAKKLAKK   23 (178)
T ss_pred             eEEEECCCCCCHHHHHHHHHHH
Confidence            7899999999999999987654

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A

Probab=97.15  E-value=0.0002  Score=44.64  Aligned_cols=27  Identities=15%  Similarity=0.138  Sum_probs=22.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .+++-|.++|||||+++.++--..-|.
T Consensus         1 vI~I~G~~gsGKST~a~~La~~~~~~~   27 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKELAERLGFPV   27 (121)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHTCEE
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCeE
Confidence            378999999999999999987665543

...

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily

Probab=97.09  E-value=0.00028  Score=44.72  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=20.7

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++++|...+|||||+++++.
T Consensus         1 ~~ki~iiG~~~vGKTsl~~~~~~   23 (162)
T cd04138           1 EYKLVVVGAGGVGKSALTIQLIQ   23 (162)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHh
Confidence            36899999999999999999874

H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family. These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation. Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers. Many Ras guanine nucleotide exchange factors (GEFs) have been identified. They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities. Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.

>cd04123 Rab21 Rab21 subfamily

Probab=97.08  E-value=0.00028  Score=44.67  Aligned_cols=23  Identities=26%  Similarity=0.271  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|++++|.+++|||||+.+++-.
T Consensus         1 ~ki~i~G~~~~GKStli~~l~~~   23 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLRYVEN   23 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhC
Confidence            58999999999999999988753

The localization and function of Rab21 are not clearly defined, with conflicting data reported. Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker. More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site

>smart00175 RAB Rab subfamily of small GTPases

Probab=97.08  E-value=0.00029  Score=44.99  Aligned_cols=22  Identities=14%  Similarity=0.179  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|..+||||||++++.-
T Consensus         1 ~kv~v~G~~~~GKTtli~~l~~   22 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSRFTD   22 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            5899999999999999999864

Rab GTPases are implicated in vesicle trafficking.

>cd00157 Rho Rho (Ras homology) family

Probab=97.02  E-value=0.00035  Score=45.02  Aligned_cols=23  Identities=17%  Similarity=0.278  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|++++|...||||||+++++.-
T Consensus         1 iki~i~G~~~~GKSsli~~l~~~   23 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLISYTTG   23 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhC
Confidence            58999999999999999998743

Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop. There are 22 human Rho family members identified currently. These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli. They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase. These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors). Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho protein

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse

Probab=97.02  E-value=0.00032  Score=43.79  Aligned_cols=21  Identities=14%  Similarity=0.112  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      +++++|...+|||||+.+++-
T Consensus         1 ~V~iiG~~~~GKSTlin~l~~   21 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINALTG   21 (116)
T ss_dssp             EEEEEESTTSSHHHHHHHHHT
T ss_pred             CEEEECCCCCCHHHHHHHHhc
Confidence            579999999999999999984

These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....

>cd01862 Rab7 Rab7 subfamily

Probab=97.01  E-value=0.00034  Score=45.08  Aligned_cols=21  Identities=14%  Similarity=0.192  Sum_probs=19.1

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|.++||||||+.++-
T Consensus         1 ~ki~viG~~~~GKSsl~~~l~   21 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQYV   21 (172)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            489999999999999998874

Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway. The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion. Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-

>smart00173 RAS Ras subfamily of RAS small GTPases

Probab=97.00  E-value=0.00037  Score=44.87  Aligned_cols=22  Identities=18%  Similarity=0.230  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.++||||||+++++-
T Consensus         1 ~ki~v~G~~~~GKTsli~~~~~   22 (164)
T smart00173        1 YKLVVLGSGGVGKSALTIQFVQ   22 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            4899999999999999998873

Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors to protein kinase cascades

>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily

Probab=96.97  E-value=0.00043  Score=45.52  Aligned_cols=25  Identities=12%  Similarity=0.394  Sum_probs=22.1

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +.+|++++|.+++|||||+.+++.-
T Consensus         1 r~~ki~vvG~~~vGKTsli~~~~~~   25 (170)
T cd04115           1 RIFKIIVIGDSNVGKTCLTYRFCAG   25 (170)
T ss_pred             CceEEEEECCCCCCHHHHHHHHHhC
Confidence            4689999999999999999998653

Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine

>cd04119 RJL RJL (RabJ-Like) subfamily

Probab=96.96  E-value=0.00042  Score=44.14  Aligned_cols=22  Identities=18%  Similarity=0.255  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+++|||||+.++|.
T Consensus         1 ~ki~~vG~~~vGKTsli~~l~~   22 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKRYCE   22 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            5899999999999999999885

RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa. RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.

>PF13479 AAA_24: AAA domain

Probab=96.95  E-value=0.00061  Score=47.78  Aligned_cols=29  Identities=34%  Similarity=0.519  Sum_probs=26.6

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcccceeee
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTSKPMMIN   64 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~~~~~~~   64 (76)
                      +.+|+|+.|.++||||||+..+    .+|++|+
T Consensus         2 ~~~~~lIyG~~G~GKTt~a~~~----~k~l~id   30 (213)
T PF13479_consen    2 KPIKILIYGPPGSGKTTLAASL----PKPLFID   30 (213)
T ss_pred             CceEEEEECCCCCCHHHHHHhC----CCeEEEE
Confidence            4589999999999999999998    8999986

>cd04139 RalA_RalB RalA/RalB subfamily

Probab=96.94  E-value=0.00046  Score=43.93  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|+.++|.++||||||+.+++.
T Consensus         1 ~ki~~~G~~~~GKTsl~~~l~~   22 (164)
T cd04139           1 YKVIVVGAGGVGKSALTLQFMY   22 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            4899999999999999999875

The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB. Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics. Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration. In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it. A Ral-specific set of GEFs has been identified that are activated by Ras binding. This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K). Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis. In rat kidney cells, RalB is required for functional assembly of the exo

>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily

Probab=96.93  E-value=0.00045  Score=44.76  Aligned_cols=23  Identities=26%  Similarity=0.265  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+++|||||+.+++.
T Consensus         2 ~~ki~i~G~~~vGKSsli~~~~~   24 (166)
T cd01869           2 LFKLLLIGDSGVGKSCLLLRFAD   24 (166)
T ss_pred             eEEEEEECCCCCCHHHHHHHHhc
Confidence            37999999999999999998864

Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

>PRK06217 hypothetical protein; Validated

Probab=96.92  E-value=0.00064  Score=46.21  Aligned_cols=28  Identities=18%  Similarity=0.192  Sum_probs=24.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .||++.|.++|||||+.+++.-...-|.
T Consensus         2 ~~I~i~G~~GsGKSTla~~L~~~l~~~~   29 (183)
T PRK06217          2 MRIHITGASGSGTTTLGAALAERLDIPH   29 (183)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHcCCcE
Confidence            3699999999999999999988776663

>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases

Probab=96.91  E-value=0.00046  Score=46.62  Aligned_cols=25  Identities=32%  Similarity=0.259  Sum_probs=23.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+++|+|+||-..|||||++..+..
T Consensus        12 ~~~~~ililGl~~sGKTtll~~l~~   36 (175)
T PF00025_consen   12 KKEIKILILGLDGSGKTTLLNRLKN   36 (175)
T ss_dssp             TSEEEEEEEESTTSSHHHHHHHHHS
T ss_pred             CcEEEEEEECCCccchHHHHHHhhh
Confidence            6789999999999999999999874

This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including: Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other. The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....

>cd04154 Arl2 Arl2 subfamily

Probab=96.91  E-value=0.00062  Score=44.87  Aligned_cols=25  Identities=16%  Similarity=0.260  Sum_probs=21.8

Q ss_pred             hhCccceeeccCCCccchhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....+|++++|.++|||||++.++.
T Consensus        11 ~~~~~kv~ivG~~~~GKTsL~~~l~   35 (173)
T cd04154          11 KEREMRILILGLDNAGKTTILKKLL   35 (173)
T ss_pred             CCCccEEEEECCCCCCHHHHHHHHc
Confidence            3457899999999999999998875

Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity. Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix. The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI. Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different. In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport. In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.

>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases

Probab=96.91  E-value=0.00045  Score=44.38  Aligned_cols=22  Identities=14%  Similarity=0.116  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      |++++|.++||||||+..++--
T Consensus         1 Ki~vvG~~~vGKtsl~~~~~~~   22 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINRLING   22 (162)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHS
T ss_pred             CEEEECCCCCCHHHHHHHHHhh
Confidence            7999999999999999988754

This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including: Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....

>KOG0074|consensus

Probab=96.89  E-value=0.00065  Score=48.40  Aligned_cols=30  Identities=20%  Similarity=0.142  Sum_probs=25.3

Q ss_pred             HhHHhhhCccceeeccCCCccchhhhhhhh
Q psy6625          25 EDGIQAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        25 kekk~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .-+....+++||||||-+..||+|||+++-
T Consensus         9 ~~ks~t~rEirilllGldnAGKTT~LKqL~   38 (185)
T KOG0074|consen    9 CCKSRTRREIRILLLGLDNAGKTTFLKQLK   38 (185)
T ss_pred             HhcCCCcceEEEEEEecCCCcchhHHHHHc
Confidence            334445789999999999999999999984

>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes

Probab=96.87  E-value=0.00057  Score=42.93  Aligned_cols=22  Identities=23%  Similarity=0.212  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++|+|..++|||||+.+++-
T Consensus         2 ~~i~l~G~~~~GKstli~~l~~   23 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNALAG   23 (157)
T ss_pred             cEEEEECCCCCCHHHHHHHHHC
Confidence            4899999999999999999874

It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes. TrmE contains a GTPase domain that forms a canonical Ras-like fold. It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue. In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.

>cd04135 Tc10 TC10 subfamily

Probab=96.86  E-value=0.00058  Score=44.46  Aligned_cols=22  Identities=9%  Similarity=0.209  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+++.+.
T Consensus         1 ~ki~i~G~~~~GKTsl~~~~~~   22 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMSYAN   22 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            5899999999999999988874

TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro. Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration. TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins. GTP-bound TC10 in vitro can bind numerous potential effectors. Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes. TC10 mRNAs are highly expressed in three types of mouse muscle tissues: leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns. TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti

>cd00879 Sar1 Sar1 subfamily

Probab=96.86  E-value=0.00061  Score=45.28  Aligned_cols=26  Identities=23%  Similarity=0.170  Sum_probs=22.9

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+..|++++|.+.|||||++.+++.
T Consensus        16 ~~~~~ki~ilG~~~~GKStLi~~l~~   41 (190)
T cd00879          16 YNKEAKILFLGLDNAGKTTLLHMLKD   41 (190)
T ss_pred             ccCCCEEEEECCCCCCHHHHHHHHhc
Confidence            34679999999999999999998875

Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER. The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER. Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12. Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification. Instead, Sar1 contains a unique nine-amino-acid N-terminal extension. This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif. The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.

>cd04163 Era Era subfamily

Probab=96.85  E-value=0.00061  Score=42.58  Aligned_cols=22  Identities=14%  Similarity=-0.040  Sum_probs=19.9

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..++.++|..+||||||+++++
T Consensus         3 ~~~i~~~G~~g~GKttl~~~l~   24 (168)
T cd04163           3 SGFVAIVGRPNVGKSTLLNALV   24 (168)
T ss_pred             eeEEEEECCCCCCHHHHHHHHh
Confidence            4689999999999999999875

Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.

>cd01892 Miro2 Miro2 subfamily

Probab=96.82  E-value=0.00059  Score=45.35  Aligned_cols=25  Identities=16%  Similarity=-0.000  Sum_probs=22.7

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++.+|++++|.+.+|||+|+.+.+.
T Consensus         2 ~~~~kv~~vG~~~vGKTsli~~~~~   26 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRAFLG   26 (169)
T ss_pred             CeEEEEEEECCCCCcHHHHHHHHhC
Confidence            4678999999999999999999875

Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the putative GTPase domain in the C terminus of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.

>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]

Probab=96.81  E-value=0.0006  Score=46.14  Aligned_cols=24  Identities=17%  Similarity=0.177  Sum_probs=21.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|++++|.+.+|||||+.++.--
T Consensus         5 ~~kivv~G~~g~GKTtl~~~l~~~   28 (219)
T COG1100           5 EFKIVVLGDGGVGKTTLLNRLVGD   28 (219)
T ss_pred             eEEEEEEcCCCccHHHHHHHHhcC
Confidence            389999999999999999998743

>cd01895 EngA2 EngA2 subfamily

Probab=96.81  E-value=0.00074  Score=42.84  Aligned_cols=23  Identities=17%  Similarity=0.147  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++++++|..+||||||+.+++-
T Consensus         2 ~~~i~i~G~~~~GKstli~~l~~   24 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNALLG   24 (174)
T ss_pred             CcEEEEEcCCCCCHHHHHHHHhC
Confidence            46899999999999999999854

This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains. Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.

>cd04136 Rap_like Rap-like subfamily

Probab=96.80  E-value=0.00072  Score=43.23  Aligned_cols=23  Identities=13%  Similarity=0.213  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++++|..++||||++.+++.
T Consensus         1 ~~ki~i~G~~~vGKTsl~~~~~~   23 (163)
T cd04136           1 EYKVVVLGSGGVGKSALTVQFVQ   23 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHh
Confidence            36999999999999999998874

The Rap subfamily consists of the Rap1, Rap2, and RSR1. Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines. Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands. In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres.

>cd04106 Rab23_lke Rab23-like subfamily

Probab=96.79  E-value=0.0007  Score=43.35  Aligned_cols=22  Identities=14%  Similarity=0.154  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...+|||||+.+++.
T Consensus         1 ~kv~~vG~~~~GKTsl~~~~~~   22 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQRFVK   22 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            5899999999999999999885

Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily

Probab=96.79  E-value=0.0017  Score=42.11  Aligned_cols=21  Identities=19%  Similarity=0.170  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|.+.+|||||+.+++.
T Consensus         1 ki~vvG~~~~GKtsli~~~~~   21 (165)
T cd04146           1 KIAVLGASGVGKSALVVRFLT   21 (165)
T ss_pred             CEEEECCCCCcHHHHHHHHHh
Confidence            689999999999999988764

RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively. RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis. Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression. In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo. RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors. Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm. Both are believed to have tu

>cd00876 Ras Ras family

Probab=96.79  E-value=0.0007  Score=42.78  Aligned_cols=21  Identities=14%  Similarity=0.211  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|...||||||+.++.-
T Consensus         1 ki~i~G~~~~GKTsli~~l~~   21 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQFVK   21 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHh
Confidence            789999999999999998863

The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins. Ras proteins regulate cell growth, proliferation and differentiation. Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding. Many RasGEFs have been identified. These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of m

>PF13555 AAA_29: P-loop containing region of AAA domain

Probab=96.79  E-value=0.00076  Score=40.57  Aligned_cols=22  Identities=23%  Similarity=0.033  Sum_probs=19.9

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      .|+.|..+|||||++-|++++-
T Consensus        26 tli~G~nGsGKSTllDAi~~~L   47 (62)
T PF13555_consen   26 TLITGPNGSGKSTLLDAIQTVL   47 (62)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            6899999999999999998764

>cd01864 Rab19 Rab19 subfamily

Probab=96.74  E-value=0.00083  Score=43.59  Aligned_cols=23  Identities=13%  Similarity=0.189  Sum_probs=20.7

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..|++++|.++||||||+.++..
T Consensus         3 ~~kv~vvG~~~~GKTsli~~l~~   25 (165)
T cd01864           3 LFKIILIGDSNVGKTCVVQRFKS   25 (165)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhh
Confidence            57999999999999999998853

Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd01868 Rab11_like Rab11-like

Probab=96.73  E-value=0.00083  Score=43.36  Aligned_cols=22  Identities=14%  Similarity=0.086  Sum_probs=20.4

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+|++++|.+.||||||+++++
T Consensus         3 ~~ki~vvG~~~~GKSsli~~l~   24 (165)
T cd01868           3 LFKIVLIGDSGVGKSNLLSRFT   24 (165)
T ss_pred             ceEEEEECCCCCCHHHHHHHHh
Confidence            4799999999999999999986

Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems

Probab=96.73  E-value=0.00075  Score=42.88  Aligned_cols=24  Identities=17%  Similarity=-0.007  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.++|..+||||||+++++-..
T Consensus        12 ~~~~i~G~nGsGKStLl~~l~g~~   35 (137)
T PF00005_consen   12 EIVAIVGPNGSGKSTLLKALAGLL   35 (137)
T ss_dssp             SEEEEEESTTSSHHHHHHHHTTSS
T ss_pred             CEEEEEccCCCccccceeeecccc
Confidence            367899999999999999988664

ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain []. The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ]. The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....

>cd04175 Rap1 Rap1 subgroup

Probab=96.72  E-value=0.00088  Score=43.33  Aligned_cols=23  Identities=17%  Similarity=0.245  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++++|..++||||++..++.
T Consensus         1 ~~ki~~~G~~~~GKTsli~~~~~   23 (164)
T cd04175           1 EYKLVVLGSGGVGKSALTVQFVQ   23 (164)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHh
Confidence            47999999999999999999873

The Rap1 subgroup is part of the Rap subfamily of the Ras family. It can be further divided into the Rap1a and Rap1b isoforms. In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively. Rap1a is sometimes called smg p21 or Krev1 in the older literature. Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. High expression of Rap1 has been observed in the n

>cd04150 Arf1_5_like Arf1-Arf5-like subfamily

Probab=96.71  E-value=0.00087  Score=44.01  Aligned_cols=22  Identities=14%  Similarity=0.191  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.++|||||++..+..
T Consensus         1 ~kv~~~G~~~~GKTsli~~l~~   22 (159)
T cd04150           1 MRILMVGLDAAGKTTILYKLKL   22 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            5899999999999999998853

This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

>cd01861 Rab6 Rab6 subfamily

Probab=96.70  E-value=0.00091  Score=42.77  Aligned_cols=23  Identities=17%  Similarity=0.144  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|++++|.++|||||++.++...
T Consensus         1 ~ki~liG~~~~GKSsli~~l~~~   23 (161)
T cd01861           1 HKLVFLGDQSVGKTSIITRFMYD   23 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcC
Confidence            48999999999999999987643

Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate

>cd04132 Rho4_like Rho4-like subfamily

Probab=96.69  E-value=0.00092  Score=44.31  Aligned_cols=21  Identities=10%  Similarity=0.151  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|..++|||||+++++
T Consensus         1 ~ki~vvG~~~vGKTsli~~l~   21 (187)
T cd04132           1 KKIVVVGDGGCGKTCLLIVYS   21 (187)
T ss_pred             CeEEEECCCCCCHHHHHHHHH
Confidence            489999999999999999987

Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis. Rho4 also plays a role in cell morphogenesis. Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules. The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP. In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>cd01863 Rab18 Rab18 subfamily

Probab=96.67  E-value=0.00096  Score=42.78  Aligned_cols=22  Identities=23%  Similarity=0.317  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...||||||+.++..
T Consensus         1 ~ki~v~G~~~~GKSsli~~l~~   22 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFTD   22 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHc
Confidence            5899999999999999988864

Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex. In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos

>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily

Probab=96.67  E-value=0.001  Score=42.53  Aligned_cols=22  Identities=14%  Similarity=0.166  Sum_probs=19.9

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+|++++|.+.+||||++.+.+
T Consensus         2 ~~ki~i~G~~~~GKtsl~~~~~   23 (164)
T cd04145           2 TYKLVVVGGGGVGKSALTIQFI   23 (164)
T ss_pred             ceEEEEECCCCCcHHHHHHHHH
Confidence            4799999999999999998865

This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells. It interacts with some of the known Ras effectors, but appears to also have its own effectors. Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts. Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum. In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras. TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali

>PLN03108 Rab family protein; Provisional

Probab=96.63  E-value=0.0028  Score=43.85  Aligned_cols=25  Identities=12%  Similarity=0.125  Sum_probs=22.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+|++++|...+|||||+..++.-
T Consensus         5 ~~~kivivG~~gvGKStLi~~l~~~   29 (210)
T PLN03108          5 YLFKYIIIGDTGVGKSCLLLQFTDK   29 (210)
T ss_pred             cceEEEEECCCCCCHHHHHHHHHhC
Confidence            4589999999999999999998743

>cd04129 Rho2 Rho2 subfamily

Probab=96.61  E-value=0.0024  Score=42.98  Aligned_cols=21  Identities=14%  Similarity=0.156  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      .|+.++|..++|||||++++.
T Consensus         2 ~Ki~ivG~~g~GKStLl~~l~   22 (187)
T cd04129           2 RKLVIVGDGACGKTSLLSVFT   22 (187)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            489999999999999999987

Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction. Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase. Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall. Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for proper intracellular localization via membrane attachment. As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).

>cd04101 RabL4 RabL4 (Rab-like4) subfamily

Probab=96.60  E-value=0.0011  Score=42.55  Aligned_cols=22  Identities=5%  Similarity=0.090  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|+.++|.++||||||++++.-
T Consensus         1 ~ki~vvG~~~~GKtsl~~~l~~   22 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQMFHS   22 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            4899999999999999998763

RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like. As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus. The specific function of RabL4 remains unknown.

>cd04140 ARHI_like ARHI subfamily

Probab=96.60  E-value=0.0012  Score=43.13  Aligned_cols=22  Identities=9%  Similarity=0.116  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+++++.
T Consensus         2 ~kv~~vG~~~vGKTsli~~~~~   23 (165)
T cd04140           2 YRVVVFGAGGVGKSSLVLRFVK   23 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHHh
Confidence            6899999999999999999874

ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to

>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2

Probab=96.59  E-value=0.0012  Score=43.22  Aligned_cols=24  Identities=25%  Similarity=0.247  Sum_probs=21.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|++++|.+++|||||+.+++.-
T Consensus         3 ~~ki~vvG~~~~GKSsl~~~~~~~   26 (167)
T cd01867           3 LFKLLLIGDSGVGKSCLLLRFSED   26 (167)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhhC
Confidence            589999999999999999998754

Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhi

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component

Probab=96.59  E-value=0.0022  Score=44.01  Aligned_cols=32  Identities=22%  Similarity=0.147  Sum_probs=24.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-.   ++--+.+|+.
T Consensus        27 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   61 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRILATLTPPSSGTIRIDGQ   61 (211)
T ss_pred             cEEEECCCCCCHHHHHHHHhCCCCCCccEEEECCC
Confidence            7899999999999999999843   3334555553

The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd01865 Rab3 Rab3 subfamily

Probab=96.58  E-value=0.0011  Score=43.16  Aligned_cols=22  Identities=18%  Similarity=0.243  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|..++|||||+..+..
T Consensus         2 ~ki~i~G~~~~GKSsli~~l~~   23 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFRYAD   23 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhc
Confidence            6999999999999999998753

The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D. All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression. Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules. Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot

>cd04177 RSR1 RSR1 subgroup

Probab=96.57  E-value=0.0012  Score=43.11  Aligned_cols=22  Identities=18%  Similarity=0.265  Sum_probs=20.1

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ++|++++|.+.|||||++++++
T Consensus         1 ~~ki~liG~~~~GKTsli~~~~   22 (168)
T cd04177           1 DYKIVVLGAGGVGKSALTVQFV   22 (168)
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            4789999999999999999976

RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)

Probab=96.56  E-value=0.0013  Score=44.02  Aligned_cols=26  Identities=27%  Similarity=0.285  Sum_probs=21.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|+++|..+|||||+.+.++-...-+
T Consensus         1 ~I~i~G~pGsGKst~a~~La~~~~~~   26 (194)
T cd01428           1 RILLLGPPGSGKGTQAERLAKKYGLP   26 (194)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHcCCe
Confidence            58999999999999999987654443

This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B

Probab=96.56  E-value=0.0011  Score=42.14  Aligned_cols=19  Identities=21%  Similarity=0.163  Sum_probs=17.0

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      +++.|..+||||||++++-
T Consensus         2 ii~~G~pgsGKSt~a~~l~   20 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKRLA   20 (143)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            5789999999999999864

...

>PTZ00133 ADP-ribosylation factor; Provisional

Probab=96.56  E-value=0.0013  Score=44.47  Aligned_cols=25  Identities=16%  Similarity=0.250  Sum_probs=21.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+.|||||++.++..
T Consensus        15 ~~~~kv~lvG~~~vGKTsli~~~~~   39 (182)
T PTZ00133         15 KKEVRILMVGLDAAGKTTILYKLKL   39 (182)
T ss_pred             CCccEEEEEcCCCCCHHHHHHHHhc
Confidence            3568999999999999999998853

>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases

Probab=96.55  E-value=0.0013  Score=42.21  Aligned_cols=23  Identities=17%  Similarity=0.119  Sum_probs=20.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      |+.++|..+||||||+.+++...
T Consensus         1 ki~iiG~~~~GKssli~~~~~~~   23 (158)
T cd00878           1 RILILGLDGAGKTTILYKLKLGE   23 (158)
T ss_pred             CEEEEcCCCCCHHHHHHHHhcCC
Confidence            78999999999999999998664

Arf proteins are activators of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. Arfs are N-terminally myristoylated. Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner. They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site. Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins. Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus. Most other Arf family proteins are so far relatively poorly characterized. Thu

>cd04114 Rab30 Rab30 subfamily

Probab=96.54  E-value=0.0011  Score=42.87  Aligned_cols=24  Identities=13%  Similarity=0.055  Sum_probs=21.4

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....|++++|.+.+|||||+.++.
T Consensus         5 ~~~~~v~v~G~~~~GKSsli~~l~   28 (169)
T cd04114           5 DFLFKIVLIGNAGVGKTCLVRRFT   28 (169)
T ss_pred             CceeEEEEECCCCCCHHHHHHHHH
Confidence            346899999999999999999985

Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts)

Probab=96.53  E-value=0.0033  Score=45.76  Aligned_cols=29  Identities=10%  Similarity=0.080  Sum_probs=24.7

Q ss_pred             hHHhhhCccceeeccCCCccchhhhhhhh
Q psy6625          26 DGIQAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        26 ekk~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .++......+|+|+|-.++|||||+.++-
T Consensus        24 ~~~~~~~~~~IllvG~tGvGKSSliNaLl   52 (249)
T cd01853          24 GKEELDFSLTILVLGKTGVGKSSTINSIF   52 (249)
T ss_pred             hhhhccCCeEEEEECCCCCcHHHHHHHHh
Confidence            34556678999999999999999999865

This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90. The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex. The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle. Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein. Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic. Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.

>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily

Probab=96.53  E-value=0.0014  Score=43.50  Aligned_cols=24  Identities=13%  Similarity=0.171  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...|++++|.+.+|||||+.+++.
T Consensus        14 ~~~kv~~~G~~~~GKTsl~~~l~~   37 (174)
T cd04153          14 KEYKVIIVGLDNAGKTTILYQFLL   37 (174)
T ss_pred             CccEEEEECCCCCCHHHHHHHHcc
Confidence            468999999999999999999875

Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus. Arl5 is developmentally regulated during embryogenesis in mice. Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion. Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library. It is found in brain, heart, lung, cartilage, and kidney. No function has been assigned for Arl8 to date.

>cd04124 RabL2 RabL2 subfamily

Probab=96.53  E-value=0.0016  Score=42.48  Aligned_cols=23  Identities=17%  Similarity=0.234  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|++++|.+++|||||+..++.-
T Consensus         1 ~ki~vvG~~~vGKTsli~~~~~~   23 (161)
T cd04124           1 VKIILLGDSAVGKSKLVERFLMD   23 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhC
Confidence            58999999999999999987643

RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b

>cd04112 Rab26 Rab26 subfamily

Probab=96.51  E-value=0.0014  Score=44.27  Aligned_cols=22  Identities=18%  Similarity=0.233  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...||||||+.+++.
T Consensus         1 ~Ki~vvG~~~vGKTSli~~~~~   22 (191)
T cd04112           1 FKVMLLGDSGVGKTCLLVRFKD   22 (191)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            5899999999999999987754

First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation. Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []

Probab=96.51  E-value=0.0012  Score=48.97  Aligned_cols=24  Identities=13%  Similarity=0.178  Sum_probs=21.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+||+.|..++|||||+.++|-.
T Consensus         4 ~fnImVvG~sG~GKTTFIntL~~~   27 (281)
T PF00735_consen    4 NFNIMVVGESGLGKTTFINTLFNS   27 (281)
T ss_dssp             EEEEEEEECTTSSHHHHHHHHHTS
T ss_pred             eEEEEEECCCCCCHHHHHHHHHhc
Confidence            468999999999999999999964

Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily

Probab=96.51  E-value=0.0014  Score=44.51  Aligned_cols=22  Identities=14%  Similarity=0.190  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+++++.
T Consensus         1 ~KivivG~~~vGKTsli~~l~~   22 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKRYVH   22 (201)
T ss_pred             CEEEEECCCCCCHHHHHHHHHc
Confidence            5899999999999999999875

Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd04176 Rap2 Rap2 subgroup

Probab=96.50  E-value=0.0015  Score=42.11  Aligned_cols=24  Identities=13%  Similarity=0.210  Sum_probs=20.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|++++|.+++|||||+...+.-
T Consensus         1 ~~ki~i~G~~~vGKTsl~~~~~~~   24 (163)
T cd04176           1 EYKVVVLGSGGVGKSALTVQFVSG   24 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHcC
Confidence            479999999999999999777653

The Rap2 subgroup is part of the Rap subfamily of the Ras family. It consists of Rap2a, Rap2b, and Rap2c. Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton. In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments. In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway. The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis. Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation. A number of additional effector proteins for Rap2 have been identified, incl

>PF05729 NACHT: NACHT domain

Probab=96.50  E-value=0.0015  Score=41.66  Aligned_cols=22  Identities=23%  Similarity=0.075  Sum_probs=18.8

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|.++|||||+++.++---
T Consensus         3 l~I~G~~G~GKStll~~~~~~~   24 (166)
T PF05729_consen    3 LWISGEPGSGKSTLLRKLAQQL   24 (166)
T ss_pred             EEEECCCCCChHHHHHHHHHHH
Confidence            5889999999999999887543

>PLN00223 ADP-ribosylation factor; Provisional

Probab=96.50  E-value=0.0015  Score=44.20  Aligned_cols=25  Identities=16%  Similarity=0.242  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+++|++++|.+.|||||++..++.
T Consensus        15 ~~~~ki~ivG~~~~GKTsl~~~l~~   39 (181)
T PLN00223         15 KKEMRILMVGLDAAGKTTILYKLKL   39 (181)
T ss_pred             CCccEEEEECCCCCCHHHHHHHHcc
Confidence            4578999999999999999998874

>cd04122 Rab14 Rab14 subfamily

Probab=96.50  E-value=0.0014  Score=42.61  Aligned_cols=22  Identities=9%  Similarity=0.167  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||+|+.+++.
T Consensus         3 ~ki~iiG~~~vGKTsli~~~~~   24 (166)
T cd04122           3 FKYIIIGDMGVGKSCLLHQFTE   24 (166)
T ss_pred             eEEEEECCCCCCHHHHHHHHhc
Confidence            6999999999999999999873

Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GT

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=96.47  E-value=0.003  Score=43.22  Aligned_cols=42  Identities=19%  Similarity=0.272  Sum_probs=29.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCcee-------EEeeeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV-------EIGVLVQ   75 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~-------~~~~~~~   75 (76)
                      -.+.|+|..+|||||+++.++-..   +--+.+++..+       .||++.|
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~~~~~~~~~~~i~~~~q   78 (205)
T cd03226          27 EIIALTGKNGAGKTTLAKILAGLIKESSGSILLNGKPIKAKERRKSIGYVMQ   78 (205)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCCCCceEEEECCEEhhhHHhhcceEEEec
Confidence            367899999999999999998653   22245555443       3566554

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>cd04160 Arfrp1 Arfrp1 subfamily

Probab=96.46  E-value=0.0015  Score=42.11  Aligned_cols=21  Identities=24%  Similarity=0.126  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      +++++|...+||||++.+++.
T Consensus         1 ~i~~vG~~~~GKstLi~~l~~   21 (167)
T cd04160           1 SVLILGLDNAGKTTFLEQLKT   21 (167)
T ss_pred             CEEEEecCCCCHHHHHHHHhh
Confidence            579999999999999999864

Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family

Probab=96.46  E-value=0.0015  Score=43.54  Aligned_cols=23  Identities=13%  Similarity=0.109  Sum_probs=19.6

Q ss_pred             eeeccCCCccchhhhhhhhhhcc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~   58 (76)
                      ++++|.++|||||+.+.++--..
T Consensus         2 i~i~G~pGsGKst~a~~la~~~~   24 (183)
T TIGR01359         2 VFVLGGPGSGKGTQCAKIVENFG   24 (183)
T ss_pred             EEEECCCCCCHHHHHHHHHHHcC
Confidence            68999999999999998876544

This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.

>TIGR01351 adk adenylate kinases

Probab=96.46  E-value=0.0015  Score=45.21  Aligned_cols=25  Identities=20%  Similarity=0.173  Sum_probs=20.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      ||+++|.++|||||+.+.++--..-
T Consensus         1 rI~i~G~pGsGKsT~a~~La~~~g~   25 (210)
T TIGR01351         1 RLVLLGPPGSGKGTQAKRIAEKYGL   25 (210)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHcCC
Confidence            5899999999999999998754443

Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds

Probab=96.45  E-value=0.003  Score=43.49  Aligned_cols=32  Identities=25%  Similarity=0.142  Sum_probs=24.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++=.   ++--+.+++.
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   64 (220)
T cd03263          30 IFGLLGHNGAGKTTTLKMLTGELRPTSGTAYINGY   64 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCcEEEECCE
Confidence            5789999999999999999854   3333455543

Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders. The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis. The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle. The ABCA genes are not present in yeast. However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport

Probab=96.44  E-value=0.0026  Score=39.37  Aligned_cols=27  Identities=22%  Similarity=0.231  Sum_probs=23.8

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      |||.|..++||||+++.++-....|.+
T Consensus         1 ill~G~~G~GKT~l~~~la~~l~~~~~   27 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALAQYLGFPFI   27 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHHHHTTSEEE
T ss_pred             CEEECcCCCCeeHHHHHHHhhcccccc
Confidence            689999999999999999988876653

Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....

>cd04116 Rab9 Rab9 subfamily

Probab=96.41  E-value=0.0017  Score=42.14  Aligned_cols=24  Identities=21%  Similarity=0.120  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|.+.||||||+.+++.
T Consensus         4 ~~~ki~vvG~~~~GKTsli~~~~~   27 (170)
T cd04116           4 SLLKVILLGDGGVGKSSLMNRYVT   27 (170)
T ss_pred             eEEEEEEECCCCCCHHHHHHHHHc
Confidence            358999999999999999998863

Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47). Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs. Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin

Probab=96.39  E-value=0.0031  Score=43.59  Aligned_cols=33  Identities=18%  Similarity=0.079  Sum_probs=24.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++..
T Consensus        28 ~~~i~G~nGsGKSTLl~~i~G~~~~~~G~i~~~g~~   63 (220)
T cd03265          28 IFGLLGPNGAGKTTTIKMLTTLLKPTSGRATVAGHD   63 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECCEe
Confidence            57899999999999999998542   3335565543

In addition to DrrA, the complex includes an integral membrane protein called DrrB. DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called P-glycoprotein. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK03839 putative kinase; Provisional

Probab=96.37  E-value=0.0024  Score=42.86  Aligned_cols=27  Identities=11%  Similarity=-0.030  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +|+|.|..+|||||+.+.++-...-|.
T Consensus         2 ~I~l~G~pGsGKsT~~~~La~~~~~~~   28 (180)
T PRK03839          2 IIAITGTPGVGKTTVSKLLAEKLGYEY   28 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCcE
Confidence            589999999999999999987766554

>cd04158 ARD1 ARD1 subfamily

Probab=96.37  E-value=0.0019  Score=42.58  Aligned_cols=22  Identities=14%  Similarity=0.083  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      |++++|..+|||||++.+++.-
T Consensus         1 ~vvlvG~~~~GKTsl~~~l~~~   22 (169)
T cd04158           1 RVVTLGLDGAGKTTILFKLKQD   22 (169)
T ss_pred             CEEEECCCCCCHHHHHHHHhcC
Confidence            6899999999999999998754

ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family. In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif. This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family. Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity. However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain. The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs. The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain. ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra

>cd01870 RhoA_like RhoA-like subfamily

Probab=96.37  E-value=0.0019  Score=42.00  Aligned_cols=22  Identities=14%  Similarity=0.253  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|++++|...||||||+.+++.
T Consensus         2 ~ki~iiG~~~~GKTsl~~~~~~   23 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIVFSK   23 (175)
T ss_pred             cEEEEECCCCCCHHHHHHHHhc
Confidence            4899999999999999998885

The RhoA subfamily consists of RhoA, RhoB, and RhoC. RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility. RhoA can bind to multiple effector proteins, thereby triggering different downstream responses. In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis. RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation. RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. RhoA and RhoC are observed only in geranyl

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional

Probab=96.36  E-value=0.0038  Score=43.24  Aligned_cols=33  Identities=21%  Similarity=0.211  Sum_probs=24.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~~   67 (76)
                      .+.|+|..+||||||++.++=.   ++--+.+++..
T Consensus        39 ~~~i~G~nGsGKSTLl~~i~G~~~~~~G~i~~~g~~   74 (214)
T PRK13543         39 ALLVQGDNGAGKTTLLRVLAGLLHVESGQIQIDGKT   74 (214)
T ss_pred             EEEEEcCCCCCHHHHHHHHhCCCCCCCeeEEECCEE
Confidence            5789999999999999999854   33345555533

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C

Probab=96.35  E-value=0.0018  Score=39.94  Aligned_cols=20  Identities=15%  Similarity=-0.014  Sum_probs=17.2

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |+|-|+.+|||||+++.+.-
T Consensus         1 I~i~G~~GsGKtTia~~L~~   20 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKELAE   20 (129)
T ss_dssp             EEEEESTTSSHHHHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHHHHH
Confidence            57889999999999988753

...

>cd04127 Rab27A Rab27a subfamily

Probab=96.35  E-value=0.002  Score=42.26  Aligned_cols=24  Identities=21%  Similarity=0.069  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|.+.+||||++.+++.
T Consensus         3 ~~~ki~ivG~~~vGKTsli~~~~~   26 (180)
T cd04127           3 YLIKFLALGDSGVGKTSFLYQYTD   26 (180)
T ss_pred             ceEEEEEECCCCCCHHHHHHHHhc
Confidence            358999999999999999999864

The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b. Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions. Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder. When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated

>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases

Probab=96.34  E-value=0.0021  Score=43.29  Aligned_cols=25  Identities=24%  Similarity=0.182  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|..++||||++.++.-
T Consensus        15 ~~~~~i~ivG~~~~GKTsli~~l~~   39 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHMLKN   39 (184)
T ss_pred             cccCEEEEECCCCCCHHHHHHHHhc
Confidence            5679999999999999999998753

Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.

>PRK14242 phosphate transporter ATP-binding protein; Provisional

Probab=96.34  E-value=0.0042  Score=43.77  Aligned_cols=21  Identities=14%  Similarity=-0.051  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++=
T Consensus        34 ~~~i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14242         34 VTALIGPSGCGKSTFLRCLNR   54 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999984

>cd04151 Arl1 Arl1 subfamily

Probab=96.34  E-value=0.002  Score=41.60  Aligned_cols=21  Identities=19%  Similarity=0.186  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|.+.+||||++.+++.
T Consensus         1 kv~lvG~~~~GKTsl~~~l~~   21 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQL   21 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHcc
Confidence            689999999999999999864

Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network. Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting. In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors. Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding. Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2. Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi. In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.

>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily

Probab=96.31  E-value=0.0022  Score=42.75  Aligned_cols=24  Identities=13%  Similarity=0.293  Sum_probs=20.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+||||++.++..
T Consensus         1 ~~~ki~vvG~~~vGKTsL~~~~~~   24 (172)
T cd04141           1 REYKIVMLGAGGVGKSAVTMQFIS   24 (172)
T ss_pred             CceEEEEECCCCCcHHHHHHHHHh
Confidence            357999999999999999988763

Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics. These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains. Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42. Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells. Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42. This ternary complex is proposed to have physiological function in processes such as tumorigenesis. Activated Ric is likely to sign

>PRK14532 adenylate kinase; Provisional

Probab=96.31  E-value=0.0022  Score=43.24  Aligned_cols=23  Identities=17%  Similarity=0.228  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +|+++|..+|||||+.+.++-..
T Consensus         2 ~i~~~G~pGsGKsT~a~~la~~~   24 (188)
T PRK14532          2 NLILFGPPAAGKGTQAKRLVEER   24 (188)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            68999999999999999886443

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN

Probab=96.31  E-value=0.0021  Score=42.93  Aligned_cols=21  Identities=5%  Similarity=-0.127  Sum_probs=18.7

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|..+|||||++++++-.
T Consensus         4 ~~i~G~sGsGKttl~~~l~~~   24 (179)
T TIGR02322         4 IYVVGPSGAGKDTLLDYARAR   24 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            689999999999999998764

Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.

>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor

Probab=96.31  E-value=0.0023  Score=42.67  Aligned_cols=23  Identities=17%  Similarity=0.287  Sum_probs=21.0

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..+|++++|.+.||||+++..+.
T Consensus        12 ~~~ki~l~G~~~~GKTsL~~~~~   34 (175)
T smart00177       12 KEMRILMVGLDAAGKTTILYKLK   34 (175)
T ss_pred             CccEEEEEcCCCCCHHHHHHHHh
Confidence            46999999999999999998885

Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).

>smart00382 AAA ATPases associated with a variety of cellular activities

Probab=96.30  E-value=0.0027  Score=37.95  Aligned_cols=27  Identities=22%  Similarity=0.219  Sum_probs=23.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ..++|.|..+|||||+++.++-...++
T Consensus         3 ~~~~l~G~~G~GKTtl~~~l~~~~~~~   29 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALARELGPP   29 (148)
T ss_pred             CEEEEECCCCCcHHHHHHHHHhccCCC
Confidence            357999999999999999998887776

AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.

>PTZ00369 Ras-like protein; Provisional

Probab=96.30  E-value=0.0023  Score=43.13  Aligned_cols=24  Identities=13%  Similarity=0.191  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++|++++|.+.+||||++..++.
T Consensus         4 ~~~Ki~iiG~~~~GKTsLi~~~~~   27 (189)
T PTZ00369          4 TEYKLVVVGGGGVGKSALTIQFIQ   27 (189)
T ss_pred             cceEEEEECCCCCCHHHHHHHHhc
Confidence            468999999999999999988774

>cd01866 Rab2 Rab2 subfamily

Probab=96.30  E-value=0.0045  Score=40.55  Aligned_cols=24  Identities=13%  Similarity=0.159  Sum_probs=21.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|++++|.+.+|||||+.+++.-
T Consensus         4 ~~ki~vvG~~~vGKSsLl~~l~~~   27 (168)
T cd01866           4 LFKYIIIGDTGVGKSCLLLQFTDK   27 (168)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHcC
Confidence            579999999999999999998743

Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur

>PRK14530 adenylate kinase; Provisional

Probab=96.29  E-value=0.0021  Score=44.66  Aligned_cols=27  Identities=22%  Similarity=0.158  Sum_probs=22.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -+|+++|+.+|||||+.+.++-...-|
T Consensus         4 ~~I~i~G~pGsGKsT~~~~La~~~~~~   30 (215)
T PRK14530          4 PRILLLGAPGAGKGTQSSNLAEEFGVE   30 (215)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHhCCe
Confidence            378999999999999999987655443

>cd04149 Arf6 Arf6 subfamily

Probab=96.29  E-value=0.0023  Score=42.51  Aligned_cols=25  Identities=20%  Similarity=0.272  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+.+||||++.+++.
T Consensus         7 ~~~~kv~i~G~~~~GKTsli~~l~~   31 (168)
T cd04149           7 NKEMRILMLGLDAAGKTTILYKLKL   31 (168)
T ss_pred             CCccEEEEECcCCCCHHHHHHHHcc
Confidence            3578999999999999999998864

Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions. In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis. Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling. Arf6 is required for and enhances Rac formation of ruffles. Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection. In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells. Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis. Arf6 is believed t

>PRK13949 shikimate kinase; Provisional

Probab=96.26  E-value=0.0032  Score=42.95  Aligned_cols=27  Identities=15%  Similarity=0.197  Sum_probs=23.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +|+|+|..+|||||+.+.++-...-|.
T Consensus         3 ~I~liG~~GsGKstl~~~La~~l~~~~   29 (169)
T PRK13949          3 RIFLVGYMGAGKTTLGKALARELGLSF   29 (169)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcCCCe
Confidence            689999999999999999987766554

>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily

Probab=96.26  E-value=0.0024  Score=41.93  Aligned_cols=22  Identities=14%  Similarity=0.178  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|++|+|.+++|||||+.++..
T Consensus         2 ~kv~l~G~~g~GKTtl~~~~~~   23 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQFVE   23 (180)
T ss_pred             eEEEEECCCCCCHHHHHHHHHh
Confidence            5899999999999999998874

Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation. It is expressed ubiquitously, with elevated levels in muscle and brain. Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth. TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell. TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb. The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb. Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le

>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases

Probab=96.26  E-value=0.0024  Score=42.17  Aligned_cols=21  Identities=19%  Similarity=0.126  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|..++|||||++++.
T Consensus         1 ~ki~vvG~~~vGKTsli~~~~   21 (166)
T cd00877           1 FKLVLVGDGGTGKTTFVKRHL   21 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999876

Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.25  E-value=0.005  Score=43.48  Aligned_cols=23  Identities=4%  Similarity=-0.057  Sum_probs=20.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.++|..+||||||++.++=..
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl~   54 (252)
T PRK14256         32 VTAIIGPSGCGKSTVLRSINRMH   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHHhcc
Confidence            47899999999999999998764

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional

Probab=96.25  E-value=0.0059  Score=43.34  Aligned_cols=33  Identities=18%  Similarity=0.198  Sum_probs=24.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh-------cccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT-------TSKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~-------~~~~~~~~~~~   67 (76)
                      .+.|+|..+||||||++.++-.       ++--+.+++..
T Consensus        31 ~~~l~G~nGsGKSTLl~~l~Gl~~~~~~~~~G~i~~~g~~   70 (254)
T PRK10418         31 VLALVGGSGSGKSLTCAAALGILPAGVRQTAGRVLLDGKP   70 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCCCcCCEEEECCee
Confidence            5789999999999999998865       33335565543

>cd04125 RabA_like RabA-like subfamily

Probab=96.24  E-value=0.0025  Score=42.61  Aligned_cols=22  Identities=14%  Similarity=0.276  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+++|||||+.++..
T Consensus         1 ~ki~v~G~~~vGKSsli~~~~~   22 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKRFTE   22 (188)
T ss_pred             CEEEEECCCCCCHHHHHHHHhc
Confidence            4899999999999999998763

RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells. The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression. The function of RabA remains unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd04110 Rab35 Rab35 subfamily

Probab=96.24  E-value=0.0033  Score=42.84  Aligned_cols=24  Identities=21%  Similarity=0.232  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|.+++|||||+.++..
T Consensus         5 ~~~kivvvG~~~vGKTsli~~l~~   28 (199)
T cd04110           5 HLFKLLIIGDSGVGKSSLLLRFAD   28 (199)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHhc
Confidence            468999999999999999998864

Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells. Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is

>cd01876 YihA_EngB The YihA (EngB) subfamily

Probab=96.24  E-value=0.0025  Score=40.02  Aligned_cols=20  Identities=15%  Similarity=0.051  Sum_probs=18.5

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ++.|+|..++||||++.+++
T Consensus         1 ~i~l~G~~g~GKTtL~~~l~   20 (170)
T cd01876           1 EIAFAGRSNVGKSSLINALT   20 (170)
T ss_pred             CEEEEcCCCCCHHHHHHHHh
Confidence            47899999999999999998

This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control. YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting). Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis. The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.

>cd04118 Rab24 Rab24 subfamily

Probab=96.23  E-value=0.0025  Score=42.51  Aligned_cols=22  Identities=14%  Similarity=0.173  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+.+++.
T Consensus         1 ~ki~vvG~~~vGKSsLi~~~~~   22 (193)
T cd04118           1 VKVVMLGKESVGKTSLVERYVH   22 (193)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            4899999999999999999874

Rab24 is distinct from other Rabs in several ways. It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments. It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita

>PRK08233 hypothetical protein; Provisional

Probab=96.23  E-value=0.0025  Score=42.08  Aligned_cols=23  Identities=4%  Similarity=-0.125  Sum_probs=18.5

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-+.+.|.++|||||++.++.--
T Consensus         4 ~iI~I~G~~GsGKtTla~~L~~~   26 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTERLTHK   26 (182)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhh
Confidence            34567899999999999988643

>PTZ00132 GTP-binding nuclear protein Ran; Provisional

Probab=96.21  E-value=0.005  Score=42.24  Aligned_cols=24  Identities=17%  Similarity=0.120  Sum_probs=20.4

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+|+.++|..+||||||+...+
T Consensus         7 ~~~~kv~liG~~g~GKTtLi~~~~   30 (215)
T PTZ00132          7 VPEFKLILVGDGGVGKTTFVKRHL   30 (215)
T ss_pred             CCCceEEEECCCCCCHHHHHHHHH
Confidence            356899999999999999996544

>cd04117 Rab15 Rab15 subfamily

Probab=96.21  E-value=0.0047  Score=40.39  Aligned_cols=22  Identities=18%  Similarity=0.244  Sum_probs=19.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+++||||++.....
T Consensus         1 ~ki~vvG~~~~GKTsli~~~~~   22 (161)
T cd04117           1 FRLLLIGDSGVGKTCLLCRFTD   22 (161)
T ss_pred             CEEEEECcCCCCHHHHHHHHhc
Confidence            4899999999999999977653

Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB

Probab=96.20  E-value=0.0029  Score=42.25  Aligned_cols=26  Identities=12%  Similarity=0.014  Sum_probs=23.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+..+++++|...+|||||+.+++-.
T Consensus        16 ~~~~~i~ivG~~~~GKStlin~l~~~   41 (179)
T TIGR03598        16 DDGPEIAFAGRSNVGKSSLINALTNR   41 (179)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHHhCC
Confidence            46789999999999999999999864

Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.

>PRK00454 engB GTP-binding protein YsxC; Reviewed

Probab=96.19  E-value=0.0031  Score=41.86  Aligned_cols=24  Identities=13%  Similarity=0.022  Sum_probs=22.3

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..++.++|...+||||++++++-
T Consensus        23 ~~~~v~ivG~~~~GKSsli~~l~~   46 (196)
T PRK00454         23 DGPEIAFAGRSNVGKSSLINALTN   46 (196)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhC
Confidence            568999999999999999999986

>TIGR03263 guanyl_kin guanylate kinase

Probab=96.17  E-value=0.0028  Score=42.19  Aligned_cols=21  Identities=14%  Similarity=0.020  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .++|+|..+|||||+++.++-
T Consensus         3 ii~l~G~~GsGKsTl~~~L~~   23 (180)
T TIGR03263         3 LIVISGPSGVGKSTLVKALLE   23 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHc
Confidence            478999999999999999875

Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.

>cd04156 ARLTS1 ARLTS1 subfamily

Probab=96.16  E-value=0.0029  Score=40.49  Aligned_cols=21  Identities=24%  Similarity=0.180  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|..++||||++.++..
T Consensus         1 ~i~i~G~~~~GKTsl~~~~~~   21 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLKH   21 (160)
T ss_pred             CEEEEcCCCCCHHHHHHHHhc
Confidence            689999999999999998864

ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling. ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers. ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL). ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter. In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity. In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation. The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily

Probab=96.15  E-value=0.0029  Score=41.92  Aligned_cols=20  Identities=10%  Similarity=0.084  Sum_probs=18.0

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+++.|..+|||||+++.++
T Consensus         5 ii~i~G~~GsGKsTl~~~l~   24 (188)
T TIGR01360         5 IIFIVGGPGSGKGTQCEKIV   24 (188)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            57889999999999998876

Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.

>PRK10078 ribose 1,5-bisphosphokinase; Provisional

Probab=96.14  E-value=0.0041  Score=42.36  Aligned_cols=29  Identities=17%  Similarity=0.151  Sum_probs=22.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      .+.|.|..+|||||+++.+.-....+..+
T Consensus         4 ~i~l~G~sGsGKsTl~~~l~~~~~~~~~~   32 (186)
T PRK10078          4 LIWLMGPSGSGKDSLLAALRQREQTQLLV   32 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHhccCCCeEEE
Confidence            47899999999999999996655434333

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane

Probab=96.13  E-value=0.0029  Score=43.27  Aligned_cols=23  Identities=9%  Similarity=0.023  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~~   51 (214)
T cd03292          29 FVFLVGPSGAGKSTLLKLIYKEE   51 (214)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            57899999999999999998653

The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.

>cd01893 Miro1 Miro1 subfamily

Probab=96.12  E-value=0.003  Score=41.28  Aligned_cols=22  Identities=14%  Similarity=0.341  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+.++..
T Consensus         1 ~kv~ivG~~~vGKTsl~~~l~~   22 (166)
T cd01893           1 VRIVLIGDEGVGKSSLIMSLVS   22 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            4899999999999999998753

Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs. Genes encoding Miro-like proteins were found in several eukaryotic organisms. This CD represents the N-terminal GTPase domain of Miro proteins. These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine

Probab=96.12  E-value=0.0029  Score=44.00  Aligned_cols=22  Identities=9%  Similarity=-0.140  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~Gl   49 (236)
T cd03219          28 IHGLIGPNGAGKTTLFNLISGF   49 (236)
T ss_pred             EEEEECCCCCCHHHHHHHHcCC
Confidence            5789999999999999999854

MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli branched-chain amino acid transporter. MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs. The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).

>cd01874 Cdc42 Cdc42 subfamily

Probab=96.11  E-value=0.0032  Score=42.19  Aligned_cols=23  Identities=17%  Similarity=0.232  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+++|||+++.+.+.
T Consensus         1 ~~ki~vvG~~~vGKTsl~~~~~~   23 (175)
T cd01874           1 TIKCVVVGDGAVGKTCLLISYTT   23 (175)
T ss_pred             CeEEEEECCCCCCHHHHHHHHHc
Confidence            37999999999999999998874

Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases. These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway. Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth. In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus. Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand. In addi

>PRK00279 adk adenylate kinase; Reviewed

Probab=96.11  E-value=0.0041  Score=43.20  Aligned_cols=26  Identities=19%  Similarity=0.240  Sum_probs=22.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|+++|.++|||||+.+.++-...-|
T Consensus         2 ~I~v~G~pGsGKsT~a~~la~~~~~~   27 (215)
T PRK00279          2 RLILLGPPGAGKGTQAKFIAEKYGIP   27 (215)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCc
Confidence            68999999999999999888665544

>TIGR00235 udk uridine kinase

Probab=96.11  E-value=0.003  Score=43.66  Aligned_cols=22  Identities=9%  Similarity=-0.061  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.+.|.++||||||+++++-.
T Consensus         8 vi~I~G~sGsGKSTl~~~l~~~   29 (207)
T TIGR00235         8 IIGIGGGSGSGKTTVARKIYEQ   29 (207)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4678899999999999999854

Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.08  E-value=0.0066  Score=43.19  Aligned_cols=22  Identities=9%  Similarity=-0.068  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        35 ~~~l~G~nGsGKSTLlk~l~Gl   56 (259)
T PRK14260         35 VTAIIGPSGCGKSTFIKTLNRI   56 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5789999999999999999864

>cd04134 Rho3 Rho3 subfamily

Probab=96.07  E-value=0.0033  Score=42.41  Aligned_cols=21  Identities=14%  Similarity=0.161  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|.+++|||||+.++..
T Consensus         2 kivivG~~~vGKTsli~~~~~   22 (189)
T cd04134           2 KVVVLGDGACGKTSLLNVFTR   22 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            899999999999999998764

Rho3 is a member of the Rho family found only in fungi. Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules. Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity. The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively

Probab=96.06  E-value=0.0033  Score=42.99  Aligned_cols=32  Identities=13%  Similarity=0.120  Sum_probs=24.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+||||||++.++-.   ++--+.+++.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~   62 (213)
T cd03262          28 VVVIIGPSGSGKSTLLRCINLLEEPDSGTIIIDGL   62 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECCE
Confidence            5789999999999999999854   2333555554

Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP. HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM. The two HisP subunits form a homodimer within the complex. The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems. All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria. The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria

Probab=96.06  E-value=0.0032  Score=43.76  Aligned_cols=24  Identities=17%  Similarity=-0.014  Sum_probs=20.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++=..
T Consensus        28 e~~~l~G~nGsGKSTLl~~i~Gl~   51 (236)
T cd03253          28 KKVAIVGPSGSGKSTILRLLFRFY   51 (236)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            367899999999999999998553

Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake

Probab=96.05  E-value=0.0033  Score=43.20  Aligned_cols=33  Identities=12%  Similarity=-0.066  Sum_probs=24.3

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -.+.|+|..+||||||++.++=..   +--+.+++.
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   67 (218)
T cd03266          32 EVTGLLGPNGAGKTTTLRMLAGLLEPDAGFATVDGF   67 (218)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCcCCCCceEEECCE
Confidence            357899999999999999998553   223455543

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.

>cd01850 CDC_Septin CDC/Septin

Probab=96.05  E-value=0.0032  Score=46.17  Aligned_cols=24  Identities=17%  Similarity=0.163  Sum_probs=21.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .++|+++|..++|||||+.++|-.
T Consensus         4 ~f~I~vvG~sg~GKSTliN~L~~~   27 (276)
T cd01850           4 QFNIMVVGESGLGKSTFINTLFNT   27 (276)
T ss_pred             EEEEEEEcCCCCCHHHHHHHHHcC
Confidence            579999999999999999999754

Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells. They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis. In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments. Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.

>PRK14531 adenylate kinase; Provisional

Probab=96.05  E-value=0.0035  Score=42.69  Aligned_cols=27  Identities=22%  Similarity=0.310  Sum_probs=21.9

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .+|+++|..+|||||+.+.++-...-|
T Consensus         3 ~~i~i~G~pGsGKsT~~~~la~~~g~~   29 (183)
T PRK14531          3 QRLLFLGPPGAGKGTQAARLCAAHGLR   29 (183)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHhCCC
Confidence            378999999999999999886654433

>cd04109 Rab28 Rab28 subfamily

Probab=96.05  E-value=0.0034  Score=43.38  Aligned_cols=21  Identities=14%  Similarity=0.230  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|.+.+||||+++.++
T Consensus         1 ~Ki~ivG~~~vGKSsLi~~l~   21 (215)
T cd04109           1 FKIVVLGDGAVGKTSLCRRFA   21 (215)
T ss_pred             CEEEEECcCCCCHHHHHHHHh
Confidence            489999999999999999987

First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA). In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos. Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus. The two human isoforms are presumbly the result of alternative splicing. Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE

Probab=96.05  E-value=0.0033  Score=43.62  Aligned_cols=24  Identities=13%  Similarity=-0.078  Sum_probs=20.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --.+.|+|..+||||||++.++-.
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~   49 (230)
T TIGR03410        26 GEVTCVLGRNGVGKTTLLKTLMGL   49 (230)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            346899999999999999998854

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>cd00881 GTP_translation_factor GTP translation factor family

Probab=96.04  E-value=0.0034  Score=40.74  Aligned_cols=23  Identities=13%  Similarity=0.020  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++.++|...||||||+.+++-..
T Consensus         1 ~v~v~G~~~~GKStlln~l~~~~   23 (189)
T cd00881           1 NVGIAGHVDHGKTTLTERLLYVT   23 (189)
T ss_pred             CEEEEeCCCCCHHHHHHHHHHhc
Confidence            47899999999999999987553

This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation. In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional

Probab=96.04  E-value=0.0082  Score=42.28  Aligned_cols=22  Identities=14%  Similarity=-0.052  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        33 ~~~l~G~nGsGKSTLl~~l~Gl   54 (252)
T PRK14255         33 ITALIGPSGCGKSTYLRTLNRM   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>PRK11147 ABC transporter ATPase component; Reviewed

Probab=96.04  E-value=0.0069  Score=48.74  Aligned_cols=40  Identities=15%  Similarity=0.125  Sum_probs=29.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      ++.|+|..+||||||++.++-..   +--+.+ +..+.||++.|
T Consensus       347 ~~~l~G~NGsGKSTLlk~l~G~~~p~~G~i~~-~~~~~i~y~~q  389 (635)
T PRK11147        347 KIALIGPNGCGKTTLLKLMLGQLQADSGRIHC-GTKLEVAYFDQ  389 (635)
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCCcEEEE-CCCcEEEEEeC
Confidence            56899999999999999998653   222344 44567888766

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors

Probab=96.03  E-value=0.0035  Score=43.61  Aligned_cols=23  Identities=17%  Similarity=0.082  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++=..
T Consensus        35 ~~~l~G~nGsGKSTLlk~l~G~~   57 (226)
T cd03234          35 VMAILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHhCcc
Confidence            57899999999999999998543

The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan. The pigment precursors are encoded by the white, brown, and scarlet genes, respectively. Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan. However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes. Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit

Probab=96.03  E-value=0.0067  Score=42.36  Aligned_cols=41  Identities=20%  Similarity=0.142  Sum_probs=28.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCcee-----EEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNNTV-----EIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~~~-----~~~~~~~   75 (76)
                      .+.|+|..+|||||+++.++-.   ++--+.+|+..+     .||++.|
T Consensus         8 ~~~l~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~~~~~~~~~i~~v~q   56 (223)
T TIGR03771         8 LLGLLGPNGAGKTTLLRAILGLIPPAKGTVKVAGASPGKGWRHIGYVPQ   56 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECCccchHhhCcEEEecc
Confidence            6789999999999999998854   334456665432     3555544

This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.03  E-value=0.0069  Score=44.18  Aligned_cols=32  Identities=16%  Similarity=0.067  Sum_probs=24.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.+|-..   +-...+++.
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~   69 (290)
T PRK13634         35 YVAIIGHTGSGKSTLLQHLNGLLQPTSGTVTIGER   69 (290)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCCCCCcEEEECCE
Confidence            57899999999999999999653   333555543

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases

Probab=96.03  E-value=0.0082  Score=41.01  Aligned_cols=24  Identities=21%  Similarity=0.058  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-.+++.|..+|||||++++++-.
T Consensus        25 g~~i~I~G~tGSGKTTll~aL~~~   48 (186)
T cd01130          25 RKNILISGGTGSGKTTLLNALLAF   48 (186)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhh
Confidence            346899999999999999998754

The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB. This alignment contains the C-terminal domain, which is the ATPase.

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)

Probab=96.03  E-value=0.0034  Score=43.12  Aligned_cols=24  Identities=13%  Similarity=-0.104  Sum_probs=20.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+|||||+++.++-..
T Consensus        31 ~~~~l~G~nGsGKSTLl~~i~Gl~   54 (218)
T cd03255          31 EFVAIVGPSGSGKSTLLNILGGLD   54 (218)
T ss_pred             CEEEEEcCCCCCHHHHHHHHhCCc
Confidence            367899999999999999988653

They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=96.02  E-value=0.0074  Score=43.62  Aligned_cols=32  Identities=13%  Similarity=0.127  Sum_probs=24.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.++|..+|||||+++.+|-.   ++--..+++.
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~   64 (274)
T PRK13644         30 YIGIIGKNGSGKSTLALHLNGLLRPQKGKVLVSGI   64 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCceEEECCE
Confidence            5789999999999999999965   3333455543

>cd00882 Ras_like_GTPase Ras-like GTPase superfamily

Probab=96.02  E-value=0.0029  Score=37.90  Aligned_cols=19  Identities=11%  Similarity=-0.043  Sum_probs=16.9

Q ss_pred             eccCCCccchhhhhhhhhh
Q psy6625          38 LLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        38 LLGaGESGKST~~~~~~~~   56 (76)
                      ++|...||||||+++++-.
T Consensus         1 iiG~~~~GKStl~~~l~~~   19 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGG   19 (157)
T ss_pred             CCCcCCCcHHHHHHHHHhC
Confidence            5899999999999999863

The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families. This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins. Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb

>cd04159 Arl10_like Arl10-like subfamily

Probab=96.02  E-value=0.0036  Score=38.96  Aligned_cols=21  Identities=14%  Similarity=0.077  Sum_probs=19.1

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +.++|...+||||++++++-.
T Consensus         2 i~i~G~~~~GKssl~~~l~~~   22 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAGG   22 (159)
T ss_pred             EEEEcCCCCCHHHHHHHHccC
Confidence            689999999999999998765

Arl9/Arl10 was identified from a human cancer-derived EST dataset. No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.

>cd04130 Wrch_1 Wrch-1 subfamily

Probab=96.01  E-value=0.0038  Score=41.06  Aligned_cols=22  Identities=18%  Similarity=0.232  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+++|||||+++...
T Consensus         1 ~k~~i~G~~~~GKtsl~~~~~~   22 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVSYTT   22 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            5899999999999999987753

Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus,

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional

Probab=96.01  E-value=0.0074  Score=42.96  Aligned_cols=22  Identities=5%  Similarity=-0.094  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        41 ~~~i~G~nGsGKSTLl~~l~Gl   62 (260)
T PRK10744         41 VTAFIGPSGCGKSTLLRTFNRM   62 (260)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>cd01120 RecA-like_NTPases RecA-like NTPases

Probab=96.01  E-value=0.0038  Score=39.32  Aligned_cols=22  Identities=23%  Similarity=0.286  Sum_probs=19.2

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|..++|||||+++++---
T Consensus         2 ~~i~G~~G~GKT~l~~~i~~~~   23 (165)
T cd01120           2 ILVFGPTGSGKTTLALQLALNI   23 (165)
T ss_pred             eeEeCCCCCCHHHHHHHHHHHH
Confidence            6889999999999999887654

This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein

Probab=96.00  E-value=0.0036  Score=43.68  Aligned_cols=32  Identities=6%  Similarity=0.089  Sum_probs=24.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+|+.
T Consensus        30 ~~~l~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   64 (243)
T TIGR02315        30 FVAIIGPSGAGKSTLLRCINRLVEPSSGSILLEGT   64 (243)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcCCCccEEEECCE
Confidence            67899999999999999988542   334556553

Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK

Probab=96.00  E-value=0.0037  Score=42.85  Aligned_cols=22  Identities=14%  Similarity=0.073  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~   49 (213)
T cd03301          28 FVVLLGPSGCGKTTTLRMIAGL   49 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4789999999999999998865

ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles. ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP. In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate

Probab=95.99  E-value=0.005  Score=39.91  Aligned_cols=31  Identities=19%  Similarity=0.317  Sum_probs=23.1

Q ss_pred             eeeccCCCccchhhhhhhhhhcccceeeeCce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMMINNNT   67 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~~~~~~   67 (76)
                      +++.|..+|||||+++.+.-..+-+ .++..+
T Consensus         2 i~l~G~~GsGKST~a~~l~~~~~~~-~i~~D~   32 (150)
T cd02021           2 IVVMGVSGSGKSTVGKALAERLGAP-FIDGDD   32 (150)
T ss_pred             EEEEcCCCCCHHHHHHHHHhhcCCE-EEeCcc
Confidence            5788999999999999887765543 344443

The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.

>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily

Probab=95.99  E-value=0.0041  Score=41.75  Aligned_cols=23  Identities=13%  Similarity=0.153  Sum_probs=21.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+.||||+|+.+++.
T Consensus         3 ~~kv~~vG~~~~GKTsli~~~~~   25 (183)
T cd04152           3 SLHIVMLGLDSAGKTTVLYRLKF   25 (183)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhc
Confidence            57999999999999999999864

Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus. In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed. Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages. Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.

>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed

Probab=95.98  E-value=0.013  Score=41.16  Aligned_cols=43  Identities=9%  Similarity=-0.042  Sum_probs=29.6

Q ss_pred             hhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          15 RSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        15 ~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-..+-..|........+..-+-+.|..+||||||++.++-.-
T Consensus        15 ~~~~l~~~~~~~~~~~~~~~iigi~G~~GsGKTTl~~~L~~~l   57 (229)
T PRK09270         15 VHKPLLRRLAALQAEPQRRTIVGIAGPPGAGKSTLAEFLEALL   57 (229)
T ss_pred             HHHHHHHHHHHHHhcCCCCEEEEEECCCCCCHHHHHHHHHHHh
Confidence            3444545554444444456677889999999999999887543

>PRK13695 putative NTPase; Provisional

Probab=95.98  E-value=0.0038  Score=41.88  Aligned_cols=20  Identities=15%  Similarity=0.115  Sum_probs=17.9

Q ss_pred             cceeeccCCCccchhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~   53 (76)
                      .|++|.|.++||||||++..
T Consensus         1 ~~i~ltG~~G~GKTTll~~i   20 (174)
T PRK13695          1 MKIGITGPPGVGKTTLVLKI   20 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            47899999999999999973

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional

Probab=95.98  E-value=0.0037  Score=43.65  Aligned_cols=23  Identities=13%  Similarity=-0.008  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        37 ~~~l~G~nGsGKSTLl~~l~Gl~   59 (233)
T PRK11629         37 MMAIVGSSGSGKSTLLHLLGGLD   59 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            57899999999999999998653

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein

Probab=95.97  E-value=0.0038  Score=42.99  Aligned_cols=22  Identities=14%  Similarity=-0.034  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        33 ~~~i~G~nGsGKSTLl~~i~G~   54 (221)
T TIGR02211        33 IVAIVGSSGSGKSTLLHLLGGL   54 (221)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999999865

This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed

Probab=95.96  E-value=0.0065  Score=46.62  Aligned_cols=34  Identities=18%  Similarity=0.165  Sum_probs=25.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCcee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV   68 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~   68 (76)
                      -+.|+|..+|||||+++.++=..   +--+.+++..+
T Consensus        42 ~~~LlGpsGsGKSTLLr~IaGl~~p~~G~I~~~g~~i   78 (375)
T PRK09452         42 FLTLLGPSGCGKTTVLRLIAGFETPDSGRIMLDGQDI   78 (375)
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCceEEEECCEEC
Confidence            47899999999999999988543   33356666544

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family

Probab=95.96  E-value=0.0048  Score=40.64  Aligned_cols=26  Identities=19%  Similarity=0.170  Sum_probs=21.0

Q ss_pred             eeeccCCCccchhhhhhhhhhcccce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +++.|..+|||||+++.+.--...|.
T Consensus         1 i~l~G~~GsGKSTla~~l~~~l~~~~   26 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLGAKF   26 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHHhcCCeE
Confidence            47889999999999998876655444

This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.95  E-value=0.0081  Score=43.40  Aligned_cols=31  Identities=10%  Similarity=0.049  Sum_probs=23.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.++|..+|||||+++.++=.   ++--+.+++
T Consensus        35 ~~~I~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g   68 (277)
T PRK13642         35 WVSIIGQNGSGKSTTARLIDGLFEEFEGKVKIDG   68 (277)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCCCCCCEEEECC
Confidence            5789999999999999999843   333345544

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]

Probab=95.94  E-value=0.0041  Score=45.56  Aligned_cols=24  Identities=8%  Similarity=-0.050  Sum_probs=21.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .+++.|.++||||||+++.|-.-|
T Consensus        31 ~iaitGPSG~GKStllk~va~Lis   54 (223)
T COG4619          31 FIAITGPSGCGKSTLLKIVASLIS   54 (223)
T ss_pred             eEEEeCCCCccHHHHHHHHHhccC
Confidence            568999999999999999997654

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters

Probab=95.94  E-value=0.0041  Score=42.52  Aligned_cols=21  Identities=19%  Similarity=0.047  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+||||||++.++=
T Consensus        35 ~~~l~G~nGsGKSTLl~~l~G   55 (192)
T cd03232          35 LTALMGESGAGKTTLLDVLAG   55 (192)
T ss_pred             EEEEECCCCCCHHHHHHHHhC
Confidence            578999999999999999984

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PTZ00088 adenylate kinase 1; Provisional

Probab=95.93  E-value=0.0054  Score=44.23  Aligned_cols=29  Identities=14%  Similarity=0.076  Sum_probs=23.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccce
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      -.||+|+|+++|||||+.+.++-...-|.
T Consensus         6 ~mrIvl~G~PGsGK~T~a~~La~~~g~~~   34 (229)
T PTZ00088          6 PLKIVLFGAPGVGKGTFAEILSKKENLKH   34 (229)
T ss_pred             CceEEEECCCCCCHHHHHHHHHHHhCCcE
Confidence            46799999999999999999876655443

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein

Probab=95.93  E-value=0.0083  Score=42.23  Aligned_cols=23  Identities=13%  Similarity=-0.018  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.+.-..
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~~   51 (247)
T TIGR00972        29 VTALIGPSGCGKSTLLRSLNRMN   51 (247)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            46899999999999999987543

This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch

Probab=95.93  E-value=0.0044  Score=42.69  Aligned_cols=22  Identities=14%  Similarity=0.084  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+++|.|...||||||+++.+.
T Consensus        30 ~~~~l~G~Ng~GKStll~~i~~   51 (202)
T cd03243          30 RLLLITGPNMGGKSTYLRSIGL   51 (202)
T ss_pred             eEEEEECCCCCccHHHHHHHHH
Confidence            3689999999999999999883

Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold

Probab=95.93  E-value=0.011  Score=35.78  Aligned_cols=25  Identities=20%  Similarity=0.162  Sum_probs=21.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..-+++.|..++||||+++..+-..
T Consensus        19 ~~~v~i~G~~G~GKT~l~~~i~~~~   43 (151)
T cd00009          19 PKNLLLYGPPGTGKTTLARAIANEL   43 (151)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHh
Confidence            3458999999999999999998765

The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.

>PRK14239 phosphate transporter ATP-binding protein; Provisional

Probab=95.92  E-value=0.0093  Score=41.91  Aligned_cols=22  Identities=14%  Similarity=-0.019  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        33 ~~~i~G~nGsGKSTLl~~l~Gl   54 (252)
T PRK14239         33 ITALIGPSGSGKSTLLRSINRM   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999743

>PRK14238 phosphate transporter ATP-binding protein; Provisional

Probab=95.92  E-value=0.0092  Score=42.97  Aligned_cols=23  Identities=9%  Similarity=-0.094  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+|||||+++.++=.
T Consensus        51 e~~~I~G~nGsGKSTLl~~i~Gl   73 (271)
T PRK14238         51 EVTAIIGPSGCGKSTYIKTLNRM   73 (271)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhh
Confidence            35789999999999999999854

>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways

Probab=95.92  E-value=0.0041  Score=42.73  Aligned_cols=22  Identities=23%  Similarity=0.277  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      |++|.|..+|||||+++++.--
T Consensus         3 rimliG~~g~GKTTL~q~L~~~   24 (143)
T PF10662_consen    3 RIMLIGPSGSGKTTLAQALNGE   24 (143)
T ss_pred             eEEEECCCCCCHHHHHHHHcCC
Confidence            7899999999999999998643

Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process

>PRK14527 adenylate kinase; Provisional

Probab=95.92  E-value=0.0043  Score=42.32  Aligned_cols=21  Identities=14%  Similarity=0.132  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -++++|.++|||||+++.++-
T Consensus         8 ~i~i~G~pGsGKsT~a~~La~   28 (191)
T PRK14527          8 VVIFLGPPGAGKGTQAERLAQ   28 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            489999999999999998873

>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily

Probab=95.92  E-value=0.0043  Score=41.32  Aligned_cols=22  Identities=14%  Similarity=0.366  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      |++++|.++||||+|+++.+.=
T Consensus         2 ki~ivG~~~vGKTsli~~~~~~   23 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKD   23 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            8999999999999999998863

Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice. This isoform is associated with membrane ruffles and promotes macropinosome formation. Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further re

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins

Probab=95.92  E-value=0.0041  Score=43.16  Aligned_cols=22  Identities=14%  Similarity=-0.028  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl   51 (234)
T cd03251          30 TVALVGPSGSGKSTLVNLIPRF   51 (234)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily

Probab=95.92  E-value=0.0043  Score=40.99  Aligned_cols=21  Identities=24%  Similarity=0.104  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      +|+++|.+.|||||++.+++-
T Consensus         1 ~i~~~G~~~~GKTsl~~~l~~   21 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSALQG   21 (167)
T ss_pred             CEEEECCCCCCHHHHHHHHhC
Confidence            479999999999999998764

Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases. Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS). Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions. Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes

Probab=95.91  E-value=0.0098  Score=41.99  Aligned_cols=40  Identities=13%  Similarity=0.162  Sum_probs=28.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVL   73 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~   73 (76)
                      -+++|.|...||||||+++.+...   ..-+.+...+++++++
T Consensus        30 ~~~~itGpNg~GKStlLk~i~~~~~la~~G~~v~a~~~~~~~~   72 (213)
T cd03281          30 SIMVITGPNSSGKSVYLKQVALIVFLAHIGSFVPADSATIGLV   72 (213)
T ss_pred             eEEEEECCCCCChHHHHHHHHHHHHHHhCCCeeEcCCcEEeee
Confidence            468999999999999999998542   2334444556666654

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2

Probab=95.91  E-value=0.0042  Score=42.27  Aligned_cols=22  Identities=9%  Similarity=-0.013  Sum_probs=19.1

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.+.|..+||||||++.+.-..
T Consensus         2 igi~G~~GsGKSTl~~~l~~~l   23 (198)
T cd02023           2 IGIAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            4688999999999999987764

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.

>TIGR02673 FtsE cell division ATP-binding protein FtsE

Probab=95.90  E-value=0.0043  Score=42.55  Aligned_cols=22  Identities=18%  Similarity=0.034  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        30 ~~~l~G~nGsGKSTLl~~i~Gl   51 (214)
T TIGR02673        30 FLFLTGPSGAGKTTLLKLLYGA   51 (214)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999988765

This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein

Probab=95.90  E-value=0.0043  Score=42.79  Aligned_cols=34  Identities=9%  Similarity=0.054  Sum_probs=25.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .-.+.|+|..+||||||++.++-..   +--+.+++.
T Consensus        24 Ge~~~i~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~   60 (213)
T TIGR01277        24 GEIVAIMGPSGAGKSTLLNLIAGFIEPASGSIKVNDQ   60 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECCE
Confidence            3367899999999999999998663   223455443

This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.90  E-value=0.0044  Score=42.47  Aligned_cols=23  Identities=13%  Similarity=-0.096  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        28 e~~~l~G~nGsGKSTLl~~i~G~   50 (200)
T PRK13540         28 GLLHLKGSNGAGKTTLLKLIAGL   50 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcC
Confidence            36789999999999999988754

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.89  E-value=0.0082  Score=43.20  Aligned_cols=22  Identities=14%  Similarity=-0.019  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        41 ~~~l~G~nGsGKSTLl~~l~Gl   62 (269)
T PRK14259         41 VTALIGPSGCGKSTVLRSLNRM   62 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity

Probab=95.89  E-value=0.0044  Score=42.46  Aligned_cols=32  Identities=13%  Similarity=0.098  Sum_probs=23.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++=..   +--+.+|+.
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~   62 (210)
T cd03269          28 IFGLLGPNGAGKTTTIRMILGIILPDSGEVLFDGK   62 (210)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECCC
Confidence            46899999999999999998542   333445543

In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs. Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.88  E-value=0.0085  Score=43.29  Aligned_cols=31  Identities=13%  Similarity=0.147  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.|+|..+|||||+++.++-.   ++--+.+++
T Consensus        32 ~~~i~G~NGsGKSTLl~~l~Gl~~p~~G~i~~~g   65 (277)
T PRK13652         32 RIAVIGPNGAGKSTLFRHFNGILKPTSGSVLIRG   65 (277)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCceEEEECC
Confidence            5689999999999999999843   333344444

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea

Probab=95.88  E-value=0.0045  Score=41.83  Aligned_cols=23  Identities=13%  Similarity=-0.045  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++=.
T Consensus        26 ~~~~l~G~nGsGKStLl~~i~G~   48 (180)
T cd03214          26 EIVGILGPNGAGKSTLLKTLAGL   48 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36789999999999999998765

Only very few species lack representatives of the siderophore family transporters. The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake. The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA. The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme. A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.

>cd04111 Rab39 Rab39 subfamily

Probab=95.87  E-value=0.0046  Score=42.93  Aligned_cols=23  Identities=9%  Similarity=0.205  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|...+|||||+++++.
T Consensus         2 ~~KIvvvG~~~vGKTsLi~~l~~   24 (211)
T cd04111           2 QFRLIVIGDSTVGKSSLLKRFTE   24 (211)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHc
Confidence            47999999999999999999864

Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines. It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids

Probab=95.87  E-value=0.0044  Score=42.58  Aligned_cols=31  Identities=13%  Similarity=0.095  Sum_probs=23.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.|+|..+||||||++.++-.   ++--+.+++
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g   61 (222)
T cd03224          28 IVALLGRNGAGKTTLLKTIMGLLPPRSGSIRFDG   61 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECC
Confidence            5789999999999999988744   233345554

The E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.

>cd04144 Ras2 Ras2 subfamily

Probab=95.86  E-value=0.0047  Score=41.62  Aligned_cols=21  Identities=29%  Similarity=0.498  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|..++|||||+.+++.
T Consensus         1 ki~ivG~~~vGKTsli~~l~~   21 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQLCL   21 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHHh
Confidence            689999999999999999874

The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis. In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family. Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.86  E-value=0.01  Score=41.71  Aligned_cols=34  Identities=9%  Similarity=0.029  Sum_probs=25.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh--------cccceeeeCcee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT--------TSKPMMINNNTV   68 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~--------~~~~~~~~~~~~   68 (76)
                      .+.|+|..+|||||+++.++=.        ++--+.+|+..+
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~~~~~~G~v~~~g~~i   72 (250)
T PRK14266         31 VTALIGPSGCGKSTFIRTLNRMNDLIPGFRHEGHIYLDGVDI   72 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhhccCCCCCCccEEEECCEEc
Confidence            5689999999999999999843        334456666443

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth

Probab=95.86  E-value=0.0046  Score=40.85  Aligned_cols=39  Identities=13%  Similarity=0.119  Sum_probs=26.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLV   74 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~   74 (76)
                      -+.++|..+||||||++.++-..   +-.+.++++ ..++++.
T Consensus        28 ~~~i~G~nGsGKStLl~~l~G~~~~~~G~i~~~~~-~~i~~~~   69 (144)
T cd03221          28 RIGLVGRNGAGKSTLLKLIAGELEPDEGIVTWGST-VKIGYFE   69 (144)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCCCCCceEEEECCe-EEEEEEc
Confidence            45799999999999999988654   223445442 3555543

EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein

Probab=95.86  E-value=0.0046  Score=42.53  Aligned_cols=23  Identities=9%  Similarity=-0.035  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+|||||+++.++-.
T Consensus        30 e~~~i~G~nGsGKSTLl~~l~Gl   52 (216)
T TIGR00960        30 EMVFLVGHSGAGKSTFLKLILGI   52 (216)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            35789999999999999998865

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD

Probab=95.85  E-value=0.0045  Score=43.24  Aligned_cols=23  Identities=30%  Similarity=0.273  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        14 ~~~i~G~nGsGKSTLl~~l~Gl~   36 (230)
T TIGR02770        14 VLALVGESGSGKSLTCLAILGLL   36 (230)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            46899999999999999998764

This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group

Probab=95.85  E-value=0.0047  Score=42.01  Aligned_cols=22  Identities=14%  Similarity=-0.016  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        26 ~~~i~G~nGsGKSTLl~~l~G~   47 (206)
T TIGR03608        26 MYAIIGESGSGKSTLLNIIGLL   47 (206)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999999854

A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.

>PLN03071 GTP-binding nuclear protein Ran; Provisional

Probab=95.85  E-value=0.0049  Score=43.13  Aligned_cols=25  Identities=16%  Similarity=0.093  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+.+.
T Consensus        11 ~~~~Ki~vvG~~gvGKTsli~~~~~   35 (219)
T PLN03071         11 YPSFKLVIVGDGGTGKTTFVKRHLT   35 (219)
T ss_pred             CCceEEEEECcCCCCHHHHHHHHhh
Confidence            4578999999999999999998763

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system

Probab=95.85  E-value=0.0046  Score=43.00  Aligned_cols=32  Identities=19%  Similarity=0.147  Sum_probs=24.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-.   ++--+.+++.
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   63 (241)
T cd03256          29 FVALIGPSGAGKSTLLRCLNGLVEPTSGSVLIDGT   63 (241)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcCCCCceEEECCE
Confidence            5789999999999999999854   2333555543

Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>KOG0073|consensus

Probab=95.85  E-value=0.0068  Score=43.61  Aligned_cols=22  Identities=23%  Similarity=0.366  Sum_probs=20.3

Q ss_pred             CccceeeccCCCccchhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~   53 (76)
                      +++++|+||--.|||+|+++.+
T Consensus        15 rE~riLiLGLdNsGKTti~~kl   36 (185)
T KOG0073|consen   15 REVRILILGLDNSGKTTIVKKL   36 (185)
T ss_pred             heeEEEEEecCCCCchhHHHHh
Confidence            3899999999999999999875

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity

Probab=95.85  E-value=0.0047  Score=41.50  Aligned_cols=23  Identities=13%  Similarity=-0.084  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.+.|..+||||||++.++-..
T Consensus        28 ~~~i~G~nGsGKStLl~~l~G~~   50 (173)
T cd03230          28 IYGLLGPNGAGKTTLIKIILGLL   50 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999987653

In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins. Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family. The ATP-binding domain shows the highest similarity between all members of the ABC transporter family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes

Probab=95.84  E-value=0.0048  Score=43.14  Aligned_cols=22  Identities=14%  Similarity=0.164  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++|.|...||||||+++.+..
T Consensus        27 ~~~ltGpNg~GKSTllr~i~~~   48 (199)
T cd03283          27 GILITGSNMSGKSTFLRTIGVN   48 (199)
T ss_pred             EEEEECCCCCChHHHHHHHHHH
Confidence            4589999999999999999853

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid

>cd00880 Era_like Era (E

Probab=95.84  E-value=0.0039  Score=38.08  Aligned_cols=19  Identities=21%  Similarity=0.090  Sum_probs=16.4

Q ss_pred             eccCCCccchhhhhhhhhh
Q psy6625          38 LLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        38 LLGaGESGKST~~~~~~~~   56 (76)
                      ++|..+||||||+++++-.
T Consensus         1 i~G~~gsGKstl~~~l~~~   19 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQ   19 (163)
T ss_pred             CcCCCCCCHHHHHHHHhCc
Confidence            5799999999999998753

coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.83  E-value=0.01  Score=41.86  Aligned_cols=22  Identities=9%  Similarity=-0.087  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++=.
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl   51 (246)
T PRK14269         30 ITALIGASGCGKSTFLRCFNRM   51 (246)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>cd04104 p47_IIGP_like p47 (47-kDa) family

Probab=95.83  E-value=0.0048  Score=42.33  Aligned_cols=22  Identities=18%  Similarity=0.061  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|+.++|.+++||||++++++-
T Consensus         2 ~kI~i~G~~g~GKSSLin~L~g   23 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALRG   23 (197)
T ss_pred             eEEEEECCCCCCHHHHHHHHhc
Confidence            6899999999999999999975

The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1. They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens. p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma). ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis. TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro. IRG-47 is involved in resistance to T. gondii infection. LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections. IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues. In macrophages, IIGP1 interacts with hook3, a microtubule binding protei

>COG4639 Predicted kinase [General function prediction only]

Probab=95.83  E-value=0.0045  Score=44.00  Aligned_cols=17  Identities=18%  Similarity=0.057  Sum_probs=15.3

Q ss_pred             eeeccCCCccchhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLA   52 (76)
Q Consensus        36 LLLLGaGESGKST~~~~   52 (76)
                      ++|-|+..||||||++.
T Consensus         5 vvL~G~~~sGKsT~ak~   21 (168)
T COG4639           5 VVLRGASGSGKSTFAKE   21 (168)
T ss_pred             EEEecCCCCchhHHHHH
Confidence            57889999999999986

>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases

Probab=95.83  E-value=0.0044  Score=40.27  Aligned_cols=20  Identities=15%  Similarity=0.238  Sum_probs=17.8

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      ++++|.+++|||||+.+++.
T Consensus         1 i~i~G~~~vGKTsli~~~~~   20 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTT   20 (174)
T ss_pred             CEEECCCCCCHHHHHHHHHh
Confidence            57899999999999998765

Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.

>cd04103 Centaurin_gamma Centaurin gamma

Probab=95.83  E-value=0.0051  Score=40.78  Aligned_cols=22  Identities=23%  Similarity=0.200  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+||||++...+.
T Consensus         1 ~ki~vvG~~gvGKTsli~~~~~   22 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHRYLT   22 (158)
T ss_pred             CEEEEECCCCCcHHHHHHHHHh
Confidence            5899999999999999998754

The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues.

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.83  E-value=0.01  Score=41.76  Aligned_cols=22  Identities=14%  Similarity=-0.056  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.+.-.
T Consensus        31 ~~~i~G~nGsGKSTLl~~i~G~   52 (250)
T PRK14247         31 ITALMGPSGSGKSTLLRVFNRL   52 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999998755

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional

Probab=95.83  E-value=0.0091  Score=44.53  Aligned_cols=23  Identities=30%  Similarity=0.280  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++++.-..
T Consensus        35 ~~~ivG~sGsGKSTLl~~i~Gl~   57 (330)
T PRK15093         35 IRGLVGESGSGKSLIAKAICGVT   57 (330)
T ss_pred             EEEEECCCCCCHHHHHHHHHccC
Confidence            47899999999999999988653

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional

Probab=95.82  E-value=0.0047  Score=43.83  Aligned_cols=23  Identities=26%  Similarity=0.088  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        33 e~~~i~G~nGsGKSTLl~~l~Gl   55 (258)
T PRK11701         33 EVLGIVGESGSGKTTLLNALSAR   55 (258)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36799999999999999998865

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=95.82  E-value=0.0047  Score=43.47  Aligned_cols=22  Identities=14%  Similarity=-0.007  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        33 ~~~l~G~nGsGKSTLl~~l~Gl   54 (255)
T PRK11300         33 IVSLIGPNGAGKTTVFNCLTGF   54 (255)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999988855

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively

Probab=95.82  E-value=0.0048  Score=42.63  Aligned_cols=22  Identities=9%  Similarity=-0.055  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl   53 (220)
T cd03293          32 FVALVGPSGCGKSTLLRIIAGL   53 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998865

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids

Probab=95.81  E-value=0.0049  Score=42.73  Aligned_cols=31  Identities=13%  Similarity=0.146  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.|+|..+|||||+++.++=.   ++--..+|+
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g   61 (232)
T cd03218          28 IVGLLGPNGAGKTTTFYMIVGLVKPDSGKILLDG   61 (232)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCcEEEECC
Confidence            5789999999999999999854   233344544

The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis. YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein. Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli. The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.

>cd03290 ABCC_SUR1_N The SUR domain 1

Probab=95.81  E-value=0.0049  Score=42.57  Aligned_cols=23  Identities=13%  Similarity=0.086  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.+|-.
T Consensus        28 e~~~i~G~nGsGKSTLl~~i~G~   50 (218)
T cd03290          28 QLTMIVGQVGCGKSSLLLAILGE   50 (218)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcc
Confidence            36789999999999999999954

The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>cd01871 Rac1_like Rac1-like subfamily

Probab=95.81  E-value=0.0052  Score=41.14  Aligned_cols=23  Identities=17%  Similarity=0.228  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|...+|||+|+.+.+.
T Consensus         1 ~~ki~iiG~~~vGKSsli~~~~~   23 (174)
T cd01871           1 AIKCVVVGDGAVGKTCLLISYTT   23 (174)
T ss_pred             CeEEEEECCCCCCHHHHHHHHhc
Confidence            36999999999999999988775

The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1. While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively. Rac1 stimulates the formation of actin lamellipodia and membrane ruffles. It also plays a role in cell-matrix adhesion and cell anoikis. In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis. Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation. In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis. Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional

Probab=95.80  E-value=0.0049  Score=42.70  Aligned_cols=22  Identities=23%  Similarity=0.153  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        38 ~~~i~G~nGsGKSTLl~~i~Gl   59 (228)
T PRK10584         38 TIALIGESGSGKSTLLAILAGL   59 (228)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            6789999999999999999865

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=95.80  E-value=0.005  Score=42.97  Aligned_cols=22  Identities=14%  Similarity=0.012  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~   49 (235)
T cd03261          28 ILAIIGPSGSGKSTLLRLIVGL   49 (235)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999999855

The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein

Probab=95.80  E-value=0.005  Score=42.61  Aligned_cols=22  Identities=9%  Similarity=-0.011  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.+.=.
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~G~   52 (229)
T cd03254          31 TVAIVGPTGAGKTTLINLLMRF   52 (229)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4789999999999999998754

In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor. This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export. The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04157 Arl6 Arl6 subfamily

Probab=95.79  E-value=0.0052  Score=39.15  Aligned_cols=22  Identities=18%  Similarity=0.096  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      +++++|...+||||++.+++.-
T Consensus         1 ~i~~vG~~~~GKTsl~~~l~~~   22 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLKPE   22 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHccc
Confidence            5799999999999999988753

Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases. Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development. Arl6 is also believed to have a role in cilia or flagella function. Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p. Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism. Older literature suggests that A

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []

Probab=95.79  E-value=0.0067  Score=38.85  Aligned_cols=28  Identities=18%  Similarity=0.284  Sum_probs=25.1

Q ss_pred             eeeccCCCccchhhhhhhhhhcccceee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      +||.|..++|||+++++++-....|++.
T Consensus         2 vlL~G~~G~GKt~l~~~la~~~~~~~~~   29 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLARELAALLGRPVIR   29 (139)
T ss_dssp             EEEEESSSSSHHHHHHHHHHHHTCEEEE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhhcceEE
Confidence            6899999999999999999888877754

The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.79  E-value=0.005  Score=43.37  Aligned_cols=23  Identities=13%  Similarity=-0.054  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++-..
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl~   54 (251)
T PRK14251         32 LTALIGPSGCGKSTFLRCLNRMN   54 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHhhcc
Confidence            47899999999999999999653

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup

Probab=95.78  E-value=0.0051  Score=42.20  Aligned_cols=22  Identities=18%  Similarity=0.017  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~   49 (213)
T cd03259          28 FLALLGPSGCGKTTLLRLIAGL   49 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998864

This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK00300 gmk guanylate kinase; Provisional

Probab=95.76  E-value=0.0054  Score=41.67  Aligned_cols=22  Identities=18%  Similarity=0.066  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.+.|+.+|||||+++.++-.
T Consensus         7 ~i~i~G~sGsGKstl~~~l~~~   28 (205)
T PRK00300          7 LIVLSGPSGAGKSTLVKALLER   28 (205)
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5789999999999999988643

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated

Probab=95.76  E-value=0.0074  Score=41.55  Aligned_cols=26  Identities=15%  Similarity=0.065  Sum_probs=21.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .+|++|+..||||||...++--..+|
T Consensus         3 ~ili~G~~~sGKS~~a~~l~~~~~~~   28 (170)
T PRK05800          3 LILVTGGARSGKSRFAERLAAQSGLQ   28 (170)
T ss_pred             EEEEECCCCccHHHHHHHHHHHcCCC
Confidence            57999999999999999987655544

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional

Probab=95.75  E-value=0.0053  Score=43.09  Aligned_cols=22  Identities=9%  Similarity=-0.008  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~G~   52 (250)
T PRK11264         31 VVAIIGPSGSGKTTLLRCINLL   52 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999998854

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed

Probab=95.75  E-value=0.0097  Score=42.66  Aligned_cols=41  Identities=20%  Similarity=0.122  Sum_probs=28.1

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      -.+.|+|..+|||||+++.++-..   +--+.+++ ...||++.|
T Consensus        31 e~~~I~G~NGsGKSTLl~~i~Gl~~p~~G~i~~~~-~~~i~~v~q   74 (251)
T PRK09544         31 KILTLLGPNGAGKSTLVRVVLGLVAPDEGVIKRNG-KLRIGYVPQ   74 (251)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCCCCceEEEECC-ccCEEEecc
Confidence            367899999999999999988542   22233433 335676655

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)

Probab=95.75  E-value=0.0063  Score=40.95  Aligned_cols=26  Identities=19%  Similarity=0.229  Sum_probs=22.3

Q ss_pred             eeeccCCCccchhhhhhhhhhcccce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      |+|-|.+.|||||+.+.++--...|.
T Consensus         5 i~l~G~~gsGKst~a~~l~~~~~~~~   30 (175)
T cd00227           5 IILNGGSSAGKSSIARALQSVLAEPW   30 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHHhhCCCc
Confidence            68889999999999999987766553

Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL

Probab=95.75  E-value=0.0054  Score=42.42  Aligned_cols=22  Identities=14%  Similarity=-0.005  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        36 ~~~l~G~nGsGKSTLl~~i~G~   57 (224)
T TIGR02324        36 CVALSGPSGAGKSTLLKSLYAN   57 (224)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999999865

Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E

Probab=95.74  E-value=0.0053  Score=42.79  Aligned_cols=33  Identities=6%  Similarity=0.027  Sum_probs=24.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -.+.|+|..+||||||++.++-..   +--+.+|+.
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~   64 (237)
T cd03252          29 EVVGIVGRSGSGKSTLTKLIQRFYVPENGRVLVDGH   64 (237)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCcCCCCCEEEECCe
Confidence            367999999999999999988542   334555553

coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.

>PRK02496 adk adenylate kinase; Provisional

Probab=95.74  E-value=0.0056  Score=41.24  Aligned_cols=23  Identities=17%  Similarity=0.278  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|++++|..+|||||+++.+.-.
T Consensus         2 ~~i~i~G~pGsGKst~a~~la~~   24 (184)
T PRK02496          2 TRLIFLGPPGAGKGTQAVVLAEH   24 (184)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            47899999999999999877543

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family

Probab=95.74  E-value=0.012  Score=46.47  Aligned_cols=40  Identities=15%  Similarity=0.107  Sum_probs=28.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+||||||++.++-..   +--+.+ ++.+.||++.|
T Consensus       350 ~~~l~G~NGsGKSTLl~~l~G~~~p~~G~i~~-~~~~~i~~v~q  392 (552)
T TIGR03719       350 IVGVIGPNGAGKSTLFRMITGQEQPDSGTIKI-GETVKLAYVDQ  392 (552)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCCCCCCeEEEE-CCceEEEEEeC
Confidence            46799999999999999998542   222344 34457888766

Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis

Probab=95.73  E-value=0.0056  Score=41.23  Aligned_cols=23  Identities=26%  Similarity=0.137  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.++|..+||||||++.+.=..
T Consensus        30 ~~~i~G~nGsGKStLl~~l~G~~   52 (178)
T cd03247          30 KIALLGRSGSGKSTLLQLLTGDL   52 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            57899999999999999987653

The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes. CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space. In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional

Probab=95.73  E-value=0.0054  Score=42.80  Aligned_cols=23  Identities=9%  Similarity=-0.006  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        26 e~~~l~G~nGsGKSTLl~~l~Gl   48 (232)
T PRK10771         26 ERVAILGPSGAGKSTLLNLIAGF   48 (232)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            35789999999999999988755

>cd04121 Rab40 Rab40 subfamily

Probab=95.73  E-value=0.0048  Score=42.59  Aligned_cols=25  Identities=20%  Similarity=0.090  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|.+++|||+|+.+.+.
T Consensus         4 ~~~~KivviG~~~vGKTsll~~~~~   28 (189)
T cd04121           4 DYLLKFLLVGDSDVGKGEILASLQD   28 (189)
T ss_pred             CceeEEEEECCCCCCHHHHHHHHHc
Confidence            3568999999999999999999886

This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous. In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle. Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components. Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide d

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional

Probab=95.73  E-value=0.0054  Score=43.90  Aligned_cols=23  Identities=13%  Similarity=-0.018  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+|||||+++.++-.
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~Gl   50 (255)
T PRK11248         28 ELLVVLGPSGCGKTTLLNLIAGF   50 (255)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            35789999999999999999854

>TIGR02528 EutP ethanolamine utilization protein, EutP

Probab=95.72  E-value=0.0058  Score=38.68  Aligned_cols=22  Identities=14%  Similarity=0.235  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      |+.++|.+.+||||++.+++--
T Consensus         2 kv~liG~~~vGKSsL~~~l~~~   23 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGE   23 (142)
T ss_pred             eEEEECCCCCCHHHHHHHHcCC
Confidence            7899999999999999987643

This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.

>TIGR01978 sufC FeS assembly ATPase SufC

Probab=95.72  E-value=0.0056  Score=42.61  Aligned_cols=22  Identities=14%  Similarity=0.046  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        28 IHAIMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998865

SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional

Probab=95.72  E-value=0.0054  Score=42.83  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        33 ~~~i~G~nGsGKSTLl~~l~G~   54 (237)
T PRK11614         33 IVTLIGANGAGKTTLLGTLCGD   54 (237)
T ss_pred             EEEEECCCCCCHHHHHHHHcCC
Confidence            5789999999999999998754

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport

Probab=95.72  E-value=0.0056  Score=42.58  Aligned_cols=23  Identities=4%  Similarity=-0.065  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        33 ~~~l~G~nGsGKSTLl~~l~G~~   55 (233)
T cd03258          33 IFGIIGRSGAGKSTLIRCINGLE   55 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999987553

Other members of this system include the MetP permease and the MetQ substrate binding protein. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules

Probab=95.72  E-value=0.0056  Score=42.38  Aligned_cols=33  Identities=12%  Similarity=0.040  Sum_probs=24.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      --.+.|+|..+||||||++.++-.   ++--..+++
T Consensus        40 Ge~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g   75 (226)
T cd03248          40 GEVTALVGPSGSGKSTVVALLENFYQPQGGQVLLDG   75 (226)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCcCCCCcEEEECC
Confidence            346799999999999999999854   233345554

Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota

Probab=95.72  E-value=0.0057  Score=41.84  Aligned_cols=22  Identities=18%  Similarity=0.022  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        29 ~~~l~G~nGsGKSTLl~~l~G~   50 (211)
T cd03225          29 FVLIVGPNGSGKSTLLRLLNGL   50 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999998754

The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export

Probab=95.71  E-value=0.0058  Score=41.00  Aligned_cols=24  Identities=17%  Similarity=-0.014  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++=..
T Consensus        29 ~~~~l~G~nGsGKstLl~~i~G~~   52 (171)
T cd03228          29 EKVAIVGPSGSGKSTLLKLLLRLY   52 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcCC
Confidence            357899999999999999998663

They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins. The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities. The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD). ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import

Probab=95.71  E-value=0.0056  Score=42.89  Aligned_cols=23  Identities=17%  Similarity=0.031  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl~   52 (239)
T cd03296          30 LVALLGPSGSGKTTLLRLIAGLE   52 (239)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            47899999999999999998763

Responsible for energy coupling to the transport system. The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP). ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain

Probab=95.70  E-value=0.0058  Score=41.04  Aligned_cols=22  Identities=14%  Similarity=0.070  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.++|..+||||||++.++-.
T Consensus        30 ~~~i~G~nGsGKStLl~~l~G~   51 (173)
T cd03246          30 SLAIIGPSGSGKSTLARLILGL   51 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHhc
Confidence            5689999999999999999865

They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

>PRK14528 adenylate kinase; Provisional

Probab=95.70  E-value=0.0078  Score=41.37  Aligned_cols=27  Identities=19%  Similarity=0.336  Sum_probs=22.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +++++|+++|||||+++.++-...-|.
T Consensus         3 ~i~i~G~pGsGKtt~a~~la~~~~~~~   29 (186)
T PRK14528          3 NIIFMGPPGAGKGTQAKILCERLSIPQ   29 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCCCe
Confidence            689999999999999999885544443

>PF13521 AAA_28: AAA domain; PDB: 1LW7_A

Probab=95.69  E-value=0.0044  Score=40.99  Aligned_cols=22  Identities=14%  Similarity=0.182  Sum_probs=17.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ||.+.|+..|||||++.++--.
T Consensus         1 rI~i~G~~stGKTTL~~~L~~~   22 (163)
T PF13521_consen    1 RIVITGGPSTGKTTLIEALAAR   22 (163)
T ss_dssp             -EEEE--TTSHHHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHHc
Confidence            6899999999999999988755

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)

Probab=95.69  E-value=0.0058  Score=42.06  Aligned_cols=23  Identities=26%  Similarity=0.096  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~G~   54 (228)
T cd03257          32 ETLGLVGESGSGKSTLARAILGL   54 (228)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36799999999999999998854

The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE). The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis. The molecular mechanism of nickel uptake in many bacteria and most archaea is not known. Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides. The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.

>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another

Probab=95.69  E-value=0.0052  Score=40.04  Aligned_cols=19  Identities=21%  Similarity=0.270  Sum_probs=17.2

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      ++++|.-.||||||+.++-
T Consensus         1 V~v~G~~ssGKSTliNaLl   19 (168)
T PF00350_consen    1 VAVVGQFSSGKSTLINALL   19 (168)
T ss_dssp             EEEEEBTTSSHHHHHHHHH
T ss_pred             CEEEcCCCCCHHHHHHHHH
Confidence            5789999999999999984

Dynamins are large GTPases that belong to a protein superfamily [] that, in eukaryotic cells, includes classical dynamins, dynamin-like proteins, OPA1, Mx proteins, mitofusins and guanylate-binding proteins/atlastins [, , , ], and are involved in the scission of a wide range of vesicles and organelles. They play a role in many processes including budding of transport vesicles, division of organelles, cytokinesis and pathogen resistance. The minimal distinguishing architectural features that are common to all dynamins and are distinct from other GTPases are the structure of the large GTPase domain (300 amino acids) and the presence of two additional domains; the middle domain and the GTPase effector domain (GED), which are involved in oligomerization and regulation of the GTPase activity. This entry represents the GTPase domain, containing the GTP-binding motifs that are needed for guanine-nucleotide binding and hydrolysis. The conservation of these motifs is absolute except for the the final motif in guanylate-binding proteins. The GTPase catalytic activity can be stimulated by oligomerisation of the protein, which is mediated by interactions between the GTPase domain, the middle domain and the GED.; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 1JWY_B 1JX2_B 3ZVR_A 2AKA_B 3L43_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D ....

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome

Probab=95.68  E-value=0.006  Score=40.98  Aligned_cols=23  Identities=22%  Similarity=0.083  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.++|..+|||||+++.++-.
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~G~   50 (166)
T cd03223          28 DRLLITGPSGTGKSSLFRALAGL   50 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcC
Confidence            36789999999999999998765

The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation. To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes. X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family. The disease is characterized by a striking and unpredictable variation in phenotypic expression. Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt

>PRK14237 phosphate transporter ATP-binding protein; Provisional

Probab=95.68  E-value=0.013  Score=42.02  Aligned_cols=23  Identities=17%  Similarity=-0.005  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        48 ~~~I~G~nGsGKSTLl~~l~Gl~   70 (267)
T PRK14237         48 ITALIGPSGSGKSTYLRSLNRMN   70 (267)
T ss_pred             EEEEECCCCCCHHHHHHHHHhcc
Confidence            46799999999999999998653

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A

Probab=95.67  E-value=0.0029  Score=40.77  Aligned_cols=21  Identities=14%  Similarity=-0.015  Sum_probs=0.0

Q ss_pred             eeccCCCccchhhhhhhhhhc
Q psy6625          37 LLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~~   57 (76)
                      ++.|...|||||+++|+...-
T Consensus         3 viiG~N~sGKS~il~ai~~~~   23 (303)
T PF13304_consen    3 VIIGPNGSGKSNILEAIYFLF   23 (303)
T ss_dssp             ---------------------
T ss_pred             ccccccccccccccccccccc
Confidence            578999999999999998764

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.67  E-value=0.013  Score=41.26  Aligned_cols=33  Identities=9%  Similarity=0.050  Sum_probs=24.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh--------cccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT--------TSKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~--------~~~~~~~~~~~   67 (76)
                      .+.|+|..+|||||+++.+.-.        ++-.+.+++..
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~G~~~~~~~~~~~G~i~~~g~~   72 (251)
T PRK14270         32 ITALIGPSGCGKSTFLRCLNRMNDLISNVKIEGEVLLDGKN   72 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHHhccCcccCCCCccEEEECCEe
Confidence            5789999999999999998854        23445665543

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.66  E-value=0.0058  Score=43.85  Aligned_cols=33  Identities=9%  Similarity=0.010  Sum_probs=24.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      .+.|+|..+||||||++.++-..   +--+.+++..
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g~~   64 (271)
T PRK13638         29 VTGLVGANGCGKSTLFMNLSGLLRPQKGAVLWQGKP   64 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCCCCCccEEEECCEE
Confidence            57899999999999999988543   2335555543

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK

Probab=95.66  E-value=0.006  Score=42.98  Aligned_cols=23  Identities=22%  Similarity=0.010  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        30 e~~~i~G~nGsGKSTLl~~l~G~   52 (253)
T TIGR02323        30 EVLGIVGESGSGKSTLLGCLAGR   52 (253)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCC
Confidence            36799999999999999988865

Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1

Probab=95.65  E-value=0.0058  Score=42.60  Aligned_cols=23  Identities=13%  Similarity=-0.038  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --+.|+|..+|||||+++.++=.
T Consensus        30 e~~~l~G~nGsGKSTLl~~i~G~   52 (238)
T cd03249          30 KTVALVGSSGCGKSTVVSLLERF   52 (238)
T ss_pred             CEEEEEeCCCCCHHHHHHHHhcc
Confidence            35789999999999999998865

In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD. MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.

>PRK05480 uridine/cytidine kinase; Provisional

Probab=95.65  E-value=0.0068  Score=41.67  Aligned_cols=26  Identities=15%  Similarity=0.069  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +...+.+-|.++||||||++++.-.-
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~l~~~l   30 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVASTIYEEL   30 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHh
Confidence            45678899999999999999987654

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional

Probab=95.65  E-value=0.0061  Score=42.52  Aligned_cols=22  Identities=9%  Similarity=-0.075  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~G~   56 (225)
T PRK10247         35 FKLITGPSGCGKSTLLKIVASL   56 (225)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999998854

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis

Probab=95.64  E-value=0.0064  Score=39.85  Aligned_cols=20  Identities=20%  Similarity=0.197  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.|+|..+|||||++..++
T Consensus        17 ~v~I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          17 GVLITGDSGIGKTELALELI   36 (107)
T ss_pred             EEEEEcCCCCCHHHHHHHhh
Confidence            57899999999999999976

It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake

Probab=95.64  E-value=0.0062  Score=42.87  Aligned_cols=24  Identities=8%  Similarity=-0.050  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --.+.|+|..+|||||+++.++-.
T Consensus        47 Ge~~~i~G~NGsGKSTLl~~i~Gl   70 (236)
T cd03267          47 GEIVGFIGPNGAGKTTTLKILSGL   70 (236)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            346789999999999999998854

NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional

Probab=95.63  E-value=0.0063  Score=42.62  Aligned_cols=32  Identities=25%  Similarity=0.170  Sum_probs=24.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++=.   ++--+.+++.
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~   64 (242)
T PRK11124         30 TLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGN   64 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECCE
Confidence            5789999999999999998854   2333555544

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment

Probab=95.63  E-value=0.0063  Score=42.71  Aligned_cols=22  Identities=18%  Similarity=0.111  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~   50 (242)
T cd03295          29 FLVLIGPSGSGKTTTMKMINRL   50 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999998854

ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor

Probab=95.62  E-value=0.0063  Score=44.04  Aligned_cols=24  Identities=17%  Similarity=-0.013  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --.+.++|..+||||||++.++=.
T Consensus        26 Ge~~~IvG~nGsGKSTLlk~l~Gl   49 (255)
T cd03236          26 GQVLGLVGPNGIGKSTALKILAGK   49 (255)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            336899999999999999998865

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD

Probab=95.62  E-value=0.0064  Score=42.51  Aligned_cols=32  Identities=6%  Similarity=0.078  Sum_probs=23.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+||||||++.++-..   +--+.+++.
T Consensus        30 ~~~l~G~nGsGKSTLl~~l~G~~~p~~G~i~~~g~   64 (242)
T TIGR03411        30 LRVIIGPNGAGKTTMMDVITGKTRPDEGSVLFGGT   64 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCCeEEECCe
Confidence            57899999999999999988542   333455543

Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family

Probab=95.62  E-value=0.0067  Score=41.50  Aligned_cols=22  Identities=5%  Similarity=0.057  Sum_probs=19.3

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++|.|+..||||||+++.++..
T Consensus         2 ~~ltG~N~~GKst~l~~i~~~~   23 (185)
T smart00534        2 VIITGPNMGGKSTYLRQVGLIV   23 (185)
T ss_pred             EEEECCCCCcHHHHHHHHHHHH
Confidence            5899999999999999998543

>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae

Probab=95.62  E-value=0.0076  Score=42.18  Aligned_cols=27  Identities=22%  Similarity=0.241  Sum_probs=22.3

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      |+|=|++-|||||+++++......|.+
T Consensus         4 I~LNG~sSSGKSsia~~Lq~~~~~p~~   30 (174)
T PF07931_consen    4 IILNGPSSSGKSSIARALQERLPEPWL   30 (174)
T ss_dssp             EEEEE-TTSSHHHHHHHHHHHSSS-EE
T ss_pred             EEEeCCCCCCHHHHHHHHHHhCcCCeE
Confidence            577799999999999999999999854

Chloramphenicol (Cm) is a metabolite produced by this bacterium that can inhibit ribosomal peptidyl transferase activity and therefore protein production. By transferring a phosphate group to the C-3 hydroxyl group of Cm, CPT inactivates this potentially lethal metabolite [, ]. ; GO: 0005524 ATP binding, 0016740 transferase activity; PDB: 1QHX_A 1QHN_A 1GRR_A 1QHY_A 1QHS_A 1GRQ_A.

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules

Probab=95.61  E-value=0.0067  Score=39.89  Aligned_cols=24  Identities=17%  Similarity=-0.009  Sum_probs=20.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.++|..+||||||+++++-..
T Consensus        26 ~~~~i~G~nGsGKStll~~l~g~~   49 (157)
T cd00267          26 EIVALVGPNGSGKSTLLRAIAGLL   49 (157)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            357899999999999999998654

The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.61  E-value=0.0064  Score=42.84  Aligned_cols=23  Identities=4%  Similarity=-0.094  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~Gl~   53 (241)
T PRK14250         31 IYTIVGPSGAGKSTLIKLINRLI   53 (241)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999988653

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)

Probab=95.59  E-value=0.0067  Score=41.55  Aligned_cols=23  Identities=22%  Similarity=0.119  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.++|..+|||||+++.++-.
T Consensus        35 ~~~~i~G~nGsGKSTLl~~l~Gl   57 (207)
T cd03369          35 EKIGIVGRTGAGKSTLILALFRF   57 (207)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcc
Confidence            36789999999999999999754

NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters. Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional

Probab=95.58  E-value=0.013  Score=43.92  Aligned_cols=23  Identities=26%  Similarity=0.199  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||++++++-..
T Consensus        44 ~~~ivG~sGsGKSTL~~~l~Gl~   66 (330)
T PRK09473         44 TLGIVGESGSGKSQTAFALMGLL   66 (330)
T ss_pred             EEEEECCCCchHHHHHHHHHcCC
Confidence            47899999999999999998665

>cd01875 RhoG RhoG subfamily

Probab=95.58  E-value=0.0075  Score=40.93  Aligned_cols=23  Identities=17%  Similarity=0.231  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+.+|||+++...+.
T Consensus         3 ~~ki~~vG~~~vGKTsli~~~~~   25 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLICYTT   25 (191)
T ss_pred             cEEEEEECCCCCCHHHHHHHHHh
Confidence            57999999999999999998774

RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding. However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif. Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1. The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor. Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology. RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists. Most Rho proteins contain a lipid modification site at the C-termin

>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria

Probab=95.58  E-value=0.0068  Score=42.38  Aligned_cols=20  Identities=25%  Similarity=0.292  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      +|||+|..+|||||+..++.
T Consensus         2 ~IlllG~tGsGKSs~~N~il   21 (212)
T PF04548_consen    2 RILLLGKTGSGKSSLGNSIL   21 (212)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            78999999999999999874

The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 []. The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....

>PRK14526 adenylate kinase; Provisional

Probab=95.58  E-value=0.007  Score=43.05  Aligned_cols=23  Identities=26%  Similarity=0.179  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++|+|+.+|||||+++.++-..
T Consensus         2 ~i~l~G~pGsGKsT~a~~La~~~   24 (211)
T PRK14526          2 KLVFLGPPGSGKGTIAKILSNEL   24 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            68999999999999999887443

>PRK14243 phosphate transporter ATP-binding protein; Provisional

Probab=95.57  E-value=0.015  Score=41.71  Aligned_cols=21  Identities=5%  Similarity=-0.102  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++-
T Consensus        38 ~~~i~G~nGsGKSTLl~~l~G   58 (264)
T PRK14243         38 ITAFIGPSGCGKSTILRCFNR   58 (264)
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999983

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional

Probab=95.57  E-value=0.0066  Score=43.43  Aligned_cols=23  Identities=17%  Similarity=-0.074  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++-.
T Consensus        38 e~~~i~G~nGsGKSTLl~~l~Gl   60 (265)
T PRK10575         38 KVTGLIGHNGSGKSTLLKMLGRH   60 (265)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCC
Confidence            35789999999999999998855

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=95.56  E-value=0.007  Score=42.21  Aligned_cols=22  Identities=14%  Similarity=-0.044  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+++|..+|||||++.+++-.
T Consensus        25 ~~~i~GpNGsGKStll~ai~~~   46 (243)
T cd03272          25 HNVVVGRNGSGKSNFFAAIRFV   46 (243)
T ss_pred             cEEEECCCCCCHHHHHHHHHHH
Confidence            5689999999999999999843

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>cd01131 PilT Pilus retraction ATPase PilT

Probab=95.56  E-value=0.007  Score=41.98  Aligned_cols=21  Identities=19%  Similarity=0.113  Sum_probs=17.7

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|+.+|||||++.++.--
T Consensus         4 ilI~GptGSGKTTll~~ll~~   24 (198)
T cd01131           4 VLVTGPTGSGKSTTLAAMIDY   24 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            688999999999999985533

PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.

>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway

Probab=95.55  E-value=0.0068  Score=43.08  Aligned_cols=23  Identities=13%  Similarity=0.057  Sum_probs=19.3

Q ss_pred             eeeccCCCccchhhhhhhhhhcc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +-+.|..+||||||++.+.-...
T Consensus         2 igI~G~sGSGKTTla~~L~~~l~   24 (220)
T cd02025           2 IGIAGSVAVGKSTTARVLQALLS   24 (220)
T ss_pred             EEeeCCCCCCHHHHHHHHHHHHh
Confidence            35789999999999999887653

The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.

>PRK10908 cell division protein FtsE; Provisional

Probab=95.54  E-value=0.0071  Score=41.85  Aligned_cols=24  Identities=13%  Similarity=0.081  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++-..
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~G~~   52 (222)
T PRK10908         29 EMAFLTGHSGAGKSTLLKLICGIE   52 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            356899999999999999988653

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional

Probab=95.54  E-value=0.0069  Score=43.55  Aligned_cols=22  Identities=23%  Similarity=-0.041  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        35 ~~~l~G~nGsGKSTLl~~l~Gl   56 (272)
T PRK15056         35 IAALVGVNGSGKSTLFKALMGF   56 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999999854

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.54  E-value=0.007  Score=43.87  Aligned_cols=22  Identities=14%  Similarity=0.003  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.+|-.
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~Gl   56 (279)
T PRK13650         35 WLSIIGHNGSGKSTTVRLIDGL   56 (279)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999999865

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]

Probab=95.53  E-value=0.007  Score=45.09  Aligned_cols=31  Identities=13%  Similarity=0.157  Sum_probs=22.3

Q ss_pred             ceeeccCCCccchhhhhhhh---hhcccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALC---TTTSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~---~~~~~~~~~~~   65 (76)
                      .+.++|.++|||||||..+=   .+++--..|++
T Consensus        30 vv~iiGpSGSGKSTlLRclN~LE~~~~G~I~i~g   63 (240)
T COG1126          30 VVVIIGPSGSGKSTLLRCLNGLEEPDSGSITVDG   63 (240)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCcCCCCceEEECC
Confidence            46889999999999996432   34555566665

>PRK13549 xylose transporter ATP-binding subunit; Provisional

Probab=95.53  E-value=0.011  Score=45.94  Aligned_cols=23  Identities=13%  Similarity=-0.091  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus       290 ~~~l~G~NGsGKSTLlk~i~Gl~  312 (506)
T PRK13549        290 ILGIAGLVGAGRTELVQCLFGAY  312 (506)
T ss_pred             EEEEeCCCCCCHHHHHHHHhCCC
Confidence            46799999999999999999654

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters

Probab=95.52  E-value=0.0071  Score=41.50  Aligned_cols=22  Identities=14%  Similarity=0.002  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        27 ~~~l~G~nGsGKSTLl~~l~G~   48 (213)
T cd03235          27 FLAIVGPNGAGKSTLLKAILGL   48 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHcCC
Confidence            5789999999999999998765

This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc. The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor. The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri. Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional

Probab=95.51  E-value=0.0072  Score=43.40  Aligned_cols=22  Identities=5%  Similarity=-0.127  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~Gl   56 (269)
T PRK11831         35 ITAIMGPSGIGKTTLLRLIGGQ   56 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998855

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.51  E-value=0.014  Score=42.89  Aligned_cols=22  Identities=14%  Similarity=-0.058  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        73 ~~~IvG~nGsGKSTLl~~L~Gl   94 (305)
T PRK14264         73 VTALIGPSGCGKSTFLRCLNRM   94 (305)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5679999999999999999855

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.51  E-value=0.0076  Score=40.38  Aligned_cols=22  Identities=23%  Similarity=0.055  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        28 ~~~l~G~nGsGKSTLl~~i~G~   49 (163)
T cd03216          28 VHALLGENGAGKSTLMKILSGL   49 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5689999999999999988744

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. Pentoses include xylose, arabinose, and ribose. Important hexoses include glucose, galactose, and fructose. In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment

Probab=95.49  E-value=0.0077  Score=40.63  Aligned_cols=22  Identities=18%  Similarity=0.048  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.+.=.
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~   49 (178)
T cd03229          28 IVALLGPSGSGKSTLLRCIAGL   49 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5679999999999999998744

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance

Probab=95.49  E-value=0.0076  Score=41.21  Aligned_cols=33  Identities=9%  Similarity=0.048  Sum_probs=24.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~~   67 (76)
                      .+.++|..+||||||++.+.=.   ++--+.+|+..
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~~~g~~   63 (208)
T cd03268          28 IYGFLGPNGAGKTTTMKIILGLIKPDSGEITFDGKS   63 (208)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcCCCceEEEECCCc
Confidence            5689999999999999998754   23335555543

Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.49  E-value=0.0075  Score=42.52  Aligned_cols=21  Identities=5%  Similarity=-0.092  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++-
T Consensus        31 ~~~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14245         31 VVAFIGPSGCGKSTFLRLFNR   51 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhh
Confidence            478999999999999999974

>PRK13651 cobalt transporter ATP-binding subunit; Provisional

Probab=95.49  E-value=0.0073  Score=44.74  Aligned_cols=22  Identities=14%  Similarity=0.016  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        35 ~v~iiG~nGsGKSTLl~~L~Gl   56 (305)
T PRK13651         35 FIAIIGQTGSGKTTFIEHLNAL   56 (305)
T ss_pred             EEEEECCCCCcHHHHHHHHhCC
Confidence            6899999999999999999965

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)

Probab=95.49  E-value=0.0077  Score=40.76  Aligned_cols=23  Identities=17%  Similarity=-0.071  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.++|..+||||||++.++-..
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~   50 (182)
T cd03215          28 IVGIAGLVGNGQTELAEALFGLR   50 (182)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999988653

The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis. In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains. However, it is assumed that two copies of the ABC domains are present in the assembled transporter.

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system

Probab=95.49  E-value=0.0076  Score=42.16  Aligned_cols=22  Identities=18%  Similarity=0.002  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~   50 (236)
T TIGR03864        29 FVALLGPNGAGKSTLFSLLTRL   50 (236)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5689999999999999998854

Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.

>PHA02530 pseT polynucleotide kinase; Provisional

Probab=95.48  E-value=0.0074  Score=43.34  Aligned_cols=22  Identities=14%  Similarity=0.063  Sum_probs=18.3

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|..+|||||+.+.+.-.-
T Consensus         5 iil~G~pGSGKSTla~~L~~~~   26 (300)
T PHA02530          5 ILTVGVPGSGKSTWAREFAAKN   26 (300)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHC
Confidence            5677999999999999876544

>PRK06762 hypothetical protein; Provisional

Probab=95.48  E-value=0.0079  Score=39.68  Aligned_cols=22  Identities=14%  Similarity=0.098  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++-|..+|||||+++.++---
T Consensus         5 i~i~G~~GsGKST~A~~L~~~l   26 (166)
T PRK06762          5 IIIRGNSGSGKTTIAKQLQERL   26 (166)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            5778999999999999887543

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)

Probab=95.48  E-value=0.012  Score=40.66  Aligned_cols=25  Identities=20%  Similarity=0.174  Sum_probs=20.5

Q ss_pred             eeeccCCCccchhhhhhhhhhcccc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|++|...||||+|..++..-.+.|
T Consensus         2 ~li~G~~~sGKS~~a~~~~~~~~~~   26 (169)
T cd00544           2 ILVTGGARSGKSRFAERLAAELGGP   26 (169)
T ss_pred             EEEECCCCCCHHHHHHHHHHhcCCC
Confidence            5899999999999999987554433

CobU is bifunctional cobalbumin biosynthesis enzymes which display adenosylcobinamide kinase and adenosylcobinamide phosphate guanyltransferase activity. This enzyme is a homotrimer with a propeller-like shape.

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed

Probab=95.48  E-value=0.0076  Score=42.18  Aligned_cols=24  Identities=17%  Similarity=0.040  Sum_probs=21.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+|||||+++.++-..
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~Gl~   51 (248)
T PRK09580         28 EVHAIMGPNGSGKSTLSATLAGRE   51 (248)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCCc
Confidence            367899999999999999988763

>cd04147 Ras_dva Ras-dva subfamily

Probab=95.47  E-value=0.0079  Score=40.85  Aligned_cols=21  Identities=10%  Similarity=0.085  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      |++++|...+|||||+..++.
T Consensus         1 kv~vvG~~~vGKTsll~~~~~   21 (198)
T cd04147           1 RLVFMGAAGVGKTALIQRFLY   21 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHh
Confidence            789999999999999998864

Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date. In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm. Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1. Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9. Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.

>PLN03118 Rab family protein; Provisional

Probab=95.47  E-value=0.008  Score=41.20  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=21.1

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..+|++++|.+.+|||||+.++.
T Consensus        13 ~~~kv~ivG~~~vGKTsli~~l~   35 (211)
T PLN03118         13 LSFKILLIGDSGVGKSSLLVSFI   35 (211)
T ss_pred             cceEEEEECcCCCCHHHHHHHHH
Confidence            46899999999999999999886

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C

Probab=95.47  E-value=0.0079  Score=41.41  Aligned_cols=22  Identities=27%  Similarity=0.161  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.++|..+||||||++.++=.
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~G~   53 (221)
T cd03244          32 KVGIVGRTGSGKSSLLLALFRL   53 (221)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            4789999999999999988754

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient

Probab=95.46  E-value=0.0079  Score=41.66  Aligned_cols=23  Identities=13%  Similarity=-0.067  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.+.-..
T Consensus        28 ~~~i~G~nGsGKSTLl~~i~G~~   50 (227)
T cd03260          28 ITALIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhc
Confidence            57899999999999999988665

The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA

Probab=95.46  E-value=0.008  Score=41.00  Aligned_cols=23  Identities=13%  Similarity=-0.091  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.++|..+||||||++.++=.
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~G~   49 (198)
T TIGR01189        27 EALQVTGPNGIGKTTLLRILAGL   49 (198)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCC
Confidence            35789999999999999988754

This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit

Probab=95.46  E-value=0.013  Score=45.55  Aligned_cols=35  Identities=11%  Similarity=0.102  Sum_probs=25.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh---cccceeeeCce
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT---TSKPMMINNNT   67 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~~   67 (76)
                      --++.+.|..+|||||+++.++-.   ++--..||+..
T Consensus       361 G~~vaIvG~SGsGKSTLl~lL~g~~~p~~G~I~i~g~~  398 (529)
T TIGR02868       361 GERVAILGPSGSGKSTLLMLLTGLLDPLQGEVTLDGVS  398 (529)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECCEE
Confidence            347799999999999999998743   33345666543

The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes

Probab=95.46  E-value=0.0084  Score=41.30  Aligned_cols=21  Identities=19%  Similarity=0.165  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .++|.|+..||||||++++..
T Consensus        30 ~~~ltG~Ng~GKStll~~i~~   50 (200)
T cd03280          30 VLVITGPNAGGKTVTLKTLGL   50 (200)
T ss_pred             EEEEECCCCCChHHHHHHHHH
Confidence            389999999999999999773

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars

Probab=95.46  E-value=0.0089  Score=35.19  Aligned_cols=21  Identities=14%  Similarity=0.093  Sum_probs=18.4

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +.+-|...|||||+++++.-.
T Consensus         2 i~i~G~~gsGKst~~~~l~~~   22 (69)
T cd02019           2 IAITGGSGSGKSTVAKKLAEQ   22 (69)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            467899999999999998866

Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.46  E-value=0.008  Score=41.45  Aligned_cols=31  Identities=13%  Similarity=0.104  Sum_probs=23.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      .+.++|..+||||||++.++-..   +--+.+++
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g   63 (207)
T PRK13539         30 ALVLTGPNGSGKTTLLRLIAGLLPPAAGTIKLDG   63 (207)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECC
Confidence            56899999999999999988653   33344544

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional

Probab=95.45  E-value=0.0081  Score=41.94  Aligned_cols=22  Identities=18%  Similarity=0.159  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        15 ~~~l~G~NGsGKSTLlk~i~Gl   36 (213)
T PRK15177         15 HIGILAAPGSGKTTLTRLLCGL   36 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5689999999999999998855

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.44  E-value=0.0081  Score=40.97  Aligned_cols=32  Identities=9%  Similarity=-0.047  Sum_probs=24.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +-.+.+++.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~   62 (195)
T PRK13541         28 ITYIKGANGCGKSSLLRMIAGIMQPSSGNIYYKNC   62 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECCc
Confidence            57899999999999999988653   333455543

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters

Probab=95.44  E-value=0.0081  Score=41.33  Aligned_cols=23  Identities=17%  Similarity=0.079  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.+.-..
T Consensus        32 ~~~i~G~nGsGKSTLl~~i~G~~   54 (220)
T cd03245          32 KVAIIGRVGSGKSTLLKLLAGLY   54 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCc
Confidence            57899999999999999987653

Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2. A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.44  E-value=0.008  Score=42.67  Aligned_cols=22  Identities=9%  Similarity=-0.085  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        40 ~~~l~G~nGsGKSTLl~~l~G~   61 (259)
T PRK14274         40 VTAIIGPSGCGKSTFIKTLNLM   61 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5789999999999999998854

>PRK00089 era GTPase Era; Reviewed

Probab=95.44  E-value=0.013  Score=42.26  Aligned_cols=29  Identities=17%  Similarity=0.098  Sum_probs=23.1

Q ss_pred             ccceeeccCCCccchhhhhhhh-----hhcccce
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC-----TTTSKPM   61 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~-----~~~~~~~   61 (76)
                      .-.+.++|...||||||+++++     +++.+|-
T Consensus         5 ~g~V~iiG~pn~GKSTLin~L~g~~~~~vs~~~~   38 (292)
T PRK00089          5 SGFVAIVGRPNVGKSTLLNALVGQKISIVSPKPQ   38 (292)
T ss_pred             eEEEEEECCCCCCHHHHHHHHhCCceeecCCCCC
Confidence            4568999999999999999885     4555553

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.43  E-value=0.018  Score=41.92  Aligned_cols=32  Identities=16%  Similarity=0.040  Sum_probs=24.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.+|-..   +--+.+++.
T Consensus        35 ~~~iiG~NGaGKSTLl~~l~Gl~~p~~G~i~~~g~   69 (287)
T PRK13641         35 FVALVGHTGSGKSTLMQHFNALLKPSSGTITIAGY   69 (287)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECCE
Confidence            56799999999999999999653   333555543

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.43  E-value=0.008  Score=43.70  Aligned_cols=32  Identities=9%  Similarity=0.095  Sum_probs=24.3

Q ss_pred             cceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      -.+.|+|..+|||||+++.+|-.   ++--+.+++
T Consensus        34 e~~~i~G~nGsGKSTLl~~L~Gl~~p~~G~i~~~g   68 (286)
T PRK13646         34 KYYAIVGQTGSGKSTLIQNINALLKPTTGTVTVDD   68 (286)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECC
Confidence            35789999999999999999854   333345554

>TIGR00436 era GTP-binding protein Era

Probab=95.42  E-value=0.009  Score=43.01  Aligned_cols=20  Identities=15%  Similarity=-0.006  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ++.|+|...+||||++.+++
T Consensus         2 ~V~liG~pnvGKSTLln~L~   21 (270)
T TIGR00436         2 FVAILGRPNVGKSTLLNQLH   21 (270)
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            67899999999999999986

Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.

>PRK14236 phosphate transporter ATP-binding protein; Provisional

Probab=95.42  E-value=0.018  Score=41.46  Aligned_cols=22  Identities=5%  Similarity=-0.096  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.++|..+|||||+++.++-.
T Consensus        53 ~~~I~G~nGsGKSTLl~~laGl   74 (272)
T PRK14236         53 VTAFIGPSGCGKSTLLRCFNRM   74 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHHhc
Confidence            5689999999999999999755

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB

Probab=95.41  E-value=0.0084  Score=41.27  Aligned_cols=23  Identities=4%  Similarity=-0.133  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.+.-.
T Consensus        24 e~~~i~G~nGsGKSTLl~~l~G~   46 (214)
T cd03297          24 EVTGIFGASGAGKSTLLRCIAGL   46 (214)
T ss_pred             eeEEEECCCCCCHHHHHHHHhCC
Confidence            46789999999999999998754

ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional

Probab=95.41  E-value=0.0082  Score=42.86  Aligned_cols=32  Identities=19%  Similarity=0.127  Sum_probs=24.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        30 ~~~i~G~nGsGKSTLl~~i~G~~~p~~G~i~~~g~   64 (258)
T PRK13548         30 VVAILGPNGAGKSTLLRALSGELSPDSGEVRLNGR   64 (258)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCCEEEECCE
Confidence            57899999999999999998763   223455553

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D

Probab=95.40  E-value=0.0085  Score=42.02  Aligned_cols=22  Identities=9%  Similarity=-0.049  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        13 ~~~i~G~nGsGKSTLl~~l~Gl   34 (230)
T TIGR01184        13 FISLIGHSGCGKSTLLNLISGL   34 (230)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998754

This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional

Probab=95.39  E-value=0.0084  Score=42.47  Aligned_cols=22  Identities=9%  Similarity=-0.038  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        30 ~~~l~G~nGsGKSTLl~~l~Gl   51 (255)
T PRK11231         30 ITALIGPNGCGKSTLLKCFARL   51 (255)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998754

>PRK10636 putative ABC transporter ATP-binding protein; Provisional

Probab=95.39  E-value=0.018  Score=46.59  Aligned_cols=40  Identities=18%  Similarity=0.209  Sum_probs=28.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      ++.|+|..+||||||++.++-..   +--+.+++ .+.||++.|
T Consensus       340 ~~~l~G~NGsGKSTLlk~l~G~~~p~~G~i~~~~-~~~igy~~Q  382 (638)
T PRK10636        340 RIGLLGRNGAGKSTLIKLLAGELAPVSGEIGLAK-GIKLGYFAQ  382 (638)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCCeEEECC-CEEEEEecC
Confidence            67799999999999999988543   22234443 367887765

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion

Probab=95.38  E-value=0.0086  Score=41.50  Aligned_cols=20  Identities=10%  Similarity=-0.086  Sum_probs=17.7

Q ss_pred             cceeeccCCCccchhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~   53 (76)
                      -.+.|+|..+|||||+++.+
T Consensus        22 ~~~~l~G~nG~GKSTLl~~i   41 (176)
T cd03238          22 VLVVVTGVSGSGKSTLVNEG   41 (176)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            36789999999999999875

Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins. Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)

Probab=95.37  E-value=0.009  Score=40.99  Aligned_cols=24  Identities=13%  Similarity=-0.040  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++=..
T Consensus        36 e~~~l~G~nGsGKStLl~~i~Gl~   59 (194)
T cd03213          36 ELTAIMGPSGAGKSTLLNALAGRR   59 (194)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            367899999999999999988664

DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional

Probab=95.36  E-value=0.0089  Score=41.03  Aligned_cols=32  Identities=6%  Similarity=-0.020  Sum_probs=24.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-.   ++-...+++.
T Consensus        29 ~~~l~G~nGsGKSTLl~~l~G~~~p~~G~v~~~g~   63 (204)
T PRK13538         29 LVQIEGPNGAGKTSLLRILAGLARPDAGEVLWQGE   63 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCcEEEECCE
Confidence            5789999999999999998854   3444555543

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor

Probab=95.36  E-value=0.0088  Score=42.93  Aligned_cols=23  Identities=13%  Similarity=-0.052  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++-..
T Consensus        27 ~~~i~G~NGsGKSTLlk~L~G~~   49 (246)
T cd03237          27 VIGILGPNGIGKTTFIKMLAGVL   49 (246)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            46899999999999999987653

The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.36  E-value=0.0086  Score=43.41  Aligned_cols=22  Identities=9%  Similarity=-0.153  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        39 ~~~l~G~nGsGKSTLl~~l~Gl   60 (289)
T PRK13645         39 VTCVIGTTGSGKSTMIQLTNGL   60 (289)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999999855

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.35  E-value=0.0089  Score=42.74  Aligned_cols=21  Identities=10%  Similarity=-0.061  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++-
T Consensus        49 ~~~i~G~nGsGKSTLl~~l~G   69 (268)
T PRK14248         49 VTALIGPSGCGKSTFLRSINR   69 (268)
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999975

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein

Probab=95.35  E-value=0.009  Score=42.18  Aligned_cols=23  Identities=26%  Similarity=0.130  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~   50 (252)
T TIGR03005        28 KVALIGPSGSGKSTILRILMTLE   50 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999998654

Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends

Probab=95.34  E-value=0.0087  Score=41.60  Aligned_cols=21  Identities=14%  Similarity=0.001  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.++|..+|||||++++++.
T Consensus        30 ~~~i~G~NGsGKSTll~~i~~   50 (213)
T cd03279          30 LFLICGPTGAGKSTILDAITY   50 (213)
T ss_pred             EEEEECCCCCCHHHHHHHhee
Confidence            578999999999999999884

They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.

>PRK04213 GTP-binding protein; Provisional

Probab=95.33  E-value=0.01  Score=39.84  Aligned_cols=24  Identities=8%  Similarity=0.122  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..|++++|-..+||||++.+++-
T Consensus         8 ~~~~i~i~G~~~~GKSsLin~l~~   31 (201)
T PRK04213          8 RKPEIVFVGRSNVGKSTLVRELTG   31 (201)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            457999999999999999999874

>cd04143 Rhes_like Rhes_like subfamily

Probab=95.33  E-value=0.009  Score=43.05  Aligned_cols=22  Identities=9%  Similarity=0.113  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||+|+.+.+.
T Consensus         1 ~KVvvlG~~gvGKTSLi~r~~~   22 (247)
T cd04143           1 YRMVVLGASKVGKTAIVSRFLG   22 (247)
T ss_pred             CEEEEECcCCCCHHHHHHHHHc
Confidence            5899999999999999999973

This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1). These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization. Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum. Rhes expression is controlled by thyroid hormones. In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane. Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling. Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity. Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.33  E-value=0.009  Score=43.17  Aligned_cols=21  Identities=5%  Similarity=-0.032  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+||||||++.++-
T Consensus        48 ~~~IiG~nGsGKSTLl~~l~G   68 (274)
T PRK14265         48 IIAFIGPSGCGKSTLLRCFNR   68 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            578999999999999999984

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea

Probab=95.32  E-value=0.0092  Score=42.94  Aligned_cols=23  Identities=9%  Similarity=-0.005  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        52 ~~~l~G~nGsGKSTLl~~L~Gl~   74 (269)
T cd03294          52 IFVIMGLSGSGKSTLLRCINRLI   74 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            57899999999999999987653

This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=95.31  E-value=0.019  Score=42.81  Aligned_cols=42  Identities=19%  Similarity=0.263  Sum_probs=29.6

Q ss_pred             ceeeccCCCccchhhhhhhhh---hcccceeeeCcee-----EEeeeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT---TTSKPMMINNNTV-----EIGVLVQK   76 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~---~~~~~~~~~~~~~-----~~~~~~~~   76 (76)
                      -+-++|.++|||||+++..-=   -++--+.+++..|     ++|+..|+
T Consensus        31 fvsilGpSGcGKSTLLriiAGL~~p~~G~V~~~g~~v~~p~~~~~~vFQ~   80 (248)
T COG1116          31 FVAILGPSGCGKSTLLRLIAGLEKPTSGEVLLDGRPVTGPGPDIGYVFQE   80 (248)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECCcccCCCCCCEEEEecc
Confidence            357899999999999987542   2333455666554     78888774

>PRK14241 phosphate transporter ATP-binding protein; Provisional

Probab=95.31  E-value=0.0091  Score=42.36  Aligned_cols=23  Identities=9%  Similarity=-0.080  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.++|..+||||||++.+.-.
T Consensus        31 e~~~i~G~nGsGKSTLl~~laGl   53 (258)
T PRK14241         31 SVTAFIGPSGCGKSTVLRTLNRM   53 (258)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcc
Confidence            35789999999999999998854

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.30  E-value=0.0094  Score=42.87  Aligned_cols=22  Identities=14%  Similarity=-0.061  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++=.
T Consensus        35 ~~~l~G~nGsGKSTLl~~i~Gl   56 (280)
T PRK13649         35 YTAFIGHTGSGKSTIMQLLNGL   56 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998854

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP

Probab=95.30  E-value=0.0097  Score=40.79  Aligned_cols=23  Identities=9%  Similarity=-0.099  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++-..
T Consensus        26 ~~~l~G~nGsGKSTLl~~l~gl~   48 (211)
T cd03298          26 ITAIVGPSGSGKSTLLNLIAGFE   48 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999887553

Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.30  E-value=0.0095  Score=42.09  Aligned_cols=22  Identities=14%  Similarity=-0.062  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~Gl   56 (254)
T PRK14273         35 ITALIGPSGCGKSTFLRTLNRM   56 (254)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999998854

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.29  E-value=0.0095  Score=42.07  Aligned_cols=21  Identities=10%  Similarity=-0.059  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++=
T Consensus        34 ~~~i~G~nGsGKSTLl~~l~G   54 (253)
T PRK14261         34 VTALIGPSGCGKSTLLRCFNR   54 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            478999999999999999983

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function

Probab=95.29  E-value=0.0097  Score=41.39  Aligned_cols=22  Identities=14%  Similarity=-0.132  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .++|+|..+|||||++++++-.
T Consensus        24 ~~~i~G~nGsGKStll~al~~l   45 (197)
T cd03278          24 LTAIVGPNGSGKSNIIDAIRWV   45 (197)
T ss_pred             cEEEECCCCCCHHHHHHHHHHH
Confidence            5789999999999999999855

Barmotin belongs to the SMC protein family. SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains. Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, w

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional

Probab=95.29  E-value=0.0095  Score=42.37  Aligned_cols=23  Identities=22%  Similarity=0.040  Sum_probs=20.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        32 ~~~i~G~nGsGKSTLl~~i~G~~   54 (262)
T PRK09984         32 MVALLGPSGSGKSTLLRHLSGLI   54 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            57999999999999999998654

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed

Probab=95.29  E-value=0.0096  Score=41.65  Aligned_cols=33  Identities=9%  Similarity=0.116  Sum_probs=24.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++..
T Consensus        29 ~~~l~G~nGsGKSTLl~~l~G~~~~~~G~i~~~g~~   64 (240)
T PRK09493         29 VVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLK   64 (240)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECCEE
Confidence            57899999999999999988553   2335555543

>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity

Probab=95.29  E-value=0.0067  Score=43.84  Aligned_cols=19  Identities=16%  Similarity=0.038  Sum_probs=15.6

Q ss_pred             eccCCCccchhhhhhhhhh
Q psy6625          38 LLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        38 LLGaGESGKST~~~~~~~~   56 (76)
                      ++|+++||||||.+++.-.
T Consensus         1 ViGpaGSGKTT~~~~~~~~   19 (238)
T PF03029_consen    1 VIGPAGSGKTTFCKGLSEW   19 (238)
T ss_dssp             -EESTTSSHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHH
Confidence            4699999999999987643

; GO: 0000166 nucleotide binding; PDB: 1YR7_A 1YRA_B 1YR8_A 1YR6_A 1YR9_A 1YRB_A 2OXR_A.

>PRK14240 phosphate transporter ATP-binding protein; Provisional

Probab=95.29  E-value=0.0097  Score=41.87  Aligned_cols=21  Identities=14%  Similarity=-0.050  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++-
T Consensus        31 ~~~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14240         31 VTALIGPSGCGKSTFLRTLNR   51 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            578999999999999999985

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional

Probab=95.26  E-value=0.0098  Score=43.17  Aligned_cols=24  Identities=17%  Similarity=-0.071  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++=..
T Consensus        51 e~~~liG~NGsGKSTLlk~L~Gl~   74 (264)
T PRK13546         51 DVIGLVGINGSGKSTLSNIIGGSL   74 (264)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            357899999999999999998664

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export

Probab=95.26  E-value=0.0099  Score=41.63  Aligned_cols=23  Identities=13%  Similarity=0.034  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.++=.
T Consensus        49 e~~~i~G~nGsGKSTLl~~l~G~   71 (224)
T cd03220          49 ERIGLIGRNGAGKSTLLRLLAGI   71 (224)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36789999999999999988754

Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.

>PRK14235 phosphate transporter ATP-binding protein; Provisional

Probab=95.26  E-value=0.0098  Score=42.66  Aligned_cols=23  Identities=9%  Similarity=-0.077  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        47 ~~~i~G~nGsGKSTLl~~l~Gl~   69 (267)
T PRK14235         47 VTAFIGPSGCGKSTFLRCLNRMN   69 (267)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhc
Confidence            47899999999999999998653

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=95.26  E-value=0.0096  Score=43.34  Aligned_cols=21  Identities=24%  Similarity=0.175  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .++++|..+|||||+++.+--
T Consensus        32 ~~~i~G~nGsGKSTL~~~l~G   52 (235)
T COG1122          32 RVLLIGPNGSGKSTLLKLLNG   52 (235)
T ss_pred             EEEEECCCCCCHHHHHHHHcC
Confidence            679999999999999998753

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional

Probab=95.25  E-value=0.018  Score=43.75  Aligned_cols=22  Identities=5%  Similarity=-0.038  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        31 ~~~l~G~nGsGKSTLL~~iaGl   52 (369)
T PRK11000         31 FVVFVGPSGCGKSTLLRMIAGL   52 (369)
T ss_pred             EEEEECCCCCcHHHHHHHHhCC
Confidence            5789999999999999998865

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit

Probab=95.25  E-value=0.01  Score=41.09  Aligned_cols=32  Identities=13%  Similarity=0.060  Sum_probs=23.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++=..   +--..+++.
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~~~~~G~i~~~~~   62 (223)
T TIGR03740        28 VYGLLGPNGAGKSTLLKMITGILRPTSGEIIFDGH   62 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECCE
Confidence            57899999999999999988543   233455543

Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.

>cd01855 YqeH YqeH

Probab=95.25  E-value=0.026  Score=38.13  Aligned_cols=24  Identities=17%  Similarity=0.054  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+.++|..++|||||+.+++-
T Consensus       126 ~~~~~~~~G~~nvGKStliN~l~~  149 (190)
T cd01855         126 KGGDVYVVGATNVGKSTLINALLK  149 (190)
T ss_pred             cCCcEEEEcCCCCCHHHHHHHHHH
Confidence            456889999999999999999984

YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts. Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional

Probab=95.25  E-value=0.01  Score=41.53  Aligned_cols=23  Identities=13%  Similarity=0.030  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.+.-..
T Consensus        31 ~~~l~G~nGsGKSTLl~~l~G~~   53 (241)
T PRK10895         31 IVGLLGPNGAGKTTTFYMVVGIV   53 (241)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999987653

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit

Probab=95.25  E-value=0.01  Score=40.12  Aligned_cols=22  Identities=27%  Similarity=0.143  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.+.-.
T Consensus        20 ~~~i~G~nGsGKSTLl~~i~G~   41 (190)
T TIGR01166        20 VLALLGANGAGKSTLLLHLNGL   41 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4789999999999999988754

This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component

Probab=95.24  E-value=0.01  Score=40.81  Aligned_cols=22  Identities=14%  Similarity=0.033  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.+.-.
T Consensus        28 ~~~i~G~nGsGKStLl~~l~G~   49 (200)
T cd03217          28 VHALMGPNGSGKSTLAKTIMGH   49 (200)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999988765

Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems. The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions. The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.24  E-value=0.0099  Score=42.89  Aligned_cols=22  Identities=18%  Similarity=0.076  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+||||||++.++=.
T Consensus        30 ~~~l~G~nGsGKSTLl~~i~Gl   51 (275)
T PRK13639         30 MVALLGPNGAGKSTLFLHFNGI   51 (275)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5689999999999999999854

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.24  E-value=0.01  Score=41.83  Aligned_cols=22  Identities=9%  Similarity=-0.025  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.+.-.
T Consensus        32 ~~~l~G~nGsGKSTLl~~l~G~   53 (253)
T PRK14267         32 VFALMGPSGCGKSTLLRTFNRL   53 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5689999999999999998765

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional

Probab=95.23  E-value=0.0098  Score=46.60  Aligned_cols=34  Identities=12%  Similarity=0.111  Sum_probs=25.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .-|+.+.|..+|||||+++.++-.-   +--..+|+.
T Consensus       369 G~~~aIvG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~  405 (582)
T PRK11176        369 GKTVALVGRSGSGKSTIANLLTRFYDIDEGEILLDGH  405 (582)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhccCCCCceEEECCE
Confidence            4478999999999999999998643   333566653

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE

Probab=95.23  E-value=0.01  Score=42.46  Aligned_cols=23  Identities=17%  Similarity=-0.015  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+||||||++.+.-.
T Consensus        38 e~~~i~G~nGsGKSTLl~~l~Gl   60 (265)
T TIGR02769        38 ETVGLLGRSGCGKSTLARLLLGL   60 (265)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36789999999999999988765

This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.

>PRK00131 aroK shikimate kinase; Reviewed

Probab=95.22  E-value=0.011  Score=38.40  Aligned_cols=28  Identities=11%  Similarity=0.064  Sum_probs=22.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ..|+|.|.++|||||+.+.+.-.-.-|.
T Consensus         5 ~~i~l~G~~GsGKstla~~La~~l~~~~   32 (175)
T PRK00131          5 PNIVLIGFMGAGKSTIGRLLAKRLGYDF   32 (175)
T ss_pred             CeEEEEcCCCCCHHHHHHHHHHHhCCCE
Confidence            4688999999999999998876554443

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.21  E-value=0.01  Score=41.67  Aligned_cols=22  Identities=14%  Similarity=-0.035  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~Gl   52 (249)
T PRK14253         31 VTALIGPSGCGKSTLLRCLNRM   52 (249)
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5689999999999999999854

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A

Probab=95.21  E-value=0.011  Score=38.71  Aligned_cols=27  Identities=30%  Similarity=0.161  Sum_probs=18.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -=+++.|..+|||||++.++.---.++
T Consensus        25 ~~~ll~G~~G~GKT~ll~~~~~~~~~~   51 (185)
T PF13191_consen   25 RNLLLTGESGSGKTSLLRALLDRLAER   51 (185)
T ss_dssp             --EEE-B-TTSSHHHHHHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHHHhc
Confidence            347899999999999999766544433

>cd04128 Spg1 Spg1p

Probab=95.21  E-value=0.011  Score=40.08  Aligned_cols=22  Identities=18%  Similarity=0.199  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...+|||+++.+.+.
T Consensus         1 ~Ki~vlG~~~vGKTsLi~~~~~   22 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVKYVE   22 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHHh
Confidence            5899999999999999998875

Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase. Spg1p is an essential gene that localizes to the spindle pole bodies. When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p. Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p. The existence of a SIN-related pathway in plants has been proposed. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional

Probab=95.21  E-value=0.019  Score=44.05  Aligned_cols=41  Identities=17%  Similarity=0.191  Sum_probs=28.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCcee--------EEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV--------EIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~--------~~~~~~~   75 (76)
                      -+.|+|..+|||||+++.++=..   +--+.+++..+        .||++.|
T Consensus        47 ~~~llGpsGsGKSTLLr~IaGl~~p~~G~I~i~g~~i~~~~~~~r~ig~vfQ   98 (377)
T PRK11607         47 IFALLGASGCGKSTLLRMLAGFEQPTAGQIMLDGVDLSHVPPYQRPINMMFQ   98 (377)
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCceEEEECCEECCCCCHHHCCEEEEeC
Confidence            46799999999999999888542   33345554433        3666655

>PRK09825 idnK D-gluconate kinase; Provisional

Probab=95.20  E-value=0.011  Score=40.65  Aligned_cols=31  Identities=16%  Similarity=0.205  Sum_probs=24.6

Q ss_pred             eeeccCCCccchhhhhhhhhhcccceeeeCce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMMINNNT   67 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~~~~~~   67 (76)
                      +.+.|..+|||||+++.++-... |..|+...
T Consensus         6 i~l~G~sGsGKSTl~~~la~~l~-~~~i~gd~   36 (176)
T PRK09825          6 YILMGVSGSGKSLIGSKIAALFS-AKFIDGDD   36 (176)
T ss_pred             EEEECCCCCCHHHHHHHHHHhcC-CEEECCcc
Confidence            68899999999999999987654 44665543

>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2

Probab=95.20  E-value=0.011  Score=38.93  Aligned_cols=21  Identities=14%  Similarity=0.006  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +.++|+..|||||+++.++-.
T Consensus         2 i~i~GpsGsGKstl~~~L~~~   22 (137)
T cd00071           2 IVLSGPSGVGKSTLLKRLLEE   22 (137)
T ss_pred             EEEECCCCCCHHHHHHHHHhc
Confidence            578999999999999988754

7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.19  E-value=0.011  Score=42.11  Aligned_cols=22  Identities=14%  Similarity=-0.053  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        40 ~~~i~G~nGsGKSTLl~~i~Gl   61 (258)
T PRK14268         40 VTALIGPSGCGKSTFIRCLNRM   61 (258)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4789999999999999999854

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein

Probab=95.19  E-value=0.011  Score=41.58  Aligned_cols=22  Identities=18%  Similarity=0.028  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        28 ~~~l~G~nGsGKSTLl~~i~G~   49 (237)
T TIGR00968        28 LVALLGPSGSGKSTLLRIIAGL   49 (237)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            5789999999999999999854

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional

Probab=95.18  E-value=0.01  Score=42.39  Aligned_cols=23  Identities=9%  Similarity=-0.057  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        35 ~~~i~G~nGsGKSTLl~~i~G~~   57 (265)
T PRK10253         35 FTAIIGPNGCGKSTLLRTLSRLM   57 (265)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            57899999999999999988653

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.18  E-value=0.01  Score=43.00  Aligned_cols=23  Identities=17%  Similarity=-0.033  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.++|..+||||||++.+|=..
T Consensus        35 ~~~I~G~nGaGKSTLl~~l~G~~   57 (282)
T PRK13640         35 WTALIGHNGSGKSTISKLINGLL   57 (282)
T ss_pred             EEEEECCCCCcHHHHHHHHhccc
Confidence            57899999999999999999653

>PLN03110 Rab GTPase; Provisional

Probab=95.18  E-value=0.011  Score=41.14  Aligned_cols=23  Identities=13%  Similarity=0.047  Sum_probs=20.4

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..+|++++|..++|||||+.++.
T Consensus        11 ~~~Ki~ivG~~~vGKStLi~~l~   33 (216)
T PLN03110         11 YLFKIVLIGDSGVGKSNILSRFT   33 (216)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHh
Confidence            45899999999999999998763

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids

Probab=95.18  E-value=0.01  Score=41.19  Aligned_cols=40  Identities=8%  Similarity=-0.080  Sum_probs=27.1

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      -.+.|+|..+|||||+++.++-..   +--+.+++  ..||++.|
T Consensus        26 e~~~l~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g--~~i~~~~q   68 (177)
T cd03222          26 EVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEWDG--ITPVYKPQ   68 (177)
T ss_pred             CEEEEECCCCChHHHHHHHHHcCCCCCCcEEEECC--EEEEEEcc
Confidence            367899999999999999887542   22344443  24565544

RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.16  E-value=0.011  Score=41.56  Aligned_cols=21  Identities=5%  Similarity=-0.050  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+||||||++.+.-
T Consensus        31 ~~~i~G~nGsGKSTLl~~i~G   51 (250)
T PRK14262         31 ITAIIGPSGCGKTTLLRSINR   51 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            578999999999999999884

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional

Probab=95.15  E-value=0.011  Score=42.66  Aligned_cols=22  Identities=9%  Similarity=-0.062  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        40 ~~~I~G~NGsGKSTLlk~l~Gl   61 (257)
T PRK11247         40 FVAVVGRSGCGKSTLLRLLAGL   61 (257)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            6789999999999999998854

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB

Probab=95.14  E-value=0.011  Score=45.30  Aligned_cols=22  Identities=14%  Similarity=-0.010  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      --+|+.|+.+|||||++.+++-
T Consensus       135 glilI~GpTGSGKTTtL~aLl~  156 (358)
T TIGR02524       135 GIVFITGATGSGKSTLLAAIIR  156 (358)
T ss_pred             CEEEEECCCCCCHHHHHHHHHH
Confidence            4679999999999999999873

Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.

>CHL00131 ycf16 sulfate ABC transporter protein; Validated

Probab=95.13  E-value=0.011  Score=41.50  Aligned_cols=23  Identities=13%  Similarity=-0.002  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.++|..+|||||+++.++-.
T Consensus        34 e~~~i~G~nGsGKSTLl~~i~Gl   56 (252)
T CHL00131         34 EIHAIMGPNGSGKSTLSKVIAGH   56 (252)
T ss_pred             cEEEEECCCCCCHHHHHHHHcCC
Confidence            36789999999999999988753

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.11  E-value=0.012  Score=42.37  Aligned_cols=23  Identities=22%  Similarity=0.073  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        37 ~~~l~G~nGsGKSTLl~~l~Gl~   59 (271)
T PRK13632         37 YVAILGHNGSGKSTISKILTGLL   59 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            56899999999999999988763

>cd01898 Obg Obg subfamily

Probab=95.10  E-value=0.012  Score=37.83  Aligned_cols=20  Identities=15%  Similarity=0.031  Sum_probs=18.1

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.++|...+|||||+.++.
T Consensus         2 ~v~ivG~~~~GKStl~~~l~   21 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAIS   21 (170)
T ss_pred             CeEEECCCCCCHHHHHHHHh
Confidence            46899999999999999986

The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.10  E-value=0.012  Score=42.23  Aligned_cols=32  Identities=16%  Similarity=0.088  Sum_probs=24.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--..+|+.
T Consensus        37 ~~~I~G~nGsGKSTLl~~i~Gl~~~~~G~i~~~g~   71 (269)
T PRK13648         37 WTSIVGHNGSGKSTIAKLMIGIEKVKSGEIFYNNQ   71 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCceEEEECCE
Confidence            57899999999999999998552   333455543

>cd04131 Rnd Rnd subfamily

Probab=95.10  E-value=0.012  Score=39.78  Aligned_cols=22  Identities=9%  Similarity=0.215  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||+++.+.+.
T Consensus         2 ~Kiv~vG~~~vGKTsli~~~~~   23 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQVFAK   23 (178)
T ss_pred             eEEEEECCCCCCHHHHHHHHHh
Confidence            6899999999999999999875

The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8. These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos. Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated. In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity. They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.10  E-value=0.011  Score=42.81  Aligned_cols=32  Identities=9%  Similarity=0.029  Sum_probs=24.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.+|-..   +--+.+++.
T Consensus        35 ~~~i~G~nGaGKSTLl~~i~G~~~p~~G~i~~~g~   69 (279)
T PRK13635         35 WVAIVGHNGSGKSTLAKLLNGLLLPEAGTITVGGM   69 (279)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCCCCCcEEEECCE
Confidence            46899999999999999999653   333455543

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.10  E-value=0.012  Score=41.54  Aligned_cols=22  Identities=5%  Similarity=-0.118  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        33 ~~~I~G~nGsGKSTLl~~i~G~   54 (251)
T PRK14244         33 VTAFIGPSGCGKSTFLRCFNRM   54 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5689999999999999998744

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C

Probab=95.10  E-value=0.012  Score=40.17  Aligned_cols=40  Identities=15%  Similarity=0.063  Sum_probs=27.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc---cceeeeCceeEEeeeee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS---KPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~---~~~~~~~~~~~~~~~~~   75 (76)
                      --.+.++|..+||||||++.++=...   --+.+++   .||++.|
T Consensus        31 G~~~~i~G~nG~GKSTLl~~i~G~~~~~~G~i~~~g---~i~~~~q   73 (204)
T cd03250          31 GELVAIVGPVGSGKSSLLSALLGELEKLSGSVSVPG---SIAYVSQ   73 (204)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCcCCCCCCeEEEcC---EEEEEec
Confidence            33678999999999999998876531   1133333   4666654

This family is also known as MRP (mulrtidrug resisitance-associated protein). Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear. The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.

>PLN02674 adenylate kinase

Probab=95.10  E-value=0.023  Score=41.72  Aligned_cols=29  Identities=21%  Similarity=0.167  Sum_probs=23.6

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhcc
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .....+++|+|+.+|||+|..+.++-...
T Consensus        28 ~~~~~~i~l~G~PGsGKgT~a~~La~~~~   56 (244)
T PLN02674         28 SKPDKRLILIGPPGSGKGTQSPIIKDEYC   56 (244)
T ss_pred             cccCceEEEECCCCCCHHHHHHHHHHHcC
Confidence            34457899999999999999998876443

>PRK15064 ABC transporter ATP-binding protein; Provisional

Probab=95.10  E-value=0.024  Score=44.33  Aligned_cols=40  Identities=20%  Similarity=0.216  Sum_probs=27.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+|||||+++.+|-..   +--+.+++ ...||++.|
T Consensus       347 ~~~l~G~NGsGKSTLl~~i~G~~~p~~G~i~~~~-~~~i~~~~q  389 (530)
T PRK15064        347 RLAIIGENGVGKTTLLRTLVGELEPDSGTVKWSE-NANIGYYAQ  389 (530)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCeEEEECC-ceEEEEEcc
Confidence            56799999999999999998652   22233333 245777655

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.10  E-value=0.011  Score=42.64  Aligned_cols=22  Identities=27%  Similarity=0.140  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++=.
T Consensus        33 ~~~i~G~nGsGKSTLl~~l~Gl   54 (274)
T PRK13647         33 KTALLGPNGAGKSTLLLHLNGI   54 (274)
T ss_pred             EEEEECCCCCcHHHHHHHHhcC
Confidence            5789999999999999999854

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=95.07  E-value=0.012  Score=42.91  Aligned_cols=22  Identities=18%  Similarity=-0.046  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        35 ~~~i~G~nGaGKSTLl~~l~Gl   56 (287)
T PRK13637         35 FVGLIGHTGSGKSTLIQHLNGL   56 (287)
T ss_pred             EEEEECCCCCcHHHHHHHHhcC
Confidence            6789999999999999999854

>PRK10762 D-ribose transporter ATP binding protein; Provisional

Probab=95.06  E-value=0.022  Score=44.30  Aligned_cols=31  Identities=13%  Similarity=0.082  Sum_probs=23.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++
T Consensus        32 ~~~l~G~NGsGKSTLl~~l~G~~~p~~G~i~~~g   65 (501)
T PRK10762         32 VMALVGENGAGKSTMMKVLTGIYTRDAGSILYLG   65 (501)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCcEEEECC
Confidence            56899999999999999998653   23345554

>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans

Probab=95.06  E-value=0.013  Score=37.69  Aligned_cols=22  Identities=14%  Similarity=0.016  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      +++++|...+||||++.+++--
T Consensus         2 ~i~~~G~~~~GKssli~~l~~~   23 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLTRA   23 (168)
T ss_pred             eEEEEcCCCCCHHHHHHHHhcC
Confidence            6899999999999999998753

NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes. Thus, defects in NOG1 can lead to defects in 60S biogenesis. The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function. It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.

>PRK09087 hypothetical protein; Validated

Probab=95.05  E-value=0.013  Score=41.93  Aligned_cols=20  Identities=15%  Similarity=0.012  Sum_probs=18.9

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +.|-|..+|||||+++++|.
T Consensus        47 l~l~G~~GsGKThLl~~~~~   66 (226)
T PRK09087         47 VVLAGPVGSGKTHLASIWRE   66 (226)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            79999999999999999994

>cd04148 RGK RGK subfamily

Probab=95.04  E-value=0.013  Score=41.10  Aligned_cols=21  Identities=10%  Similarity=0.120  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|.+.+||||++.+++
T Consensus         1 ~KI~lvG~~gvGKTsLi~~~~   21 (221)
T cd04148           1 YRVVMLGSPGVGKSSLASQFT   21 (221)
T ss_pred             CEEEEECCCCCcHHHHHHHHh
Confidence            589999999999999999986

The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues. RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function. Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells. RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton. Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional

Probab=95.04  E-value=0.012  Score=42.24  Aligned_cols=23  Identities=17%  Similarity=0.053  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+|||||+++.++=.
T Consensus        39 e~~~i~G~nGsGKSTLl~~l~Gl   61 (268)
T PRK10419         39 ETVALLGRSGCGKSTLARLLVGL   61 (268)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            36899999999999999998865

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]

Probab=95.04  E-value=0.017  Score=44.54  Aligned_cols=34  Identities=21%  Similarity=0.214  Sum_probs=27.2

Q ss_pred             ceeeccCCCccchhhhhhhhh---hcccceeeeCcee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT---TTSKPMMINNNTV   68 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~---~~~~~~~~~~~~~   68 (76)
                      -+.|||.++|||||+|+...=   +|+--+.|+++.|
T Consensus        31 f~vllGPSGcGKSTlLr~IAGLe~~~~G~I~i~g~~v   67 (338)
T COG3839          31 FVVLLGPSGCGKSTLLRMIAGLEEPTSGEILIDGRDV   67 (338)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEECCEEC
Confidence            368899999999999987663   4677788877765

>KOG2655|consensus

Probab=95.03  E-value=0.021  Score=44.63  Aligned_cols=24  Identities=25%  Similarity=0.205  Sum_probs=22.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +.-|++.|.+++|||||..++|-.
T Consensus        21 ~ftlmvvG~sGlGKsTfiNsLf~~   44 (366)
T KOG2655|consen   21 DFTLMVVGESGLGKSTFINSLFLT   44 (366)
T ss_pred             ceEEEEecCCCccHHHHHHHHHhh
Confidence            577899999999999999999987

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal

Probab=95.01  E-value=0.013  Score=41.62  Aligned_cols=22  Identities=18%  Similarity=0.048  Sum_probs=18.7

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|.++|||||+++++.--.
T Consensus         2 Ivl~G~pGSGKST~a~~La~~l   23 (249)
T TIGR03574         2 IILTGLPGVGKSTFSKELAKKL   23 (249)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHH
Confidence            5789999999999999887543

Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional

Probab=95.01  E-value=0.013  Score=42.71  Aligned_cols=22  Identities=9%  Similarity=-0.065  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        67 ~~~l~G~nGsGKSTLl~~L~Gl   88 (286)
T PRK14275         67 VTAIIGPSGCGKSTFLRAINRM   88 (286)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5689999999999999999854

>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE

Probab=95.00  E-value=0.052  Score=42.56  Aligned_cols=39  Identities=15%  Similarity=0.090  Sum_probs=28.5

Q ss_pred             HHHHHHHHHhH-HhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          17 KQIEKNLKEDG-IQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        17 k~IDk~L~kek-k~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++++.+...+ +.....+|+.++|.+.+||||++.+++-
T Consensus       186 ~~l~~ll~~~~~~~~~~g~kVvIvG~~nvGKSSLiN~L~~  225 (442)
T TIGR00450       186 AELKDILNSYKLEKLDDGFKLAIVGSPNVGKSSLLNALLK  225 (442)
T ss_pred             HHHHHHHHHHHHHHhhcCCEEEEECCCCCcHHHHHHHHhC
Confidence            33444444332 3455779999999999999999999973

TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.

>PLN02200 adenylate kinase family protein

Probab=95.00  E-value=0.013  Score=42.06  Aligned_cols=26  Identities=15%  Similarity=0.039  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -..++++|+++|||||+.+.++--..
T Consensus        43 ~~ii~I~G~PGSGKsT~a~~La~~~g   68 (234)
T PLN02200         43 PFITFVLGGPGSGKGTQCEKIVETFG   68 (234)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHhC
Confidence            35689999999999999988764443

>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily

Probab=95.00  E-value=0.014  Score=39.91  Aligned_cols=25  Identities=8%  Similarity=0.159  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+|++++|.+.+|||+++...+.-
T Consensus         4 ~~~KivvvGd~~vGKTsli~~~~~~   28 (182)
T cd04172           4 VKCKIVVVGDSQCGKTALLHVFAKD   28 (182)
T ss_pred             ceEEEEEECCCCCCHHHHHHHHHhC
Confidence            4689999999999999999988753

Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7. Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I. Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol. Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation. In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell. In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint. Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation. In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional

Probab=94.99  E-value=0.013  Score=42.04  Aligned_cols=24  Identities=21%  Similarity=0.156  Sum_probs=20.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+|||||+++.++=..
T Consensus        40 e~~~i~G~NGsGKSTLl~~l~Gl~   63 (267)
T PRK15112         40 QTLAIIGENGSGKSTLAKMLAGMI   63 (267)
T ss_pred             CEEEEEcCCCCCHHHHHHHHhCCC
Confidence            367899999999999999998653

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2

Probab=94.99  E-value=0.013  Score=45.72  Aligned_cols=24  Identities=21%  Similarity=0.023  Sum_probs=21.3

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+|||||+++.++-..
T Consensus        27 e~~~iiG~nGsGKSTLl~~l~Gl~   50 (520)
T TIGR03269        27 EVLGILGRSGAGKSVLMHVLRGMD   50 (520)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhcc
Confidence            357999999999999999998864

The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed

Probab=94.99  E-value=0.029  Score=44.40  Aligned_cols=40  Identities=15%  Similarity=0.116  Sum_probs=27.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+ +..+.||++.|
T Consensus       352 ~~~l~G~NGsGKSTLl~~i~G~~~p~~G~i~~-~~~~~i~~v~q  394 (556)
T PRK11819        352 IVGIIGPNGAGKSTLFKMITGQEQPDSGTIKI-GETVKLAYVDQ  394 (556)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCeEEEE-CCceEEEEEeC
Confidence            36799999999999999998553   122333 33456777765

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]

Probab=94.99  E-value=0.011  Score=44.07  Aligned_cols=21  Identities=19%  Similarity=-0.007  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +-++|+.+|||||+|+++.-+
T Consensus        31 ~~iiGpNG~GKSTLLk~l~g~   51 (258)
T COG1120          31 TGILGPNGSGKSTLLKCLAGL   51 (258)
T ss_pred             EEEECCCCCCHHHHHHHHhcc
Confidence            468899999999999988764

>cd03288 ABCC_SUR2 The SUR domain 2

Probab=94.98  E-value=0.013  Score=41.69  Aligned_cols=33  Identities=21%  Similarity=0.153  Sum_probs=24.3

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -.+.++|..+|||||+++.++=..   +--+.+++.
T Consensus        48 e~~~i~G~nGsGKSTLl~~l~Gl~~~~~G~i~i~g~   83 (257)
T cd03288          48 QKVGICGRTGSGKSSLSLAFFRMVDIFDGKIVIDGI   83 (257)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcccCCCCCeEEECCE
Confidence            367899999999999999988653   233445443

The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family. Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel. Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism. It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11

Probab=94.97  E-value=0.013  Score=43.37  Aligned_cols=26  Identities=15%  Similarity=0.084  Sum_probs=21.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...-.+++.|..+||||||+++++--
T Consensus       142 ~~~~~ili~G~tGsGKTTll~al~~~  167 (308)
T TIGR02788       142 ASRKNIIISGGTGSGKTTFLKSLVDE  167 (308)
T ss_pred             hCCCEEEEECCCCCCHHHHHHHHHcc
Confidence            34558899999999999999988743

The VirB11 protein is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer. VirB11 is believed to be an ATPase. VirB11 is a homolog of the P-like conjugation system TrbB protein and the Flp pilus sytem protein TadA.

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3

Probab=94.97  E-value=0.022  Score=46.16  Aligned_cols=36  Identities=14%  Similarity=0.109  Sum_probs=25.1

Q ss_pred             hHHHHHHHHHhHHh----hhCccceeeccCCCccchhhhh
Q psy6625          16 SKQIEKNLKEDGIQ----AAKDIKLLLLGEYFSSQMVPSL   51 (76)
Q Consensus        16 Sk~IDk~L~kekk~----~~~evKLLLLGaGESGKST~~~   51 (76)
                      -++|+..++..-..    ...---+.|.|+.+|||||+|+
T Consensus        11 ~r~Ie~~l~~vL~~Vsl~i~~GEiv~L~G~SGsGKSTLLr   50 (504)
T TIGR03238        11 KRKIQTDLERILVKFNKELPSSSLLFLCGSSGDGKSEILA   50 (504)
T ss_pred             chHHHHHHHHHHhCCceeecCCCEEEEECCCCCCHHHHHh
Confidence            45666666554433    2233357899999999999999

cereus E33L, Hahella chejuensis KCTC 2396, Pseudoalteromonas haloplanktis TAC12, and Escherichia coli B7A.

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.97  E-value=0.028  Score=42.20  Aligned_cols=24  Identities=8%  Similarity=-0.121  Sum_probs=20.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -++.++|..+||||||+++++-..
T Consensus       109 e~v~IvG~~GsGKSTLl~~L~g~~  132 (329)
T PRK14257        109 KVTAFIGPSGCGKSTFLRNLNQLN  132 (329)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            368899999999999999998553

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.95  E-value=0.013  Score=42.68  Aligned_cols=22  Identities=18%  Similarity=-0.031  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        34 ~v~i~G~nGsGKSTLl~~l~Gl   55 (288)
T PRK13643         34 YTALIGHTGSGKSTLLQHLNGL   55 (288)
T ss_pred             EEEEECCCCChHHHHHHHHhcC
Confidence            6789999999999999999855

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI

Probab=94.94  E-value=0.014  Score=42.79  Aligned_cols=23  Identities=17%  Similarity=-0.002  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        32 ~~~l~G~NGaGKSTLl~~l~Gl~   54 (303)
T TIGR01288        32 CFGLLGPNGAGKSTIARMLLGMI   54 (303)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            67899999999999999998653

This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.94  E-value=0.014  Score=41.68  Aligned_cols=22  Identities=9%  Similarity=-0.088  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        44 ~~~i~G~nGsGKSTLl~~l~Gl   65 (265)
T PRK14252         44 VTALIGPSGCGKSTFLRCFNRM   65 (265)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter

Probab=94.93  E-value=0.014  Score=39.99  Aligned_cols=24  Identities=17%  Similarity=-0.031  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --.+.|+|..+||||||++.++-.
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~G~   49 (201)
T cd03231          26 GEALQVTGPNGSGKTTLLRILAGL   49 (201)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            346789999999999999998854

The CCM family is involved in bacterial cytochrome c biogenesis. Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH). CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH. The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.

>PRK13633 cobalt transporter ATP-binding subunit; Provisional

Probab=94.92  E-value=0.014  Score=42.22  Aligned_cols=22  Identities=18%  Similarity=0.128  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        38 ~~~l~G~nGsGKSTLl~~l~Gl   59 (280)
T PRK13633         38 FLVILGRNGSGKSTIAKHMNAL   59 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4789999999999999999854

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains

Probab=94.92  E-value=0.015  Score=41.35  Aligned_cols=22  Identities=18%  Similarity=-0.035  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -..++|..+|||||++.|+|-.
T Consensus        27 ~~~IvG~NGsGKStll~Ai~~l   48 (251)
T cd03273          27 FNAITGLNGSGKSNILDAICFV   48 (251)
T ss_pred             eEEEECCCCCCHHHHHHHHHHH
Confidence            3578999999999999999976

Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains. The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins. The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases. The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences. In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein

Probab=94.90  E-value=0.014  Score=41.34  Aligned_cols=32  Identities=16%  Similarity=-0.032  Sum_probs=23.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        29 ~~~i~G~nGsGKSTLl~~i~G~~~~~~G~i~~~g~   63 (256)
T TIGR03873        29 LTGLLGPNGSGKSTLLRLLAGALRPDAGTVDLAGV   63 (256)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCCCCCCCEEEECCE
Confidence            56899999999999999987542   333455543

This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.

>PRK03695 vitamin B12-transporter ATPase; Provisional

Probab=94.90  E-value=0.014  Score=41.43  Aligned_cols=23  Identities=13%  Similarity=0.007  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++-..
T Consensus        24 i~~l~G~nGsGKSTLl~~l~Gl~   46 (248)
T PRK03695         24 ILHLVGPNGAGKSTLLARMAGLL   46 (248)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            57899999999999999988654

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional

Probab=94.89  E-value=0.014  Score=42.40  Aligned_cols=22  Identities=23%  Similarity=0.080  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++-.
T Consensus        29 ~~~l~G~nGsGKSTLl~~laG~   50 (272)
T PRK13547         29 VTALLGRNGAGKSTLLKALAGD   50 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999999754

>PRK13764 ATPase; Provisional

Probab=94.89  E-value=0.014  Score=48.00  Aligned_cols=23  Identities=17%  Similarity=0.072  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --+|+-|+.+||||||++++|--
T Consensus       258 ~~ILIsG~TGSGKTTll~AL~~~  280 (602)
T PRK13764        258 EGILIAGAPGAGKSTFAQALAEF  280 (602)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH
Confidence            34899999999999999998843

>PRK05057 aroK shikimate kinase I; Reviewed

Probab=94.88  E-value=0.021  Score=38.81  Aligned_cols=28  Identities=11%  Similarity=0.127  Sum_probs=23.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .+|+++|..+|||||+.+.+.-...-|.
T Consensus         5 ~~I~liG~~GaGKStl~~~La~~l~~~~   32 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGRQLAQQLNMEF   32 (172)
T ss_pred             CEEEEECCCCcCHHHHHHHHHHHcCCcE
Confidence            4689999999999999999987666554

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.88  E-value=0.015  Score=40.87  Aligned_cols=23  Identities=13%  Similarity=-0.063  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.+.=..
T Consensus        32 ~~~i~G~nGsGKSTLl~~i~G~~   54 (252)
T PRK14272         32 VNALIGPSGCGKTTFLRAINRMH   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            46899999999999999988653

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional

Probab=94.86  E-value=0.014  Score=45.02  Aligned_cols=22  Identities=18%  Similarity=0.110  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        31 ~~~liG~nGsGKSTLl~~l~G~   52 (490)
T PRK10938         31 SWAFVGANGSGKSALARALAGE   52 (490)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999998865

>cd04126 Rab20 Rab20 subfamily

Probab=94.86  E-value=0.015  Score=41.33  Aligned_cols=22  Identities=18%  Similarity=0.229  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||||+.+++.
T Consensus         1 ~KIvivG~~~vGKTSLi~r~~~   22 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHRYME   22 (220)
T ss_pred             CEEEEECCCCCcHHHHHHHHhc
Confidence            5899999999999999998764

Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells. It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells. Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron. It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters

Probab=94.84  E-value=0.015  Score=40.09  Aligned_cols=24  Identities=29%  Similarity=0.116  Sum_probs=20.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+|||||+++.++-..
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~G~~   57 (202)
T cd03233          34 EMVLVLGRPGSGCSTLLKALANRT   57 (202)
T ss_pred             cEEEEECCCCCCHHHHHHHhcccC
Confidence            367899999999999999987653

PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes. This PDR subfamily represents domain I of its (ABC-IM)2 organization. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules. The nucleotide-binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd04102 RabL3 RabL3 (Rab-like3) subfamily

Probab=94.84  E-value=0.016  Score=40.75  Aligned_cols=22  Identities=14%  Similarity=0.363  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+.+|||+++..++-
T Consensus         1 vKIvlvGd~gVGKTSLi~~~~~   22 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHLICK   22 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHHc
Confidence            6899999999999999998874

RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like. As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus. The specific function of RabL3 remains unknown.

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases

Probab=94.81  E-value=0.014  Score=39.91  Aligned_cols=21  Identities=14%  Similarity=-0.004  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|.++|||||+++.+...
T Consensus         1 ~vv~G~pGsGKSt~i~~~~~~   21 (234)
T PF01443_consen    1 IVVHGVPGSGKSTLIKKLLKD   21 (234)
T ss_pred             CEEEcCCCCCHHHHHHHHHHh
Confidence            467899999999999988766

Some of the members are found in positive-strand single stranded RNA viruses. The helicase has multiple roles at different stages of viral RNA replication, as dissected by mutational analysis [].; GO: 0004386 helicase activity

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein

Probab=94.81  E-value=0.028  Score=42.64  Aligned_cols=33  Identities=9%  Similarity=0.006  Sum_probs=24.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      .+.|+|..+|||||+++.++=..   +--+.+++..
T Consensus        32 ~~~l~GpsGsGKSTLLr~iaGl~~p~~G~I~i~g~~   67 (353)
T TIGR03265        32 FVCLLGPSGCGKTTLLRIIAGLERQTAGTIYQGGRD   67 (353)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCCceEEEECCEE
Confidence            57899999999999999988653   3334555543

This ABC transporter ATP-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely.

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.81  E-value=0.016  Score=42.05  Aligned_cols=22  Identities=18%  Similarity=-0.026  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.++=.
T Consensus        49 ~~~I~G~nGsGKSTLl~~l~Gl   70 (276)
T PRK14271         49 VTSLMGPTGSGKTTFLRTLNRM   70 (276)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999999854

>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily

Probab=94.80  E-value=0.017  Score=38.13  Aligned_cols=21  Identities=19%  Similarity=0.162  Sum_probs=18.8

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      ++++|.+.+||||++.+++.-
T Consensus         2 i~ivG~~~vGKTsli~~~~~~   22 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLSSE   22 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            689999999999999998743

Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project. It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2). This is a novel subfamily identified in human cancers that is uncharacterized to date.

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]

Probab=94.80  E-value=0.04  Score=44.51  Aligned_cols=44  Identities=16%  Similarity=0.131  Sum_probs=33.6

Q ss_pred             CccceeeccCCCccchhhhhhh---hhhcccceeeeCceeEEeeeeeC
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLAL---CTTTSKPMMINNNTVEIGVLVQK   76 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~---~~~~~~~~~~~~~~~~~~~~~~~   76 (76)
                      +.-||-++|..++||||+++.+   -.-. .....-..+|.||++-|.
T Consensus       347 ~g~riaiiG~NG~GKSTLlk~l~g~~~~~-~G~v~~g~~v~igyf~Q~  393 (530)
T COG0488         347 RGDRIAIVGPNGAGKSTLLKLLAGELGPL-SGTVKVGETVKIGYFDQH  393 (530)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhhhcccC-CceEEeCCceEEEEEEeh
Confidence            4568889999999999999988   3333 444555667999998773

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit

Probab=94.80  E-value=0.016  Score=42.46  Aligned_cols=31  Identities=16%  Similarity=0.052  Sum_probs=23.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++
T Consensus        21 ~~~l~G~NGaGKSTLl~~l~Gl~~p~~G~i~~~g   54 (302)
T TIGR01188        21 VFGFLGPNGAGKTTTIRMLTTLLRPTSGTARVAG   54 (302)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCceEEEECC
Confidence            46799999999999999998543   33344544

This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional

Probab=94.80  E-value=0.032  Score=43.40  Aligned_cols=22  Identities=18%  Similarity=0.054  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        32 ~~~l~G~nGsGKSTLl~~l~Gl   53 (501)
T PRK11288         32 VHALMGENGAGKSTLLKILSGN   53 (501)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998864

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)

Probab=94.79  E-value=0.017  Score=39.33  Aligned_cols=20  Identities=15%  Similarity=0.270  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      +|+|+|-.++||||+..+++
T Consensus         2 ~i~lvG~~g~GKSsl~N~il   21 (196)
T cd01852           2 RLVLVGKTGAGKSATGNTIL   21 (196)
T ss_pred             EEEEECCCCCCHHHHHHHhh
Confidence            68999999999999999986

This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family. The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections. The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]

Probab=94.79  E-value=0.016  Score=43.03  Aligned_cols=18  Identities=17%  Similarity=0.215  Sum_probs=15.2

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |-.+|+++|||||||.  ||
T Consensus        35 isIIGsSGSGKSTfLR--Ci   52 (256)
T COG4598          35 ISIIGSSGSGKSTFLR--CI   52 (256)
T ss_pred             EEEecCCCCchhHHHH--HH
Confidence            4678999999999995  65

>cd03299 ABC_ModC_like Archeal protein closely related to ModC

Probab=94.78  E-value=0.016  Score=40.61  Aligned_cols=31  Identities=19%  Similarity=0.215  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.|+|..+||||||++.++=.   ++--..+++
T Consensus        27 ~~~i~G~nG~GKStLl~~l~G~~~p~~G~v~i~g   60 (235)
T cd03299          27 YFVILGPTGSGKSVLLETIAGFIKPDSGKILLNG   60 (235)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcCCCceEEEECC
Confidence            5789999999999999998754   233344544

ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional

Probab=94.78  E-value=0.016  Score=41.07  Aligned_cols=23  Identities=9%  Similarity=-0.044  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        33 ~~~l~G~nGsGKSTLl~~i~G~~   55 (257)
T PRK10619         33 VISIIGSSGSGKSTFLRCINFLE   55 (257)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            56899999999999999988653

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.78  E-value=0.016  Score=42.07  Aligned_cols=23  Identities=13%  Similarity=-0.061  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+||||||++.++-..
T Consensus        34 ~~~i~G~nGaGKSTLl~~i~Gl~   56 (283)
T PRK13636         34 VTAILGGNGAGKSTLFQNLNGIL   56 (283)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            57899999999999999998653

>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes

Probab=94.78  E-value=0.016  Score=42.67  Aligned_cols=22  Identities=9%  Similarity=-0.079  Sum_probs=18.6

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-+.|..+||||||++.++-.-
T Consensus         2 igI~G~sGsGKSTl~~~L~~ll   23 (273)
T cd02026           2 IGVAGDSGCGKSTFLRRLTSLF   23 (273)
T ss_pred             EEEECCCCCCHHHHHHHHHHhh
Confidence            4578999999999999998553

This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.78  E-value=0.036  Score=40.43  Aligned_cols=23  Identities=4%  Similarity=-0.117  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+.|+|..+|||||+++.+.-.
T Consensus        66 e~~~I~G~nGsGKSTLl~~l~Gl   88 (285)
T PRK14254         66 QVTAMIGPSGCGKSTFLRCINRM   88 (285)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcc
Confidence            35789999999999999998743

>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2

Probab=94.77  E-value=0.015  Score=39.72  Aligned_cols=22  Identities=14%  Similarity=-0.008  Sum_probs=18.0

Q ss_pred             eeccCCCccchhhhhhhhhhcc
Q psy6625          37 LLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~~~   58 (76)
                      -+=|.+.||||||.+++...-.
T Consensus         3 gI~G~sgSGKTTla~~L~~~L~   24 (194)
T PF00485_consen    3 GIAGPSGSGKTTLAKRLAQILN   24 (194)
T ss_dssp             EEEESTTSSHHHHHHHHHHHHT
T ss_pred             EEECCCCCCHHHHHHHHHHHhC
Confidence            4568999999999999876544

7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups. Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction: ATP + Uridine = ADP + UMP Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB

Probab=94.76  E-value=0.036  Score=41.30  Aligned_cols=24  Identities=21%  Similarity=0.171  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .--+|+-|..+||||||+.+++--
T Consensus       132 ~~~ilI~G~tGSGKTTll~al~~~  155 (299)
T TIGR02782       132 RKNILVVGGTGSGKTTLANALLAE  155 (299)
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHH
Confidence            456899999999999999998743

The TrbB protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbB is a homolog of the vir system VirB11 ATPase, and the Flp pilus sytem ATPase TadA.

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional

Probab=94.76  E-value=0.016  Score=43.26  Aligned_cols=30  Identities=7%  Similarity=0.038  Sum_probs=23.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMIN   64 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~   64 (76)
                      .+.|+|..+|||||+++.++=.   ++--+.++
T Consensus        54 ~~~I~G~nGsGKSTLl~~L~Gl~~p~~G~I~i~   86 (320)
T PRK13631         54 IYFIIGNSGSGKSTLVTHFNGLIKSKYGTIQVG   86 (320)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCCeEEEC
Confidence            5789999999999999999865   33344554

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional

Probab=94.76  E-value=0.037  Score=43.31  Aligned_cols=23  Identities=35%  Similarity=0.271  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus       314 ~~~i~G~nGsGKSTLlk~l~Gl~  336 (529)
T PRK15134        314 TLGLVGESGSGKSTTGLALLRLI  336 (529)
T ss_pred             EEEEECCCCCCHHHHHHHHhCcC
Confidence            46899999999999999998753

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein

Probab=94.75  E-value=0.016  Score=43.60  Aligned_cols=23  Identities=13%  Similarity=0.001  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++=..
T Consensus        25 i~~l~G~nGsGKSTLl~~iaGl~   47 (354)
T TIGR02142        25 VTAIFGRSGSGKTTLIRLIAGLT   47 (354)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            46899999999999999987653

This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.

>PRK15064 ABC transporter ATP-binding protein; Provisional

Probab=94.74  E-value=0.016  Score=45.28  Aligned_cols=41  Identities=17%  Similarity=0.097  Sum_probs=28.1

Q ss_pred             cceeeccCCCccchhhhhhhhhhcc---cceeeeCceeEEeeeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTS---KPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~---~~~~~~~~~~~~~~~~~   75 (76)
                      -.+.|+|..+|||||+++.++-...   --+.+++. ..||++.|
T Consensus        28 e~~~liG~NGsGKSTLl~~l~Gl~~p~~G~i~~~~~-~~i~~~~q   71 (530)
T PRK15064         28 NRYGLIGANGCGKSTFMKILGGDLEPSAGNVSLDPN-ERLGKLRQ   71 (530)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCCCCCceEEecCC-CEEEEEec
Confidence            3689999999999999999986431   22334432 34676655

>PLN03073 ABC transporter F family; Provisional

Probab=94.73  E-value=0.036  Score=45.94  Aligned_cols=40  Identities=13%  Similarity=0.136  Sum_probs=27.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      ++.|+|..+||||||++.++-..   +--+.++ ....||++-|
T Consensus       537 ~i~LvG~NGsGKSTLLk~L~Gll~p~~G~I~~~-~~~~igyv~Q  579 (718)
T PLN03073        537 RIAMVGPNGIGKSTILKLISGELQPSSGTVFRS-AKVRMAVFSQ  579 (718)
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCCceEEEC-CceeEEEEec
Confidence            56799999999999999998653   2222332 3356777665

>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2

Probab=94.71  E-value=0.018  Score=39.09  Aligned_cols=20  Identities=20%  Similarity=0.016  Sum_probs=18.3

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |.|.|..+|||||++..+.-
T Consensus         2 i~itG~~gsGKst~~~~l~~   21 (179)
T cd02022           2 IGLTGGIGSGKSTVAKLLKE   21 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            68999999999999999876

7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.

>PTZ00301 uridine kinase; Provisional

Probab=94.70  E-value=0.017  Score=41.16  Aligned_cols=18  Identities=17%  Similarity=0.028  Sum_probs=14.2

Q ss_pred             eeeccCCCccchhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~   53 (76)
                      |.+=|.+.||||||++++
T Consensus         6 IgIaG~SgSGKTTla~~l   23 (210)
T PTZ00301          6 IGISGASGSGKSSLSTNI   23 (210)
T ss_pred             EEEECCCcCCHHHHHHHH
Confidence            345579999999999755

>PRK14529 adenylate kinase; Provisional

Probab=94.68  E-value=0.018  Score=41.62  Aligned_cols=26  Identities=12%  Similarity=0.083  Sum_probs=20.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|+++|+.+|||||.++.++-...-|
T Consensus         2 ~I~l~G~PGsGK~T~a~~La~~~~~~   27 (223)
T PRK14529          2 NILIFGPNGSGKGTQGALVKKKYDLA   27 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHCCC
Confidence            68999999999999998776544433

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional

Probab=94.66  E-value=0.017  Score=43.45  Aligned_cols=22  Identities=9%  Similarity=-0.038  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++=.
T Consensus        26 ~~~l~G~nGsGKSTLl~~iaGl   47 (352)
T PRK11144         26 ITAIFGRSGAGKTSLINAISGL   47 (352)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5799999999999999998754

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains

Probab=94.66  E-value=0.019  Score=40.11  Aligned_cols=20  Identities=20%  Similarity=0.097  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -.+++|..+|||||++.++|
T Consensus        24 ~~~i~G~NGsGKTTLl~ai~   43 (204)
T cd03240          24 LTLIVGQNGAGKTTIIEALK   43 (204)
T ss_pred             eEEEECCCCCCHHHHHHHHH
Confidence            56899999999999999987

The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]

Probab=94.66  E-value=0.015  Score=43.64  Aligned_cols=17  Identities=18%  Similarity=0.063  Sum_probs=15.2

Q ss_pred             eeccCCCccchhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        37 LLLGaGESGKST~~~~~   53 (76)
                      -|+|.++|||||||+.+
T Consensus        37 AlIGPSGcGKST~LR~l   53 (253)
T COG1117          37 ALIGPSGCGKSTLLRCL   53 (253)
T ss_pred             EEECCCCcCHHHHHHHH
Confidence            67899999999999875

>PRK06893 DNA replication initiation factor; Validated

Probab=94.65  E-value=0.019  Score=40.68  Aligned_cols=22  Identities=14%  Similarity=0.009  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++|.|..++||||++++.|--
T Consensus        41 ~l~l~G~~G~GKThL~~ai~~~   62 (229)
T PRK06893         41 FFYIWGGKSSGKSHLLKAVSNH   62 (229)
T ss_pred             eEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999999854

>smart00763 AAA_PrkA PrkA AAA domain

Probab=94.65  E-value=0.018  Score=44.80  Aligned_cols=22  Identities=23%  Similarity=0.073  Sum_probs=19.1

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++|.|+.+|||||++.+++---
T Consensus        81 l~L~GPPGsGKStla~~La~~l  102 (361)
T smart00763       81 LYLLGPVGGGKSSLVECLKRGL  102 (361)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            5899999999999999987544

This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.

>cd04142 RRP22 RRP22 subfamily

Probab=94.65  E-value=0.019  Score=39.65  Aligned_cols=21  Identities=10%  Similarity=0.088  Sum_probs=19.2

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|+.++|.+.+|||+|+..+.
T Consensus         1 ~kI~ivG~~~vGKTsLi~~~~   21 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQFL   21 (198)
T ss_pred             CEEEEECCCCCcHHHHHHHHH
Confidence            589999999999999998865

RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death. Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation. RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Like most Ras family proteins, RRP22 is farnesylated.

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family

Probab=94.63  E-value=0.018  Score=45.41  Aligned_cols=41  Identities=15%  Similarity=0.084  Sum_probs=28.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      -.+.|+|..+||||||++.++=..   +--+.+++ ...||++.|
T Consensus        32 e~~~liG~NGsGKSTLl~~i~G~~~p~~G~i~~~~-~~~i~~v~Q   75 (552)
T TIGR03719        32 AKIGVLGLNGAGKSTLLRIMAGVDKEFNGEARPAP-GIKVGYLPQ   75 (552)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCCCCCceEEecC-CCEEEEEec
Confidence            367899999999999999998553   11233433 245777665

Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown.

>PRK08727 hypothetical protein; Validated

Probab=94.62  E-value=0.019  Score=40.83  Aligned_cols=21  Identities=33%  Similarity=0.434  Sum_probs=19.1

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|.|..+|||||++++.|.-
T Consensus        44 l~l~G~~G~GKThL~~a~~~~   64 (233)
T PRK08727         44 LYLSGPAGTGKTHLALALCAA   64 (233)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            899999999999999998753

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]

Probab=94.61  E-value=0.018  Score=42.13  Aligned_cols=31  Identities=23%  Similarity=0.128  Sum_probs=22.2

Q ss_pred             ceeeccCCCccchhhhhhhhh---hcccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT---TTSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~---~~~~~~~~~~   65 (76)
                      .+-+.|.++|||||+|..+=-   -|+--..+++
T Consensus        33 ~vaI~GpSGSGKSTLLniig~ld~pt~G~v~i~g   66 (226)
T COG1136          33 FVAIVGPSGSGKSTLLNLLGGLDKPTSGEVLING   66 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHhcccCCCCceEEECC
Confidence            467899999999999986532   2444455655

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D

Probab=94.61  E-value=0.019  Score=40.11  Aligned_cols=24  Identities=13%  Similarity=-0.064  Sum_probs=20.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+.|+|..+||||||++.++-..
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~g~~   50 (232)
T cd03300          27 EFFTLLGPSGCGKTTLLRLIAGFE   50 (232)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            467899999999999999998663

PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1

Probab=94.60  E-value=0.019  Score=42.26  Aligned_cols=22  Identities=14%  Similarity=0.039  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        65 ~~~liG~NGsGKSTLl~~I~Gl   86 (282)
T cd03291          65 MLAITGSTGSGKTSLLMLILGE   86 (282)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998754

The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia. Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole. In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells. CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.

>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]

Probab=94.59  E-value=0.03  Score=43.96  Aligned_cols=26  Identities=19%  Similarity=0.160  Sum_probs=23.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --..-|+++|..++|||||..++|-.
T Consensus        21 Gi~f~im~~G~sG~GKttfiNtL~~~   46 (373)
T COG5019          21 GIDFTIMVVGESGLGKTTFINTLFGT   46 (373)
T ss_pred             CCceEEEEecCCCCchhHHHHhhhHh
Confidence            34678899999999999999999977

>PRK04182 cytidylate kinase; Provisional

Probab=94.59  E-value=0.029  Score=36.77  Aligned_cols=26  Identities=12%  Similarity=-0.021  Sum_probs=21.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .|.+.|..+|||||+.+.+.--..-|
T Consensus         2 ~I~i~G~~GsGKstia~~la~~lg~~   27 (180)
T PRK04182          2 IITISGPPGSGKTTVARLLAEKLGLK   27 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcCCc
Confidence            57899999999999999987655444

>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2

Probab=94.57  E-value=0.02  Score=39.29  Aligned_cols=21  Identities=14%  Similarity=0.017  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++-|..+||||||+.++.-.
T Consensus         2 i~i~G~sgsGKttla~~l~~~   22 (179)
T cd02028           2 VGIAGPSGSGKTTFAKKLSNQ   22 (179)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            567899999999999988765

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).

>cd03114 ArgK-like The function of this protein family is unkown

Probab=94.56  E-value=0.02  Score=38.38  Aligned_cols=22  Identities=18%  Similarity=-0.044  Sum_probs=19.0

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.++|.++||||||+..+....
T Consensus         2 i~~~G~~GsGKTt~~~~l~~~~   23 (148)
T cd03114           2 IGITGVPGAGKSTLIDALITAL   23 (148)
T ss_pred             EEEECCCCCcHHHHHHHHHHHH
Confidence            6789999999999999887653

The protein sequences are similar to the ArgK protein in E. coli. ArgK protein is a membrane ATPase which is required for transporting arginine, ornithine and lysine into the cells by the arginine and ornithine (AO system) and lysine, arginine and ornithine (LAO) transport systems.

>PRK13947 shikimate kinase; Provisional

Probab=94.55  E-value=0.029  Score=36.92  Aligned_cols=27  Identities=19%  Similarity=0.164  Sum_probs=22.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +|+|.|..+|||||+.+.+.-...-|.
T Consensus         3 ~I~l~G~~GsGKst~a~~La~~lg~~~   29 (171)
T PRK13947          3 NIVLIGFMGTGKTTVGKRVATTLSFGF   29 (171)
T ss_pred             eEEEEcCCCCCHHHHHHHHHHHhCCCE
Confidence            589999999999999999877666654

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family

Probab=94.55  E-value=0.02  Score=39.60  Aligned_cols=33  Identities=9%  Similarity=-0.012  Sum_probs=25.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      -.+.++|..+||||||++.++-.   ++.-+.+++.
T Consensus        32 ~~~~I~G~nGsGKStLl~~l~G~~~~~~G~i~~~g~   67 (220)
T TIGR02982        32 EIVILTGPSGSGKTTLLTLIGGLRSVQEGSLKVLGQ   67 (220)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCCCCCeEEEECCE
Confidence            36789999999999999999853   3444566554

Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.

>PRK01184 hypothetical protein; Provisional

Probab=94.55  E-value=0.019  Score=38.53  Aligned_cols=17  Identities=18%  Similarity=-0.170  Sum_probs=15.1

Q ss_pred             ceeeccCCCccchhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSL   51 (76)
Q Consensus        35 KLLLLGaGESGKST~~~   51 (76)
                      .++|.|..+|||||+.+
T Consensus         3 ~i~l~G~~GsGKsT~a~   19 (184)
T PRK01184          3 IIGVVGMPGSGKGEFSK   19 (184)
T ss_pred             EEEEECCCCCCHHHHHH
Confidence            57899999999999865

>cd01857 HSR1_MMR1 HSR1/MMR1

Probab=94.55  E-value=0.022  Score=37.07  Aligned_cols=22  Identities=18%  Similarity=0.021  Sum_probs=19.7

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      +.+++++|.+.+|||||+.+++
T Consensus        83 ~~~~~~~G~~~vGKstlin~l~  104 (141)
T cd01857          83 NATIGLVGYPNVGKSSLINALV  104 (141)
T ss_pred             CcEEEEECCCCCCHHHHHHHHh
Confidence            3489999999999999999986

Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.

>TIGR01618 phage_P_loop phage nucleotide-binding protein

Probab=94.53  E-value=0.023  Score=41.12  Aligned_cols=30  Identities=13%  Similarity=0.113  Sum_probs=24.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccceeeeC
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMMINN   65 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~~~~   65 (76)
                      ..++|+.|.+++||||+++++   ..+|.+|+.
T Consensus        12 ~~~~liyG~~G~GKtt~a~~~---~~~~~~~~~   41 (220)
T TIGR01618        12 PNMYLIYGKPGTGKTSTIKYL---PGKTLVLSF   41 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHhc---CCCCEEEec
Confidence            467999999999999999887   467777764

This model represents an uncharacterized family of proteins from a number of phage of Gram-positive bacteria. This protein contains a P-loop motif, G/A-X-X-G-X-G-K-T near its amino end. The function of this protein is unknown.

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional

Probab=94.50  E-value=0.02  Score=43.00  Aligned_cols=23  Identities=4%  Similarity=-0.089  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        33 i~~iiG~nGsGKSTLlk~L~Gl~   55 (343)
T PRK11153         33 IFGVIGASGAGKSTLIRCINLLE   55 (343)
T ss_pred             EEEEECCCCCcHHHHHHHHhCCC
Confidence            56899999999999999887653

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein

Probab=94.49  E-value=0.02  Score=44.72  Aligned_cols=34  Identities=12%  Similarity=0.071  Sum_probs=25.3

Q ss_pred             CccceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      +--++.+.|..+|||||+++.++-.   ++--..+|+
T Consensus       365 ~Ge~i~IvG~sGsGKSTLlklL~gl~~p~~G~I~i~g  401 (576)
T TIGR02204       365 PGETVALVGPSGAGKSTLFQLLLRFYDPQSGRILLDG  401 (576)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHhccCCCCCEEEECC
Confidence            3347899999999999999998844   333355665

This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.

>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site

Probab=94.49  E-value=0.02  Score=38.59  Aligned_cols=26  Identities=15%  Similarity=0.043  Sum_probs=22.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +...+.++|...|||||++.++....
T Consensus         2 ~~~~I~i~G~~~sGKTTL~~~L~~~~   27 (188)
T PF00009_consen    2 NIRNIAIIGHVDSGKTTLLGALLGKA   27 (188)
T ss_dssp             TEEEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             CEEEEEEECCCCCCcEeechhhhhhc
Confidence            45678999999999999999887544

The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....

>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C

Probab=94.49  E-value=0.02  Score=38.22  Aligned_cols=24  Identities=21%  Similarity=0.163  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -.++.|.++||||||+.+++.--+
T Consensus        34 l~~i~g~~g~GKT~~~~~l~~~~~   57 (193)
T PF13481_consen   34 LTLIAGPPGSGKTTLALQLAAALA   57 (193)
T ss_dssp             EEEEEECSTSSHHHHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHHHHH
Confidence            468889999999999999876433

>PRK13851 type IV secretion system protein VirB11; Provisional

Probab=94.47  E-value=0.027  Score=43.09  Aligned_cols=25  Identities=24%  Similarity=0.216  Sum_probs=21.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .....+|+.|..+||||||++++.-
T Consensus       160 ~~~~nilI~G~tGSGKTTll~aLl~  184 (344)
T PRK13851        160 VGRLTMLLCGPTGSGKTTMSKTLIS  184 (344)
T ss_pred             HcCCeEEEECCCCccHHHHHHHHHc
Confidence            3456789999999999999999864

>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS)

Probab=94.47  E-value=0.021  Score=37.91  Aligned_cols=22  Identities=23%  Similarity=0.042  Sum_probs=18.4

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|..+|||||+++.+--..
T Consensus         2 i~i~G~~GsGKSTla~~L~~~l   23 (149)
T cd02027           2 IWLTGLSGSGKSTIARALEEKL   23 (149)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHH
Confidence            5788999999999999876554

The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]

Probab=94.44  E-value=0.022  Score=42.08  Aligned_cols=31  Identities=13%  Similarity=0.114  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.|.|.+++|||||++.+|-.   |+--..+|+
T Consensus        30 f~fl~GpSGAGKSTllkLi~~~e~pt~G~i~~~~   63 (223)
T COG2884          30 FVFLTGPSGAGKSTLLKLIYGEERPTRGKILVNG   63 (223)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhhcCCCceEEECC
Confidence            4688999999999999998864   333344444

>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells

Probab=94.43  E-value=0.018  Score=37.71  Aligned_cols=20  Identities=20%  Similarity=0.100  Sum_probs=17.3

Q ss_pred             eccCCCccchhhhhhhhhhc
Q psy6625          38 LLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        38 LLGaGESGKST~~~~~~~~~   57 (76)
                      |+|+++|||+|+.+.++--.
T Consensus         1 i~G~PgsGK~t~~~~la~~~   20 (151)
T PF00406_consen    1 ILGPPGSGKGTQAKRLAKRY   20 (151)
T ss_dssp             EEESTTSSHHHHHHHHHHHH
T ss_pred             CcCCCCCChHHHHHHHHHhc
Confidence            68999999999999887644

Two ADK isozymes have been identified in mammalian cells. These specifically bind AMP and favour binding to ATP over other nucleotide triphosphates (AK1 is cytosolic and AK2 is located in the mitochondria). A third ADK has been identified in bovine heart and human cells [], this is a mitochondrial GTP:AMP phosphotransferase, also specific for the phosphorylation of AMP, but can only use GTP or ITP as a substrate []. ADK has also been identified in different bacterial species and in yeast []. Two further enzymes are known to be related to the ADK family, i.e. yeast uridine monophosphokinase and slime mold UMP-CMP kinase. Within the ADK family there are several conserved regions, including the ATP-binding domains. One of the most conserved areas includes an Arg residue, whose modification inactivates the enzyme, together with an Asp that resides in the catalytic cleft of the enzyme and participates in a salt bridge.; GO: 0005524 ATP binding, 0019205 nucleobase-containing compound kinase activity, 0006139 nucleobase-containing compound metabolic process; PDB: 1ZD8_A 3TLX_D 1TEV_A 1ZAK_B 3CM0_A 3ADK_A 1ZIP_A 1ZIO_A 1ZIN_A 3NDP_A ....

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein

Probab=94.42  E-value=0.028  Score=41.46  Aligned_cols=23  Identities=13%  Similarity=0.239  Sum_probs=19.9

Q ss_pred             hCccceeeccCCCccchhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~   53 (76)
                      ..-.++.++|..+|||||+++.+
T Consensus        11 ~~~fr~viIG~sGSGKT~li~~l   33 (241)
T PF04665_consen   11 KDPFRMVIIGKSGSGKTTLIKSL   33 (241)
T ss_pred             CCCceEEEECCCCCCHHHHHHHH
Confidence            45579999999999999998765

This is thought to be an ATPase involved in viral DNA packaging [].

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.40  E-value=0.023  Score=40.09  Aligned_cols=22  Identities=14%  Similarity=-0.031  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++=.
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl   53 (251)
T PRK14249         32 ITAIIGPSGCGKSTLLRALNRM   53 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            5789999999999999998765

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional

Probab=94.40  E-value=0.023  Score=40.83  Aligned_cols=22  Identities=9%  Similarity=-0.103  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.++|..+||||||++.++-.
T Consensus        36 ~~~i~G~nGsGKSTLl~~l~Gl   57 (261)
T PRK14263         36 ITGFIGPSGCGKSTVLRSLNRM   57 (261)
T ss_pred             EEEEECCCCCCHHHHHHHHHcc
Confidence            5789999999999999998754

>PRK10261 glutathione transporter ATP-binding protein; Provisional

Probab=94.39  E-value=0.041  Score=44.33  Aligned_cols=32  Identities=25%  Similarity=0.262  Sum_probs=23.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus       352 ~~~lvG~nGsGKSTLlk~i~Gl~~p~~G~I~~~g~  386 (623)
T PRK10261        352 TLSLVGESGSGKSTTGRALLRLVESQGGEIIFNGQ  386 (623)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCCCCcEEEECCE
Confidence            46799999999999999998553   333445543

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily

Probab=94.39  E-value=0.023  Score=39.83  Aligned_cols=24  Identities=17%  Similarity=0.020  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      --++|.|..+|||||+++.++--.
T Consensus        44 ~~~~l~G~~G~GKTtl~~~l~~~l   67 (269)
T TIGR03015        44 GFILITGEVGAGKTTLIRNLLKRL   67 (269)
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHhc
Confidence            357899999999999999886543

Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.

>PRK08356 hypothetical protein; Provisional

Probab=94.38  E-value=0.023  Score=38.98  Aligned_cols=20  Identities=5%  Similarity=0.002  Sum_probs=17.8

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -+.+.|..+|||||+.+.+.
T Consensus         7 ~i~~~G~~gsGK~t~a~~l~   26 (195)
T PRK08356          7 IVGVVGKIAAGKTTVAKFFE   26 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            47899999999999999883

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed

Probab=94.37  E-value=0.022  Score=45.01  Aligned_cols=40  Identities=15%  Similarity=0.099  Sum_probs=28.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+||||||++.++-..   +--+.++++ ..||++.|
T Consensus        35 ~~~iiG~NGsGKSTLlk~i~G~~~p~~G~i~~~~~-~~i~~v~Q   77 (556)
T PRK11819         35 KIGVLGLNGAGKSTLLRIMAGVDKEFEGEARPAPG-IKVGYLPQ   77 (556)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCCCCCceEEecCC-CEEEEEec
Confidence            57899999999999999998653   222334332 35777665

>cd04133 Rop_like Rop subfamily

Probab=94.37  E-value=0.024  Score=38.61  Aligned_cols=22  Identities=14%  Similarity=0.170  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|.+++|||+++...+.
T Consensus         2 ~kivv~G~~~vGKTsli~~~~~   23 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLICYTS   23 (176)
T ss_pred             eEEEEECCCCCcHHHHHHHHhc
Confidence            6899999999999999998873

The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance. Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade. They transmit a variety of extracellular and intracellular signals. Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility. An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins. For example,

>PRK05642 DNA replication initiation factor; Validated

Probab=94.37  E-value=0.023  Score=40.47  Aligned_cols=22  Identities=18%  Similarity=0.077  Sum_probs=19.0

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      --++|-|..++||||++++.|-
T Consensus        46 ~~l~l~G~~G~GKTHLl~a~~~   67 (234)
T PRK05642         46 SLIYLWGKDGVGRSHLLQAACL   67 (234)
T ss_pred             CeEEEECCCCCCHHHHHHHHHH
Confidence            3467889999999999999884

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed

Probab=94.32  E-value=0.023  Score=44.70  Aligned_cols=34  Identities=18%  Similarity=0.080  Sum_probs=25.1

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc--ccceeeeCc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT--SKPMMINNN   66 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~--~~~~~~~~~   66 (76)
                      --++.+.|..+|||||+++.++-.-  +--..+|+.
T Consensus       376 G~~vaIvG~SGsGKSTL~~lL~g~~p~~G~I~i~g~  411 (588)
T PRK11174        376 GQRIALVGPSGAGKTSLLNALLGFLPYQGSLKINGI  411 (588)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCCCCcEEEECCE
Confidence            3477999999999999999887653  223555553

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]

Probab=94.32  E-value=0.043  Score=39.08  Aligned_cols=28  Identities=18%  Similarity=0.019  Sum_probs=22.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhcc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +...-+|.-|..+|||||++.++.--..
T Consensus       125 ~~~~~ili~G~tGSGKTT~l~all~~i~  152 (270)
T PF00437_consen  125 RGRGNILISGPTGSGKTTLLNALLEEIP  152 (270)
T ss_dssp             HTTEEEEEEESTTSSHHHHHHHHHHHCH
T ss_pred             ccceEEEEECCCccccchHHHHHhhhcc
Confidence            4456789999999999999999865433

These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit

Probab=94.30  E-value=0.022  Score=43.62  Aligned_cols=31  Identities=16%  Similarity=0.180  Sum_probs=23.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      -+.|+|..+|||||+++.++-.   ++--..|++
T Consensus        21 i~~l~G~sGsGKSTLLr~L~Gl~~p~~G~I~i~G   54 (363)
T TIGR01186        21 IFVIMGLSGSGKSTTVRMLNRLIEPTAGQIFIDG   54 (363)
T ss_pred             EEEEECCCCChHHHHHHHHhCCCCCCceEEEECC
Confidence            4689999999999999999854   333345554

This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact

>PRK06620 hypothetical protein; Validated

Probab=94.30  E-value=0.024  Score=40.13  Aligned_cols=25  Identities=16%  Similarity=0.096  Sum_probs=21.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      -++|-|..+|||||++++.|-....
T Consensus        46 ~l~l~Gp~G~GKThLl~a~~~~~~~   70 (214)
T PRK06620         46 TLLIKGPSSSGKTYLTKIWQNLSNA   70 (214)
T ss_pred             eEEEECCCCCCHHHHHHHHHhccCC
Confidence            4799999999999999998876554

>TIGR00150 HI0065_YjeE ATPase, YjeE family

Probab=94.28  E-value=0.11  Score=35.08  Aligned_cols=24  Identities=17%  Similarity=0.122  Sum_probs=20.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -++|.|.-++|||||++.++-.-.
T Consensus        24 ~i~l~G~lGaGKTtl~~~l~~~lg   47 (133)
T TIGR00150        24 VVLLKGDLGAGKTTLVQGLLQGLG   47 (133)
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHcC
Confidence            578999999999999999886543

Members of this family have a conserved nucleotide-binding motif GXXGXGKT and a nucleotide-binding fold. Member protein YjeE of Haemophilus influenzae (HI0065) was shown to have ATPase activity.

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional

Probab=94.27  E-value=0.024  Score=44.53  Aligned_cols=34  Identities=18%  Similarity=0.215  Sum_probs=24.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      --++.+.|..+|||||+++.+|-.-   +--..+|+.
T Consensus       349 G~~~aivG~sGsGKSTL~~ll~g~~~~~~G~i~~~g~  385 (547)
T PRK10522        349 GELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGK  385 (547)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCCCCCeEEEECCE
Confidence            3478999999999999999998432   223455543

>PRK05541 adenylylsulfate kinase; Provisional

Probab=94.25  E-value=0.026  Score=37.70  Aligned_cols=24  Identities=17%  Similarity=0.047  Sum_probs=19.6

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.-+++.|..+|||||+++.+.--
T Consensus         7 ~~~I~i~G~~GsGKst~a~~l~~~   30 (176)
T PRK05541          7 GYVIWITGLAGSGKTTIAKALYER   30 (176)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHHHH
Confidence            346788999999999999887543

>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies

Probab=94.25  E-value=0.023  Score=38.82  Aligned_cols=20  Identities=25%  Similarity=0.132  Sum_probs=15.1

Q ss_pred             cceeeccCCCccchhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~   53 (76)
                      --+|+.|..+||||+++.++
T Consensus        39 ~h~li~G~tgsGKS~~l~~l   58 (205)
T PF01580_consen   39 PHLLIAGATGSGKSTLLRTL   58 (205)
T ss_dssp             -SEEEE--TTSSHHHHHHHH
T ss_pred             ceEEEEcCCCCCccHHHHHH
Confidence            36899999999999999853

The domain contains a putative ATP binding P-loop motif. A mutation in FtsK causes a temperature sensitive block in cell division and it is involved in peptidoglycan synthesis or modification []. The SpoIIIE protein is implicated in intercellular chromosomal DNA transfer []. ; GO: 0000166 nucleotide binding, 0003677 DNA binding, 0005524 ATP binding, 0007049 cell cycle, 0007059 chromosome segregation, 0051301 cell division, 0016021 integral to membrane; PDB: 2IUS_E 2IUU_A 2IUT_A.

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes

Probab=94.25  E-value=0.028  Score=39.74  Aligned_cols=21  Identities=14%  Similarity=0.140  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .++|.|...||||||+++.+.
T Consensus        32 ~~~l~Gpn~sGKstllr~i~~   52 (216)
T cd03284          32 ILLITGPNMAGKSTYLRQVAL   52 (216)
T ss_pred             EEEEECCCCCChHHHHHHHHH
Confidence            478999999999999999864

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clam

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional

Probab=94.25  E-value=0.024  Score=44.68  Aligned_cols=35  Identities=11%  Similarity=0.001  Sum_probs=25.5

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      ..-++.+.|..+|||||+++.++-.-   +--..+|+.
T Consensus       366 ~Ge~iaIvG~SGsGKSTLl~lL~gl~~p~~G~I~idg~  403 (592)
T PRK10790        366 SRGFVALVGHTGSGKSTLASLLMGYYPLTEGEIRLDGR  403 (592)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcccCCCCceEEECCE
Confidence            34578999999999999999986432   233566654

>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain

Probab=94.24  E-value=0.026  Score=41.44  Aligned_cols=26  Identities=12%  Similarity=-0.000  Sum_probs=21.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.-++|.|.|.+|||||+..++-+-
T Consensus        75 ~~~~~~l~G~g~nGKStl~~~l~~l~  100 (304)
T TIGR01613        75 EQKLFFLYGNGGNGKSTFQNLLSNLL  100 (304)
T ss_pred             ceEEEEEECCCCCcHHHHHHHHHHHh
Confidence            35567888999999999999886554

This model represents a clade within a larger family of proteins from viruses of bacteria and animals. Members of this family are found in phage and plasmids of bacteria and archaea only. The model describes a domain of about 300 residues, found generally toward the protein C-terminus.

>COG1855 ATPase (PilT family) [General function prediction only]

Probab=94.24  E-value=0.024  Score=46.48  Aligned_cols=22  Identities=18%  Similarity=0.116  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =+|.-|++++|||||+||+--.
T Consensus       265 GILIAG~PGaGKsTFaqAlAef  286 (604)
T COG1855         265 GILIAGAPGAGKSTFAQALAEF  286 (604)
T ss_pred             ceEEecCCCCChhHHHHHHHHH
Confidence            4699999999999999998643

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes

Probab=94.23  E-value=0.027  Score=39.68  Aligned_cols=21  Identities=10%  Similarity=0.075  Sum_probs=18.7

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|.|+..|||||++++++..
T Consensus        32 ~~l~G~n~~GKstll~~i~~~   52 (204)
T cd03282          32 HIITGPNMSGKSTYLKQIALL   52 (204)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            689999999999999988754

The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch. Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily. MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes. The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis. All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action. MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily

Probab=94.23  E-value=0.039  Score=35.28  Aligned_cols=23  Identities=9%  Similarity=0.014  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.++|...|||||++.+++.-.
T Consensus         2 ~i~iiG~~~~GKtsli~~l~~~~   24 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIRKTN   24 (168)
T ss_pred             EEEEEecCCCCHHHHHHHHHhcc
Confidence            37899999999999999997543

IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.

>PRK00889 adenylylsulfate kinase; Provisional

Probab=94.22  E-value=0.027  Score=37.58  Aligned_cols=22  Identities=14%  Similarity=0.045  Sum_probs=18.1

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.+.|..+|||||+.+++.-..
T Consensus         7 i~~~G~~GsGKST~a~~la~~l   28 (175)
T PRK00889          7 VWFTGLSGAGKTTIARALAEKL   28 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            5778999999999998876543

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B

Probab=94.21  E-value=0.03  Score=38.67  Aligned_cols=24  Identities=21%  Similarity=0.191  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -+++.|.++||||||++++|.-..
T Consensus        21 i~~i~G~~GsGKT~l~~~l~~~~~   44 (235)
T cd01123          21 ITEIFGEFGSGKTQLCHQLAVTVQ   44 (235)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHee
Confidence            358899999999999999986543

This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]

Probab=94.21  E-value=0.036  Score=40.57  Aligned_cols=29  Identities=17%  Similarity=0.140  Sum_probs=22.0

Q ss_pred             eeeccCCCccchhhhhhhhhhcc--cceeee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS--KPMMIN   64 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~--~~~~~~   64 (76)
                      +.+=|+++||||||++.++-.-.  ++.+|.
T Consensus        11 IgIaG~SgSGKTTva~~l~~~~~~~~~~~I~   41 (218)
T COG0572          11 IGIAGGSGSGKTTVAKELSEQLGVEKVVVIS   41 (218)
T ss_pred             EEEeCCCCCCHHHHHHHHHHHhCcCcceEee
Confidence            44557999999999999998766  444543

>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A

Probab=94.21  E-value=0.024  Score=37.21  Aligned_cols=24  Identities=13%  Similarity=-0.053  Sum_probs=19.9

Q ss_pred             eeeccCCCccchhhhhhhhhhccc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      .++.|..++||||++.+++..-..
T Consensus        22 ~vi~G~Ng~GKStil~ai~~~L~~   45 (202)
T PF13476_consen   22 NVIYGPNGSGKSTILEAIRYALGG   45 (202)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHHHHcC
Confidence            478899999999999998876533

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein

Probab=94.18  E-value=0.025  Score=43.76  Aligned_cols=22  Identities=18%  Similarity=-0.053  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus       288 ~~~l~G~NGsGKSTLl~~l~G~  309 (500)
T TIGR02633       288 ILGVAGLVGAGRTELVQALFGA  309 (500)
T ss_pred             EEEEeCCCCCCHHHHHHHHhCC
Confidence            5789999999999999999855

Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional

Probab=94.17  E-value=0.025  Score=43.65  Aligned_cols=22  Identities=5%  Similarity=-0.035  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus       288 ~~~i~G~NGsGKSTLl~~l~G~  309 (490)
T PRK10938        288 HWQIVGPNGAGKSTLLSLITGD  309 (490)
T ss_pred             EEEEECCCCCCHHHHHHHHcCC
Confidence            4579999999999999999864

>PRK10261 glutathione transporter ATP-binding protein; Provisional

Probab=94.15  E-value=0.025  Score=45.56  Aligned_cols=23  Identities=35%  Similarity=0.358  Sum_probs=20.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||++++++-..
T Consensus        44 ~~~lvG~nGsGKSTLl~~l~Gll   66 (623)
T PRK10261         44 TLAIVGESGSGKSVTALALMRLL   66 (623)
T ss_pred             EEEEECCCCChHHHHHHHHHcCC
Confidence            57899999999999999998664

>PRK12339 2-phosphoglycerate kinase; Provisional

Probab=94.15  E-value=0.028  Score=39.65  Aligned_cols=23  Identities=9%  Similarity=-0.187  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+++.|.++|||||++..+.--.
T Consensus         5 ~i~i~G~~G~GKst~a~~l~~~~   27 (197)
T PRK12339          5 IHFIGGIPGVGKTSISGYIARHR   27 (197)
T ss_pred             EEEEECCCCCCHHHHHHHHHHhc
Confidence            46888999999999998776543

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional

Probab=94.14  E-value=0.027  Score=42.35  Aligned_cols=22  Identities=18%  Similarity=0.060  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||++++++-.
T Consensus        49 ~~~lvG~sGsGKSTLlk~i~Gl   70 (331)
T PRK15079         49 TLGVVGESGCGKSTFARAIIGL   70 (331)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC
Confidence            4679999999999999998764

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Length	Definition	E-value
Query	76
3d7m_A	354	Crystal Structure Of The G Protein Fast-Exchange Do		2e-10
2zjy_A	356	Structure Of The K349p Mutant Of Gi Alpha 1 Subunit		1e-09
3ffb_A	360	Crystal Structure Of A Fast Activating G Protein Mu		1e-09
3ums_A	354	Crystal Structure Of The G202a Mutant Of Human G-Al		1e-09
3umr_A	354	Crystal Structure Of The G202d Mutant Of Human G-Al		1e-09
1svk_A	353	Structure Of The K180p Mutant Of Gi Alpha Subunit B		5e-09
1as0_A	353	Gtp-Gamma-S Bound G42v Gia1 Length = 353		5e-09
1gp2_A	353	G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi		5e-09
1gil_A	353	Structure Of Active Conformations Of Gia1 And The M		5e-09
1gg2_A	353	G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet		5e-09
2bcj_Q	353	Crystal Structure Of G Protein-coupled Receptor Kin		6e-09
3ah8_A	355	Structure Of Heterotrimeric G Protein Galpha-Q Beta		6e-09
1zcb_A	362	Crystal Structure Of G Alpha 13 In Complex With Gdp		9e-09
2ode_A	350	Crystal Structure Of The Heterodimeric Complex Of H		1e-07
1zca_A	359	Crystal Structure Of G Alpha 12 In Complex With Gdp		6e-07

>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354

Iteration: 1
 Score = 60.8 bits (146), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/56 (51%), Positives = 43/56 (76%), Gaps = 2/56 (3%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLL--GEYFSSQMVPSLALC 54
          MGC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLL  GE   S +V  + +C
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIC 56

>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356

Iteration: 1
 Score = 58.5 bits (140), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/40 (62%), Positives = 36/40 (90%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 3  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 42

>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354

Iteration: 1
 Score = 58.2 bits (139), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/40 (62%), Positives = 36/40 (90%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 40

>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354

Iteration: 1
 Score = 58.2 bits (139), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/40 (62%), Positives = 36/40 (90%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 40

>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353

Iteration: 1
 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/39 (61%), Positives = 35/39 (89%)
Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353

Iteration: 1
 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/39 (61%), Positives = 35/39 (89%)
Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353

Iteration: 1
 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/39 (61%), Positives = 35/39 (89%)
Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353

Iteration: 1
 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/39 (61%), Positives = 35/39 (89%)
Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353

Iteration: 1
 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/39 (61%), Positives = 35/39 (89%)
Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353

Iteration: 1
 Score = 55.8 bits (133), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/40 (57%), Positives = 35/40 (87%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG ++ +++KLLLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGERSRRELKLLLLG 40

>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355

Iteration: 1
 Score = 55.8 bits (133), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/40 (57%), Positives = 35/40 (87%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG ++ +++KLLLLG
Sbjct: 3  MGCTLSAEDKAAVERSKMIDRNLREDGERSRRELKLLLLG 42

>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362

Iteration: 1
 Score = 55.5 bits (132), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/40 (57%), Positives = 35/40 (87%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG ++A+ +K+LLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGERSARLVKILLLG 40

>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350

Iteration: 1
 Score = 51.2 bits (121), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/36 (63%), Positives = 33/36 (91%)
Query: 5  MSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          +SAE++AA+ RSK I++NL+EDG +AAK++KLLLLG
Sbjct: 4  LSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLG 39

>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359

Iteration: 1
 Score = 49.3 bits (116), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/42 (54%), Positives = 34/42 (80%), Gaps = 2/42 (4%)
Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAA--KDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG + A  + +K+LLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGERRAVRRLVKILLLG 42

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	76
1cip_A	353	Protein (guanine nucleotide-binding protein alpha-	1e-11
1zcb_A	362	G alpha I/13; GTP-binding, lipoprotein, membrane,	5e-11
1azs_C	402	GS-alpha; complex (lyase/hydrolase), hydrolase, si	1e-09
1qzv_F	154	Plant photosystem I: subunit PSAF; photosynthesis,	4e-04

>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353

 Score = 57.4 bits (138), Expect = 1e-11
 Identities = 24/39 (61%), Positives = 35/39 (89%)

Query: 2  GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          GC +SAE++AA+ RSK I++NL+EDG +AA+++KLLLLG
Sbjct: 1  GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLG 39

>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362

 Score = 55.5 bits (133), Expect = 5e-11
 Identities = 23/40 (57%), Positives = 35/40 (87%)

Query: 1  MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC +SAE++AA+ RSK I++NL+EDG ++A+ +K+LLLG
Sbjct: 1  MGCTLSAEDKAAVERSKMIDRNLREDGERSARLVKILLLG 40

>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402

 Score = 51.7 bits (123), Expect = 1e-09
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 1  MGCAMSA-------EERAALARSKQIEKNLKEDGIQAAKDIKLLLLG 40
          MGC  ++       EE+A    +K+IEK L++D        +LLLLG
Sbjct: 1  MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLG 47

>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154

 Score = 35.3 bits (80), Expect = 4e-04
 Identities = 13/51 (25%), Positives = 22/51 (43%), Gaps = 22/51 (43%)

Query: 20 EKN-LKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVE 69
          EK  LK+  +QA+  +KL      ++    P+LA+             T+E
Sbjct: 18 EKQALKK--LQAS--LKL------YADDSAPALAI-----------KATME 47

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	76
1azs_C	402	GS-alpha; complex (lyase/hydrolase), hydrolase, si	99.77
1cip_A	353	Protein (guanine nucleotide-binding protein alpha-	99.75
1zcb_A	362	G alpha I/13; GTP-binding, lipoprotein, membrane,	99.68
3ohm_A	327	Guanine nucleotide-binding protein G(Q) subunit A;	99.17
4fid_A	340	G protein alpha subunit; RAS-like domain, all-heli	99.11
2xtz_A	354	Guanine nucleotide-binding protein alpha-1 subuni;	98.7
1z2a_A	168	RAS-related protein RAB-23; RAB GTPase, vesicular	97.31
2ce2_X	166	GTPase HRAS; signaling protein, guanine nucleotide	97.24
1upt_A	171	ARL1, ADP-ribosylation factor-like protein 1; hydr	97.23
2erx_A	172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	97.2
1u8z_A	168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	97.18
1c1y_A	167	RAS-related protein RAP-1A; GTP-binding proteins,	97.18
1ky3_A	182	GTP-binding protein YPT7P; vesicular traffic, GTP	97.17
1kao_A	167	RAP2A; GTP-binding protein, small G protein, GDP,	97.16
1z0j_A	170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	97.15
1z08_A	170	RAS-related protein RAB-21; RAB GTPase, vesicular	97.13
3q72_A	166	GTP-binding protein RAD; G-domain, CAV2 beta, sign	97.13
2oil_A	193	CATX-8, RAS-related protein RAB-25; G-protein, GDP	97.12
2zej_A	184	Dardarin, leucine-rich repeat kinase 2; parkinson'	97.12
2o52_A	200	RAS-related protein RAB-4B; G-protein, GDP, struct	97.12
1r2q_A	170	RAS-related protein RAB-5A; GTPase, GNP, atomic re	97.11
1z0f_A	179	RAB14, member RAS oncogene family; RAB GTPase, ves	97.1
3clv_A	208	RAB5 protein, putative; malaria, GTPase, structura	97.09
1ek0_A	170	Protein (GTP-binding protein YPT51); vesicular tra	97.08
2a9k_A	187	RAS-related protein RAL-A; bacterial ADP-ribosyltr	97.07
1h65_A	270	Chloroplast outer envelope protein OEP34; GTPase,	97.07
1g16_A	170	RAS-related protein SEC4; G protein RAB, signaling	97.05
3tw8_B	181	RAS-related protein RAB-35; longin domain, RAB GTP	97.05
2wkq_A	332	NPH1-1, RAS-related C3 botulinum toxin substrate 1	97.05
2fn4_A	181	P23, RAS-related protein R-RAS; GDP/GTP binding, G	97.05
3con_A	190	GTPase NRAS; structural genomics consortium, SGC,	97.04
2hxs_A	178	RAB-26, RAS-related protein RAB-28; GTPase, signal	97.04
3kkq_A	183	RAS-related protein M-RAS; GTP-binding, GTPase, si	97.03
2efe_B	181	Small GTP-binding protein-like; GEF, GTPase, VPS9,	97.01
4dsu_A	189	GTPase KRAS, isoform 2B; small G-protein, signalin	97.01
2f9l_A	199	RAB11B, member RAS oncogene family; RAB11B GTPase,	97.0
2fg5_A	192	RAB-22B, RAS-related protein RAB-31; G-protein, GT	97.0
3bwd_D	182	RAC-like GTP-binding protein ARAC6; G domain, cyto	96.99
3q85_A	169	GTP-binding protein REM 2; G-domain, CAV2 beta, si	96.99
2nzj_A	175	GTP-binding protein REM 1; GDP/GTP binding, GTP hy	96.98
3def_A	262	T7I23.11 protein; chloroplast, TOC33, GTPase, hydr	96.98
2y8e_A	179	RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti	96.98
2bov_A	206	RAla, RAS-related protein RAL-A; C3BOT, exoenzyme,	96.98
3oes_A	201	GTPase rhebl1; small GTPase, structural genomics,	96.98
1oix_A	191	RAS-related protein RAB-11A; small G protein, intr	96.98
2lkc_A	178	Translation initiation factor IF-2; NMR {Geobacill	96.97
1mh1_A	186	RAC1; GTP-binding, GTPase, small G-protein, RHO fa	96.96
3bc1_A	195	RAS-related protein RAB-27A; RAB27, GTPase, RAB, s	96.96
2iwr_A	178	Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi	96.96
2f7s_A	217	C25KG, RAS-related protein RAB-27B; G-protein, str	96.94
1vg8_A	207	RAS-related protein RAB-7; GTP-binding protein, pr	96.93
2j1l_A	214	RHO-related GTP-binding protein RHOD; GTPase, memb	96.93
2bme_A	186	RAB4A, RAS-related protein RAB4A; GTP-binding prot	96.93
1ksh_A	186	ARF-like protein 2; small GTPase, small GTP-bindin	96.93
2wjg_A	188	FEOB, ferrous iron transport protein B homolog; me	96.92
2gf0_A	199	GTP-binding protein DI-RAS1; GDP/GTP binding, GTP	96.92
2ged_A	193	SR-beta, signal recognition particle receptor beta	96.92
3ihw_A	184	Centg3; RAS, centaurin, GTPase, structural genomic	96.91
3cbq_A	195	GTP-binding protein REM 2; FLJ38964A, structural g	96.91
1wms_A	177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	96.91
2dyk_A	161	GTP-binding protein; GTPase, ribosome-binding prot	96.91
1r8s_A	164	ADP-ribosylation factor 1; protein transport/excha	96.9
3dz8_A	191	RAS-related protein RAB-3B; GDP, GTPase, structura	96.89
1moz_A	183	ARL1, ADP-ribosylation factor-like protein 1; GTP-	96.88
2q3h_A	201	RAS homolog gene family, member U; GTPase, structu	96.88
1z06_A	189	RAS-related protein RAB-33B; RAB GTPase, RAB33B GT	96.88
2g6b_A	180	RAS-related protein RAB-26; G-protein, GTP analogu	96.87
1zj6_A	187	ADP-ribosylation factor-like protein 5; ARL, GTP-b	96.87
1m7b_A	184	RND3/RHOE small GTP-binding protein; small GTPase,	96.87
2fh5_B	214	SR-beta, signal recognition particle receptor beta	96.87
3c5c_A	187	RAS-like protein 12; GDP, GTPase, structural genom	96.87
2cxx_A	190	Probable GTP-binding protein ENGB; structural geno	96.86
2atv_A	196	RERG, RAS-like estrogen-regulated growth inhibitor	96.86
3reg_A	194	RHO-like small GTPase; cytoskeleton, nucleotide-bi	96.84
4djt_A	218	GTP-binding nuclear protein GSP1; structural genom	96.84
1nrj_B	218	SR-beta, signal recognition particle receptor beta	96.83
1svi_A	195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	96.82
2h57_A	190	ADP-ribosylation factor-like protein 6; GTP, GTPas	96.81
1x3s_A	195	RAS-related protein RAB-18; GTPase, GNP, structura	96.81
2hf9_A	226	Probable hydrogenase nickel incorporation protein	96.8
1zd9_A	188	ADP-ribosylation factor-like 10B; transport protei	96.8
3t5g_A	181	GTP-binding protein RHEB; immunoglobulin-like beta	96.8
3l0i_B	199	RAS-related protein RAB-1A; GEF-GDF-RAB complex, G	96.79
2h17_A	181	ADP-ribosylation factor-like protein 5A; GDP, GTPa	96.79
2cjw_A	192	GTP-binding protein GEM; nucleotide-binding, small	96.77
3q3j_B	214	RHO-related GTP-binding protein RHO6; RAS-binding	96.77
3cph_A	213	RAS-related protein SEC4; RAB GTPase, prenylation,	96.76
2b6h_A	192	ADP-ribosylation factor 5; membrane trafficking, G	96.74
2a5j_A	191	RAS-related protein RAB-2B; GTPase, signal transdu	96.74
2x77_A	189	ADP-ribosylation factor; GTP-binding protein, smal	96.73
3pqc_A	195	Probable GTP-binding protein ENGB; rossmann fold,	96.73
4gzl_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	96.72
2wji_A	165	Ferrous iron transport protein B homolog; membrane	96.72
2bcg_Y	206	Protein YP2, GTP-binding protein YPT1; RABGTPase,	96.71
3tkl_A	196	RAS-related protein RAB-1A; vesicle trafficking, p	96.69
3t1o_A	198	Gliding protein MGLA; G domain containing protein,	96.69
2ew1_A	201	RAS-related protein RAB-30; G-protein, GTP analogu	96.68
1gwn_A	205	RHO-related GTP-binding protein RHOE; GTPase, inac	96.68
1fzq_A	181	ADP-ribosylation factor-like protein 3; protein-GD	96.68
2p5s_A	199	RAS and EF-hand domain containing; G-protein, RAB,	96.68
3gj0_A	221	GTP-binding nuclear protein RAN; G protein, GDP, a	96.67
1m2o_B	190	GTP-binding protein SAR1, GTP binding protein; zin	96.66
2hup_A	201	RAS-related protein RAB-43; G-protein, GDP, struct	96.66
2gf9_A	189	RAS-related protein RAB-3D; G-protein, structural	96.66
2fu5_C	183	RAS-related protein RAB-8A; MSS4:RAB8 protein comp	96.65
4bas_A	199	ADP-ribosylation factor, putative (small GTPase, p	96.65
2il1_A	192	RAB12; G-protein, GDP, GTPase, predicted, structur	96.64
2ehv_A	251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	96.64
1zbd_A	203	Rabphilin-3A; G protein, effector, RABCDR, synapti	96.64
3llu_A	196	RAS-related GTP-binding protein C; structural geno	96.59
3n70_A	145	Transport activator; sigma-54, ntpase, PSI, MCSG,	96.59
1zp6_A	191	Hypothetical protein ATU3015; alpha-beta protein.,	96.58
3tr0_A	205	Guanylate kinase, GMP kinase; purines, pyrimidines	96.57
2qu8_A	228	Putative nucleolar GTP-binding protein 1; GTPase,	96.56
4gp7_A	171	Metallophosphoesterase; polynucleotide kinase phos	96.56
1ye8_A	178	Protein THEP1, hypothetical UPF0334 kinase-like pr	96.55
2yc2_C	208	IFT27, small RAB-related GTPase; transport protein	96.54
2fv8_A	207	H6, RHO-related GTP-binding protein RHOB; GDP/GTP	96.52
1kag_A	173	SKI, shikimate kinase I; transferase, structural g	96.5
2gco_A	201	H9, RHO-related GTP-binding protein RHOC; GTPase,s	96.5
2j0v_A	212	RAC-like GTP-binding protein ARAC7; nucleotide-bin	96.49
3lw7_A	179	Adenylate kinase related protein (ADKA-like); AMP,	96.48
2p5t_B	253	PEZT; postsegregational killing system, phosphoryl	96.47
2atx_A	194	Small GTP binding protein TC10; GTPase, P-loop, al	96.46
1f6b_A	198	SAR1; gtpases, N-terminal helix, Mg-containing com	96.45
3th5_A	204	RAS-related C3 botulinum toxin substrate 1; rossma	95.45
1ly1_A	181	Polynucleotide kinase; PNK, phosphatase, transfera	96.42
1pui_A	210	ENGB, probable GTP-binding protein ENGB; structura	96.41
2gj8_A	172	MNME, tRNA modification GTPase TRME; G-domain dime	96.4
3fb4_A	216	Adenylate kinase; psychrophIle, phosphotransferase	96.4
4a74_A	231	DNA repair and recombination protein RADA; hydrola	96.39
3lxx_A	239	GTPase IMAP family member 4; structural genomics c	96.39
3c8u_A	208	Fructokinase; YP_612366.1, putative fructose trans	96.39
4dkx_A	216	RAS-related protein RAB-6A; GTP binding fold, memb	96.36
2cbz_A	237	Multidrug resistance-associated protein 1; ABC pro	96.36
3dl0_A	216	Adenylate kinase; phosphotransferase, zinc coordin	96.36
4dhe_A	223	Probable GTP-binding protein ENGB; melioidosis, RA	96.35
3tlx_A	243	Adenylate kinase 2; structural genomics, structura	96.34
2j41_A	207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	96.34
3cpj_B	223	GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl	96.32
3sop_A	270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	96.28
3asz_A	211	Uridine kinase; cytidine phosphorylation, transfer	96.28
1knq_A	175	Gluconate kinase; ALFA/beta structure, transferase	96.26
3t5d_A	274	Septin-7; GTP-binding protein, cytoskeleton, signa	96.25
3kb2_A	173	SPBC2 prophage-derived uncharacterized protein YOR	96.24
1kgd_A	180	CASK, peripheral plasma membrane CASK; maguk, guan	96.23
2bbw_A	246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	96.19
1htw_A	158	HI0065; nucleotide-binding fold, structural genomi	96.19
1tev_A	196	UMP-CMP kinase; ploop, NMP binding region, LID reg	96.16
3t61_A	202	Gluconokinase; PSI-biology, structural genomics, p	96.16
4eun_A	200	Thermoresistant glucokinase; putative sugar kinase	96.15
3ec2_A	180	DNA replication protein DNAC; helicase loader, rep	96.15
3cm0_A	186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	96.14
2pze_A	229	Cystic fibrosis transmembrane conductance regulat;	96.13
3a00_A	186	Guanylate kinase, GMP kinase; domain movement, dim	96.12
2bdt_A	189	BH3686; alpha-beta protein, structural genomics, P	96.12
3lxw_A	247	GTPase IMAP family member 1; immunity, structural	96.07
1lvg_A	198	Guanylate kinase, GMP kinase; transferase; HET: AD	96.04
1cke_A	227	CK, MSSA, protein (cytidine monophosphate kinase);	96.04
2aka_B	299	Dynamin-1; fusion protein, GTPase domain, myosin,	96.03
2w0m_A	235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	96.02
1c9k_A	180	COBU, adenosylcobinamide kinase; alpha/beta struct	96.01
1qhx_A	178	CPT, protein (chloramphenicol phosphotransferase);	96.0
3tif_A	235	Uncharacterized ABC transporter ATP-binding prote;	96.0
2g3y_A	211	GTP-binding protein GEM; small GTPase, GDP, inacti	95.98
2xtp_A	260	GTPase IMAP family member 2; immune system, G prot	95.98
1znw_A	207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	95.97
2if2_A	204	Dephospho-COA kinase; alpha-beta protein, structur	95.97
1nks_A	194	Adenylate kinase; thermophilic, transferase; HET:	95.95
1mv5_A	243	LMRA, multidrug resistance ABC transporter ATP-bin	95.9
2eyu_A	261	Twitching motility protein PILT; pilus retraction	95.9
3b85_A	208	Phosphate starvation-inducible protein; PHOH2, ATP	95.88
3vaa_A	199	Shikimate kinase, SK; structural genomics, center	95.88
1sgw_A	214	Putative ABC transporter; structural genomics, P p	95.87
3lnc_A	231	Guanylate kinase, GMP kinase; ALS collaborative cr	95.87
3k53_A	271	Ferrous iron transport protein B; GTPase fold, hel	95.87
2wsm_A	221	Hydrogenase expression/formation protein (HYPB); m	95.86
2pcj_A	224	ABC transporter, lipoprotein-releasing system ATP-	95.85
1lw7_A	365	Transcriptional regulator NADR; NMN, NMN adenylyl	95.82
2jaq_A	205	Deoxyguanosine kinase; transferase, deoxyribonucle	95.82
1via_A	175	Shikimate kinase; structural genomics, transferase	95.82
1ji0_A	240	ABC transporter; ATP binding protein, structural g	95.82
3kta_A	182	Chromosome segregation protein SMC; structural mai	95.81
2cvh_A	220	DNA repair and recombination protein RADB; filamen	95.81
3iij_A	180	Coilin-interacting nuclear ATPase protein; alpha a	95.81
2pt5_A	168	Shikimate kinase, SK; aromatic amino acid biosynth	95.81
1jjv_A	206	Dephospho-COA kinase; P-loop nucleotide-binding fo	95.79
2qag_A	361	Septin-2, protein NEDD5; cell cycle, cell division	95.78
2d2e_A	250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	95.77
1e4v_A	214	Adenylate kinase; transferase(phosphotransferase);	95.76
1vpl_A	256	ABC transporter, ATP-binding protein; TM0544, stru	95.76
3dpu_A	535	RAB family protein; roccor, G-domain, COR, GTP-bin	95.75
3a1s_A	258	Iron(II) transport protein B; FEOB, iron transport	95.75
2ff7_A	247	Alpha-hemolysin translocation ATP-binding protein	95.75
2ixe_A	271	Antigen peptide transporter 1; ABC ATPase, hydrola	95.75
1kht_A	192	Adenylate kinase; phosphotransferase, signaling pr	95.74
2plr_A	213	DTMP kinase, probable thymidylate kinase; TMP-bind	95.74
2iyv_A	184	Shikimate kinase, SK; transferase, aromatic amino	95.73
1aky_A	220	Adenylate kinase; ATP:AMP phosphotransferase, myok	95.73
2qor_A	204	Guanylate kinase; phosphotransferase, purine metab	95.73
3gfo_A	275	Cobalt import ATP-binding protein CBIO 1; structur	95.71
1g6h_A	257	High-affinity branched-chain amino acid transport	95.71
1qf9_A	194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	95.71
2rhm_A	193	Putative kinase; P-loop containing nucleoside trip	95.7
2yz2_A	266	Putative ABC transporter ATP-binding protein TM_0;	95.7
1z6g_A	218	Guanylate kinase; structural genomics, SGC, struct	95.69
2jeo_A	245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	95.69
2onk_A	240	Molybdate/tungstate ABC transporter, ATP-binding p	95.69
1b0u_A	262	Histidine permease; ABC transporter, transport pro	95.69
1s96_A	219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	95.68
2pjz_A	263	Hypothetical protein ST1066; ATP binding protein,	95.68
1y63_A	184	LMAJ004144AAA protein; structural genomics, protei	95.68
2pbr_A	195	DTMP kinase, thymidylate kinase; transferase, nucl	95.67
2vli_A	183	Antibiotic resistance protein; transferase, tunica	95.66
2kjq_A	149	DNAA-related protein; solution structure, NESG, st	95.64
3uie_A	200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	95.64
2qnr_A	301	Septin-2, protein NEDD5; structural genomics conso	95.62
1ixz_A	254	ATP-dependent metalloprotease FTSH; AAA domain fol	95.62
3jvv_A	356	Twitching mobility protein; hexameric P-loop ATPas	95.61
2olj_A	263	Amino acid ABC transporter; ABC domain, ATPase, hy	95.61
3tau_A	208	Guanylate kinase, GMP kinase; structural genomics,	95.61
2qi9_C	249	Vitamin B12 import ATP-binding protein BTUD; inner	95.6
2bbs_A	290	Cystic fibrosis transmembrane conductance regulato	95.6
1e6c_A	173	Shikimate kinase; phosphoryl transfer, ADP, shikim	95.6
2zu0_C	267	Probable ATP-dependent transporter SUFC; iron-sulf	95.59
3sr0_A	206	Adenylate kinase; phosphoryl transfer analogue, AL	95.57
1n0w_A	243	DNA repair protein RAD51 homolog 1; DNA repair, ho	95.56
3o47_A	329	ADP-ribosylation factor GTPase-activating protein	95.55
2nq2_C	253	Hypothetical ABC transporter ATP-binding protein H	95.55
3trf_A	185	Shikimate kinase, SK; amino acid biosynthesis, tra	95.54
4g1u_C	266	Hemin import ATP-binding protein HMUV; membrane tr	95.53
2ghi_A	260	Transport protein; multidrug resistance protein, M	95.52
2pt7_A	330	CAG-ALFA; ATPase, protein-protein complex, type IV	95.52
3c5h_A	255	Glucocorticoid receptor DNA-binding factor 1; RAS,	95.51
2ihy_A	279	ABC transporter, ATP-binding protein; ATPase, ABC	95.5
2qt1_A	207	Nicotinamide riboside kinase 1; non-protein kinase	95.49
1rz3_A	201	Hypothetical protein rbstp0775; MCSG, structural g	95.49
2bwj_A	199	Adenylate kinase 5; phosphoryl transfer reaction,	95.46
3umf_A	217	Adenylate kinase; rossmann fold, transferase; 2.05	95.45
3b1v_A	272	Ferrous iron uptake transporter protein B; G prote	95.43
2cdn_A	201	Adenylate kinase; phosphoryl transfer, associative	95.42
1uj2_A	252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	95.41
2ze6_A	253	Isopentenyl transferase; crown GALL tumor, cytokin	95.41
2c95_A	196	Adenylate kinase 1; transferase, AP4A, nucleotide	95.4
2pez_A	179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	95.39
3r7w_A	307	Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT	95.37
1nlf_A	279	Regulatory protein REPA; replicative DNA helicase	95.36
1zuh_A	168	Shikimate kinase; alpha-beta protein, transferase;	95.36
3i8s_A	274	Ferrous iron transport protein B; GTPase, GPCR, ir	95.36
3aez_A	312	Pantothenate kinase; transferase, homodimer, COA b	95.34
3be4_A	217	Adenylate kinase; malaria, cryptosporidium parvum	95.32
2qag_C	418	Septin-7; cell cycle, cell division, GTP-binding,	95.32
2z0h_A	197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	95.3
2gza_A	361	Type IV secretion system protein VIRB11; ATPase, h	95.3
1iy2_A	278	ATP-dependent metalloprotease FTSH; AAA domain fol	95.3
2x2e_A	353	Dynamin-1; nitration, hydrolase, membrane fission,	95.29
1zd8_A	227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	95.28
2wwf_A	212	Thymidilate kinase, putative; transferase, malaria	95.24
1p9r_A	418	General secretion pathway protein E; bacterial typ	95.24
1cr0_A	296	DNA primase/helicase; RECA-type protein fold, tran	95.23
1ukz_A	203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	95.22
1sq5_A	308	Pantothenate kinase; P-loop, transferase; HET: PAU	95.22
1f2t_A	149	RAD50 ABC-ATPase; DNA double-strand break repair,	95.21
2yvu_A	186	Probable adenylyl-sulfate kinase; transferase, str	95.2
1uf9_A	203	TT1252 protein; P-loop, nucleotide binding domain,	95.18
1nn5_A	215	Similar to deoxythymidylate kinase (thymidylate K;	95.17
2xb4_A	223	Adenylate kinase; ATP-binding, nucleotide-binding,	95.16
2www_A	349	Methylmalonic aciduria type A protein, mitochondri	95.14
2v54_A	204	DTMP kinase, thymidylate kinase; nucleotide biosyn	95.13
2qtf_A	364	Protein HFLX, GTP-binding protein; beta-alpha-barr	95.12
2grj_A	192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	95.11
1ltq_A	301	Polynucleotide kinase; phosphatase, alpha/beta, P-	95.11
2ewv_A	372	Twitching motility protein PILT; pilus retraction	95.09
2dr3_A	247	UPF0273 protein PH0284; RECA superfamily ATPase, h	95.08
1gvn_B	287	Zeta; postsegregational killing system, plasmid; 1	95.07
2v9p_A	305	Replication protein E1; AAA+ molecular motor, DNA	95.05
2x8a_A	274	Nuclear valosin-containing protein-like; nuclear p	95.02
1zak_A	222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	95.02
2j69_A	695	Bacterial dynamin-like protein; FZO, FZL, GTPase,	95.0
3a4m_A	260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	94.99
2npi_A	460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	94.99
1odf_A	290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	94.96
3co5_A	143	Putative two-component system transcriptional RES	94.94
2i3b_A	189	HCR-ntpase, human cancer-related ntpase; AAA, ross	94.91
2qag_B	427	Septin-6, protein NEDD5; cell cycle, cell division	94.9
1ak2_A	233	Adenylate kinase isoenzyme-2; nucleoside monophosp	94.89
1jbk_A	195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	94.86
2w58_A	202	DNAI, primosome component (helicase loader); ATP-b	94.86
1vht_A	218	Dephospho-COA kinase; structural genomics, transfe	94.83
1lv7_A	257	FTSH; alpha/beta domain, four helix bundle, hydrol	94.83
2oap_1	511	GSPE-2, type II secretion system protein; hexameri	94.8
3gee_A	476	MNME, tRNA modification GTPase MNME; G protein, cy	94.79
1z47_A	355	CYSA, putative ABC-transporter ATP-binding protein	94.77
2vp4_A	230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	94.75
2e87_A	357	Hypothetical protein PH1320; GTP-binding, GTPase,	94.75
1g29_1	372	MALK, maltose transport protein MALK; ATPase, acti	94.75
4e22_A	252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	94.74
3iby_A	256	Ferrous iron transport protein B; G protein, G dom	94.72
2it1_A	362	362AA long hypothetical maltose/maltodextrin trans	94.7
1v43_A	372	Sugar-binding transport ATP-binding protein; ATPas	94.66
2yyz_A	359	Sugar ABC transporter, ATP-binding protein; sugar	94.66
1m7g_A	211	Adenylylsulfate kinase; APS kinase, transferase, s	94.65
3p32_A	355	Probable GTPase RV1496/MT1543; structural genomics	94.6
3fvq_A	359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	94.58
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	94.55
1jwy_B	315	Dynamin A GTPase domain; dynamin, GTPase, GDP, myo	94.54
3ake_A	208	Cytidylate kinase; CMP kinase, CMP complex, open c	94.53
3qks_A	203	DNA double-strand break repair RAD50 ATPase; RECA-	94.52
3bos_A	242	Putative DNA replication factor; P-loop containing	94.48
1in4_A	334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	94.47
3nh6_A	306	ATP-binding cassette SUB-family B member 6, mitoc;	94.46
1gtv_A	214	TMK, thymidylate kinase; transferase, transferase	94.41
3rlf_A	381	Maltose/maltodextrin import ATP-binding protein M;	94.39
3t34_A	360	Dynamin-related protein 1A, linker, dynamin-relat	94.37
3d31_A	348	Sulfate/molybdate ABC transporter, ATP-binding pro	94.37
1u0l_A	301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	94.31
3h4m_A	285	Proteasome-activating nucleotidase; ATPase, PAN, A	94.28
3sjy_A	403	Translation initiation factor 2 subunit gamma; zin	94.27
2bjv_A	265	PSP operon transcriptional activator; AAA, transcr	94.26
3tqc_A	321	Pantothenate kinase; biosynthesis of cofactors, pr	94.25
1oxx_K	353	GLCV, glucose, ABC transporter, ATP binding protei	94.22
3pfi_A	338	Holliday junction ATP-dependent DNA helicase RUVB;	94.22
1ega_A	301	Protein (GTP-binding protein ERA); GTPase, RNA-bin	94.19
2p65_A	187	Hypothetical protein PF08_0063; CLPB, malaria, str	94.18
3tui_C	366	Methionine import ATP-binding protein METN; ABC-tr	94.16
3lvq_E	497	ARF-GAP with SH3 domain, ANK repeat and PH domain	94.16
2qz4_A	262	Paraplegin; AAA+, SPG7, protease, ADP, structural	94.15
1wf3_A	301	GTP-binding protein; GTPase, riken structural geno	94.06
3lda_A	400	DNA repair protein RAD51; DNA binding protein, ATP	94.05
1pzn_A	349	RAD51, DNA repair and recombination protein RAD51,	94.04
3b9p_A	297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	94.03
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	94.02
2yv5_A	302	YJEQ protein; hydrolase, GTPase, permutation, stru	94.02
3gd7_A	390	Fusion complex of cystic fibrosis transmembrane co	94.0
3geh_A	462	MNME, tRNA modification GTPase MNME; G protein, U3	93.96
1qhl_A	227	Protein (cell division protein MUKB); SMC, chromos	93.94
1sxj_E	354	Activator 1 40 kDa subunit; clamp loader, processi	93.92
1svm_A	377	Large T antigen; AAA+ fold, viral protein; HET: AT	93.89
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	93.88
2f1r_A	171	Molybdopterin-guanine dinucleotide biosynthesis pr	93.87
2f6r_A	281	COA synthase, bifunctional coenzyme A synthase; 18	93.85
2qm8_A	337	GTPase/ATPase; G protein, G3E, metallochaperone, c	93.8
3p26_A	483	Elongation factor 1 alpha-like protein; GTP/GDP bi	93.77
2chg_A	226	Replication factor C small subunit; DNA-binding pr	93.77
1rj9_A	304	FTSY, signal recognition protein; SRP-GTPase domai	93.77
2ius_A	512	DNA translocase FTSK; nucleotide-binding, chromoso	93.77
1yrb_A	262	ATP(GTP)binding protein; GTPase, P-loop, rossman f	93.73
3ney_A	197	55 kDa erythrocyte membrane protein; structural ge	93.71
1tq4_A	413	IIGP1, interferon-inducible GTPase; interferon gam	93.7
1bif_A	469	6-phosphofructo-2-kinase/ fructose-2,6-bisphospha;	93.7
2yl4_A	595	ATP-binding cassette SUB-family B member 10, mitoc	93.69
1njg_A	250	DNA polymerase III subunit gamma; rossman-like fol	93.63
3nwj_A	250	ATSK2; P loop, shikimate, nucleoside monophosphate	93.58
1hqc_A	324	RUVB; extended AAA-ATPase domain, complex with nuc	93.58
3zvl_A	416	Bifunctional polynucleotide phosphatase/kinase; hy	93.57
3b60_A	582	Lipid A export ATP-binding/permease protein MSBA;	93.47
3b9q_A	302	Chloroplast SRP receptor homolog, alpha subunit CP	93.39
1q3t_A	236	Cytidylate kinase; nucleotide monophosphate kinase	93.38
3b5x_A	582	Lipid A export ATP-binding/permease protein MSBA;	93.35
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	93.33
2dby_A	368	GTP-binding protein; GDP, structural genomics, NPP	93.26
2r62_A	268	Cell division protease FTSH homolog; ATPase domain	93.22
1np6_A	174	Molybdopterin-guanine dinucleotide biosynthesis pr	93.19
2qmh_A	205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	93.17
3euj_A	483	Chromosome partition protein MUKB, linker; MUKB, M	93.16
4eaq_A	229	DTMP kinase, thymidylate kinase; structural genomi	93.16
1nij_A	318	Hypothetical protein YJIA; structural genomics, P-	93.11
3r20_A	233	Cytidylate kinase; structural genomics, seattle st	93.08
4ag6_A	392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	93.08
2rcn_A	358	Probable GTPase ENGC; YJEQ, circularly permuted, G	93.05
1tf7_A	525	KAIC; homohexamer, hexamer, circadian clock protei	93.03
1ex7_A	186	Guanylate kinase; substrate-induced FIT, domain mo	93.02
1l8q_A	324	Chromosomal replication initiator protein DNAA; AA	92.97
3qf4_B	598	Uncharacterized ABC transporter ATP-binding prote	92.97
1jny_A	435	EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-	92.96
1d2n_A	272	N-ethylmaleimide-sensitive fusion protein; hexamer	92.95
1a7j_A	290	Phosphoribulokinase; transferase, calvin cycle; 2.	92.91
2c78_A	405	Elongation factor TU-A; hydrolase, GTPase, transla	92.89
1d2e_A	397	Elongation factor TU (EF-TU); G-protein, beta-barr	92.86
1xzp_A	482	Probable tRNA modification GTPase TRME; GTP-bindin	92.85
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	92.81
3cf0_A	301	Transitional endoplasmic reticulum ATPase; AAA, P9	92.8
4dcu_A	456	GTP-binding protein ENGA; GTPase, GDP, protein bin	92.78
1p5z_B	263	DCK, deoxycytidine kinase; nucleoside kinase, P-lo	92.78
3ozx_A	538	RNAse L inhibitor; ATP binding cassette protein, h	92.78
3szr_A	608	Interferon-induced GTP-binding protein MX1; interf	92.73
3iev_A	308	GTP-binding protein ERA; ERA, GTPase, KH domain, a	92.71
3qf7_A	365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	92.7
4a82_A	578	Cystic fibrosis transmembrane conductance regulat;	92.68
3hr8_A	356	Protein RECA; alpha and beta proteins (A/B, A+B),	92.58
3cnl_A	262	YLQF, putative uncharacterized protein; circular p	92.49
1kk1_A	410	EIF2gamma; initiation of translation; HET: GNP; 1.	92.44
1yqt_A	538	RNAse L inhibitor; ATP-binding cassette, ribosome	92.44
1jal_A	363	YCHF protein; nucleotide-binding fold, structural	92.42
3bk7_A	607	ABC transporter ATP-binding protein; ABC ATPase, i	92.42
3syl_A	309	Protein CBBX; photosynthesis, rubisco activase, AA	92.41
2zts_A	251	Putative uncharacterized protein PH0186; KAIC like	92.35
1lnz_A	342	SPO0B-associated GTP-binding protein; GTPase, OBG,	92.34
3eie_A	322	Vacuolar protein sorting-associated protein 4; AAA	92.34
2og2_A	359	Putative signal recognition particle receptor; nuc	92.32
2yhs_A	503	FTSY, cell division protein FTSY; cell cycle, prot	92.31
3ec1_A	369	YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase	92.29
2dpy_A	438	FLII, flagellum-specific ATP synthase; beta barrel	92.28
1um8_A	376	ATP-dependent CLP protease ATP-binding subunit CL;	92.28
1ofh_A	310	ATP-dependent HSL protease ATP-binding subunit HSL	92.25
4aby_A	415	DNA repair protein RECN; hydrolase, double strand	92.24
3tr5_A	528	RF-3, peptide chain release factor 3; protein synt	92.23
1wxq_A	397	GTP-binding protein; structural genomics, riken st	92.22
3hws_A	363	ATP-dependent CLP protease ATP-binding subunit CL;	92.19
1ni3_A	392	YCHF GTPase, YCHF GTP-binding protein; structural	92.14
1fnn_A	389	CDC6P, cell division control protein 6; ORC1, AAA	92.13
3gmt_A	230	Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle	92.13
3e70_C	328	DPA, signal recognition particle receptor; FTSY, S	92.12
1puj_A	282	YLQF, conserved hypothetical protein YLQF; structu	92.1
1s0u_A	408	EIF-2-gamma, translation initiation factor 2 gamma	92.09
3qf4_A	587	ABC transporter, ATP-binding protein; multidrug tr	92.09
1ojl_A	304	Transcriptional regulatory protein ZRAR; response	92.07
2qby_A	386	CDC6 homolog 1, cell division control protein 6 ho	92.07
1udx_A	416	The GTP-binding protein OBG; TGS domain, riken str	92.05
3cr8_A	552	Sulfate adenylyltranferase, adenylylsulfate kinase	92.05
1ewq_A	765	DNA mismatch repair protein MUTS; multiple domains	92.04
1w1w_A	430	Structural maintenance of chromosome 1; cohesin, c	92.03
2obl_A	347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	92.01
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	92.01
1e69_A	322	Chromosome segregation SMC protein; structural mai	92.0
1t9h_A	307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	91.95
1zun_B	434	Sulfate adenylate transferase, subunit 1/adenylyls	91.92
1wb9_A	800	DNA mismatch repair protein MUTS; DNA-binding, ATP	91.87
4fcw_A	311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	91.85
3qq5_A	423	Small GTP-binding protein; hydrogenase, H-cluster,	91.81
2qpt_A	550	EH domain-containing protein-2; protein-nucleotide	91.74
2zr9_A	349	Protein RECA, recombinase A; recombination, RECA m	91.73
2ohf_A	396	Protein OLA1, GTP-binding protein 9; ATPase, GTPas	91.73
2v1u_A	387	Cell division control protein 6 homolog; DNA repli	91.73
1sxj_C	340	Activator 1 40 kDa subunit; clamp loader, processi	91.72
2hjg_A	436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	91.72
3j16_B	608	RLI1P; ribosome recycling, translation, eukarya, r	91.66
3h2y_A	368	GTPase family protein; GTP-binding protein YQEH, p	91.66
3tqf_A	181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	91.61
2h92_A	219	Cytidylate kinase; rossmann fold, transferase; HET	91.51
1xjc_A	169	MOBB protein homolog; structural genomics, midwest	91.49
2ocp_A	241	DGK, deoxyguanosine kinase; protein-nucleotide com	91.46
2hjg_A	436	GTP-binding protein ENGA; GTPase ENGA KH-domain, h	91.41
2z43_A	324	DNA repair and recombination protein RADA; archaea	91.4
2dhr_A	499	FTSH; AAA+ protein, hexameric Zn metalloprotease,	91.36
1v5w_A	343	DMC1, meiotic recombination protein DMC1/LIM15 hom	91.36
3izq_1	611	HBS1P, elongation factor 1 alpha-like protein; NO-	91.32
2p67_A	341	LAO/AO transport system kinase; ARGK, structural G	91.3
2px0_A	296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	91.24
2qgz_A	308	Helicase loader, putative primosome component; str	91.23
2iw3_A	986	Elongation factor 3A; acetylation, ATP-binding, pr	91.2
3t15_A	293	Ribulose bisphosphate carboxylase/oxygenase activ	91.18
2i1q_A	322	DNA repair and recombination protein RADA; ATPase,	91.15
3ux8_A	670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	91.15
3vfd_A	389	Spastin; ATPase, microtubule severing, hydrolase;	91.07
3qkt_A	339	DNA double-strand break repair RAD50 ATPase; RECA-	91.05
3m6a_A	543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	91.02
2dy1_A	665	Elongation factor G; translocation, GTP complex, s	90.92
2gks_A	546	Bifunctional SAT/APS kinase; transferase, sulfuryl	90.8
1ypw_A	806	Transitional endoplasmic reticulum ATPase; AAA, P9	90.75
2iut_A	574	DNA translocase FTSK; nucleotide-binding, chromoso	90.75
1sxj_D	353	Activator 1 41 kDa subunit; clamp loader, processi	90.63
2h5e_A	529	Peptide chain release factor RF-3; beta barrel, tr	90.6
2o8b_B	1022	DNA mismatch repair protein MSH6; DNA damage respo	90.56
1vma_A	306	Cell division protein FTSY; TM0570, structural gen	90.55
3d3q_A	340	TRNA delta(2)-isopentenylpyrophosphate transferase	90.51
3r7w_B	331	Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT	90.49
1g8p_A	350	Magnesium-chelatase 38 kDa subunit; parallel beta	90.41
3thx_A	934	DNA mismatch repair protein MSH2; ABC family ATPas	90.36
2qby_B	384	CDC6 homolog 3, cell division control protein 6 ho	90.34
2ce7_A	476	Cell division protein FTSH; metalloprotease; HET:	90.28
1m8p_A	573	Sulfate adenylyltransferase; rossmann fold, phosph	90.27
2axn_A	520	6-phosphofructo-2-kinase/fructose-2,6- biphosphata	90.27
1g8f_A	511	Sulfate adenylyltransferase; alpha-beta protein, b	90.26
2z4s_A	440	Chromosomal replication initiator protein DNAA; AA	90.26
3upu_A	459	ATP-dependent DNA helicase DDA; RECA-like domain,	90.21
1ko7_A	314	HPR kinase/phosphatase; protein kinase, phosphotra	90.19
2ga8_A	359	Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn	90.17
2r6a_A	454	DNAB helicase, replicative helicase; replication,	89.91
1xwi_A	322	SKD1 protein; VPS4B, AAA ATPase, protein transport	89.91
3thx_B	918	DNA mismatch repair protein MSH3; ABC family ATPas	89.83
3d8b_A	357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	89.82
1ls1_A	295	Signal recognition particle protein; FFH, SRP54, S	89.73
2qp9_X	355	Vacuolar protein sorting-associated protein 4; ATP	89.72
1u94_A	356	RECA protein, recombinase A; homologous recombinat	89.68
2iw3_A	986	Elongation factor 3A; acetylation, ATP-binding, pr	89.59
2r44_A	331	Uncharacterized protein; putative ATPase, structur	89.59
3uk6_A	368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	89.57
1f60_A	458	Elongation factor EEF1A; protein-protein complex,	89.57
1wb1_A	482	Translation elongation factor SELB; selenocysteine	89.45
1zu4_A	320	FTSY; GTPase, signal recognition particle, SRP, re	89.4
3crm_A	323	TRNA delta(2)-isopentenylpyrophosphate transferase	89.37
2o5v_A	359	DNA replication and repair protein RECF; ABC ATPas	89.36
3bh0_A	315	DNAB-like replicative helicase; ATPase, replicatio	89.34
1knx_A	312	Probable HPR(Ser) kinase/phosphatase; HPR kinase,	89.16
3j2k_7	439	ERF3, eukaryotic polypeptide chain release factor	89.09
4dcu_A	456	GTP-binding protein ENGA; GTPase, GDP, protein bin	89.08
1mky_A	439	Probable GTP-binding protein ENGA; GTPase, DER, KH	89.06
3izy_P	537	Translation initiation factor IF-2, mitochondrial;	89.0
1tue_A	212	Replication protein E1; helicase, replication, E1E	88.91

>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A*

Probab=99.77  E-value=5e-20  Score=140.21  Aligned_cols=60  Identities=30%  Similarity=0.326  Sum_probs=30.1

Q ss_pred             CCccCCH-------HHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625           1 MGCAMSA-------EERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus         1 MGcc~S~-------ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ||||.|.       +++++.++|++||++|+++++...+++|||||||||||||||++||.|+-..+
T Consensus         1 mg~~~s~~~~~~~~~~~~~~~~~~~Id~~l~~~~~~~~~~~klLLLG~geSGKSTi~KQmkiih~~g   67 (402)
T 1azs_C            1 MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNG   67 (402)
T ss_dssp             -----------------------------------CCTTEEEEEEEESTTSSHHHHHHHHHHHHCCC
T ss_pred             CCCCCCCccccccchhHHHHHHHHHHHHHHHHHHHHhhccceEEEecCCCCchhhHHHHHHHHhCCC
Confidence            8999876       35678889999999999999999999999999999999999999999997654

>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ...

Probab=99.75  E-value=1.6e-19  Score=134.50  Aligned_cols=59  Identities=42%  Similarity=0.617  Sum_probs=27.3

Q ss_pred             CccCCHHHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625           2 GCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus         2 Gcc~S~ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      |||.|.+++++.++|++||++|+++++..++++||||||+||||||||++||.|+-..+
T Consensus         1 g~~~~~~~~~~~~~s~~id~~l~~~~~~~~~~~klLlLG~geSGKST~~KQmkii~~~g   59 (353)
T 1cip_A            1 GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG   59 (353)
T ss_dssp             ------------------------------CEEEEEEECSTTSSHHHHHHHHHHHHSCC
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHhHHhhcccceEEEEcCCCCCchhHHHHHHHhhCCC
Confidence            78999888899999999999999999999999999999999999999999999987654

>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A*

Probab=99.68  E-value=4.6e-18  Score=126.92  Aligned_cols=59  Identities=41%  Similarity=0.601  Sum_probs=26.9

Q ss_pred             CCccCCHHHHHHHHhhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhccc
Q psy6625           1 MGCAMSAEERAALARSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus         1 MGcc~S~ee~ea~~~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      ||||.|.+++++.++|++||++|+++++..++.+||||||+||||||||+++|.++-..
T Consensus         1 mgc~~~~~~~~~~~~s~~Id~~l~~~~~~~~~~~killlG~~~SGKST~~kq~~i~~~~   59 (362)
T 1zcb_A            1 MGCTLSAEDKAAVERSKMIDRNLREDGERSARLVKILLLGAGESGKSTFLKQMRIIHGQ   59 (362)
T ss_dssp             ------------------------------CCCEEEEEECSTTSSHHHHHHHHHHHHSC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHhHHHhcCccEEEEECCCCCcHHHHHHHHHHHhCC
Confidence            89999988889999999999999999999999999999999999999999999887653

>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A*

Probab=99.17  E-value=5.7e-12  Score=93.50  Aligned_cols=33  Identities=24%  Similarity=0.211  Sum_probs=27.5

Q ss_pred             HhhhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          28 IQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        28 k~~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +..++++|||||||||||||||++||.|+-..+
T Consensus         2 ~~~~~~~klLlLG~geSGKSTi~KQmkiih~~g   34 (327)
T 3ohm_A            2 ADARRELKLLLLGTGESGKSTFIKQMRIIHGSG   34 (327)
T ss_dssp             ---CCEEEEEEECSTTSSHHHHHHHHHHHHSCC
T ss_pred             chhcccceEEEEcCCCccHHHHHHHHHHHHcCC
Confidence            346789999999999999999999999987643

>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica}

Probab=99.11  E-value=1.7e-11  Score=91.57  Aligned_cols=30  Identities=27%  Similarity=0.160  Sum_probs=27.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ++++||||||+||||||||++||.|+-..+
T Consensus         3 ~~~~klLLLG~geSGKSTi~KQmkii~~~g   32 (340)
T 4fid_A            3 AKPITVMLLGSGESGKSTIAKQLKILFGGG   32 (340)
T ss_dssp             -CCEEEEEEECTTSSHHHHHHHHHHHTSCC
T ss_pred             CCcceEEEECCCCCcHHHHHHHHHHHhcCC
Confidence            578999999999999999999999997754

>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana}

Probab=98.70  E-value=3.1e-09  Score=79.08  Aligned_cols=30  Identities=23%  Similarity=0.007  Sum_probs=26.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .+++||||||+||||||||+++|.++-..+
T Consensus         7 ~~~~k~lllG~~~sGKsT~~kq~~~~~~~g   36 (354)
T 2xtz_A            7 IHIRKLLLLGAGESGKSTIFKQIKLLFQTG   36 (354)
T ss_dssp             CEEEEEEEECSTTSSHHHHHHHHHHHHSCC
T ss_pred             CCceeEEEECCCCCcHHHHHHHHHHHhcCC
Confidence            468999999999999999999999886543

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*

Probab=97.31  E-value=8.1e-05  Score=46.00  Aligned_cols=25  Identities=16%  Similarity=0.246  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+.||||||+.+++-
T Consensus         3 ~~~~~i~v~G~~~~GKssl~~~l~~   27 (168)
T 1z2a_A            3 EVAIKMVVVGNGAVGKSSMIQRYCK   27 (168)
T ss_dssp             -CEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceeEEEEEECcCCCCHHHHHHHHHc
Confidence            3578999999999999999999874

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...

Probab=97.24  E-value=9.8e-05  Score=45.12  Aligned_cols=23  Identities=17%  Similarity=0.238  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+++|||||+.+++-
T Consensus         3 ~~~i~v~G~~~~GKssl~~~l~~   25 (166)
T 2ce2_X            3 EYKLVVVGAGGVGKSALTIQLIQ   25 (166)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHHHHHh
Confidence            57999999999999999999863

>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A*

Probab=97.23  E-value=9.6e-05  Score=45.93  Aligned_cols=26  Identities=15%  Similarity=0.240  Sum_probs=23.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++++|...+|||||+.+++.
T Consensus         4 ~~~~~~i~v~G~~~~GKssl~~~l~~   29 (171)
T 1upt_A            4 MTREMRILILGLDGAGKTTILYRLQV   29 (171)
T ss_dssp             CSSCEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCCccEEEEECCCCCCHHHHHHHHhc
Confidence            45678999999999999999999874

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8

Probab=97.20  E-value=0.00012  Score=45.16  Aligned_cols=24  Identities=13%  Similarity=0.141  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus         2 ~~~~i~v~G~~~~GKssli~~l~~   25 (172)
T 2erx_A            2 NDYRVAVFGAGGVGKSSLVLRFVK   25 (172)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHT
T ss_pred             CceEEEEECCCCCCHHHHHHHHHc
Confidence            468999999999999999999875

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*

Probab=97.18  E-value=0.00013  Score=44.70  Aligned_cols=24  Identities=13%  Similarity=0.074  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus         3 ~~~~i~v~G~~~~GKssl~~~l~~   26 (168)
T 1u8z_A            3 ALHKVIMVGSGGVGKSALTLQFMY   26 (168)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHHHHh
Confidence            468999999999999999999874

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*

Probab=97.18  E-value=0.00014  Score=44.93  Aligned_cols=24  Identities=17%  Similarity=0.272  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus         2 ~~~ki~v~G~~~~GKssli~~l~~   25 (167)
T 1c1y_A            2 REYKLVVLGSGGVGKSALTVQFVQ   25 (167)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECCCCCCHHHHHHHHHc
Confidence            468999999999999999999874

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*

Probab=97.17  E-value=0.00014  Score=45.50  Aligned_cols=25  Identities=12%  Similarity=0.133  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...||||||+.+++-
T Consensus         6 ~~~~~i~v~G~~~~GKSsli~~l~~   30 (182)
T 1ky3_A            6 KNILKVIILGDSGVGKTSLMHRYVN   30 (182)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHHHHHHh
Confidence            4578999999999999999998874

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*

Probab=97.16  E-value=0.00015  Score=44.50  Aligned_cols=24  Identities=17%  Similarity=0.277  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++.
T Consensus         2 ~~~~i~v~G~~~~GKSsli~~l~~   25 (167)
T 1kao_A            2 REYKVVVLGSGGVGKSALTVQFVT   25 (167)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             cEEEEEEECCCCCCHHHHHHHHHc
Confidence            468999999999999999998874

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*

Probab=97.15  E-value=9.6e-05  Score=45.75  Aligned_cols=26  Identities=15%  Similarity=0.204  Sum_probs=22.7

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+|++++|...+|||||+.+++--
T Consensus         4 ~~~~~i~v~G~~~~GKSsli~~l~~~   29 (170)
T 1z0j_A            4 LRELKVCLLGDTGVGKSSIMWRFVED   29 (170)
T ss_dssp             EEEEEEEEECCTTSSHHHHHHHHHHS
T ss_pred             CcceEEEEECcCCCCHHHHHHHHHcC
Confidence            35789999999999999999998743

>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A*

Probab=97.13  E-value=0.00012  Score=45.38  Aligned_cols=25  Identities=32%  Similarity=0.438  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus         4 ~~~~~i~v~G~~~~GKssli~~l~~   28 (170)
T 1z08_A            4 AYSFKVVLLGEGCVGKTSLVLRYCE   28 (170)
T ss_dssp             CEEEEEEEECCTTSCHHHHHHHHHH
T ss_pred             CcceEEEEECcCCCCHHHHHHHHHc
Confidence            3568999999999999999998874

>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A*

Probab=97.13  E-value=0.00015  Score=44.96  Aligned_cols=22  Identities=23%  Similarity=0.110  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+|++++|..++|||||+.+++
T Consensus         2 ~~ki~~vG~~~~GKSsli~~l~   23 (166)
T 3q72_A            2 VYKVLLLGAPGVGKSALARIFG   23 (166)
T ss_dssp             CCEEEEEESTTSSHHHHHHHHC
T ss_pred             eEEEEEECCCCCCHHHHHHHHc
Confidence            5899999999999999999986

>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens}

Probab=97.12  E-value=9.1e-05  Score=47.54  Aligned_cols=31  Identities=13%  Similarity=0.007  Sum_probs=24.5

Q ss_pred             HhHHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          25 EDGIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        25 kekk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+...+.+|++++|...+|||||+.+++-
T Consensus        17 ~~~~~~~~~~ki~v~G~~~~GKSsLi~~l~~   47 (193)
T 2oil_A           17 RGSEDYNFVFKVVLIGESGVGKTNLLSRFTR   47 (193)
T ss_dssp             ---CCCSEEEEEEEESSTTSSHHHHHHHHHH
T ss_pred             ccccccCcceEEEEECcCCCCHHHHHHHHhc
Confidence            3344456689999999999999999999875

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*

Probab=97.12  E-value=0.00016  Score=46.59  Aligned_cols=23  Identities=22%  Similarity=0.258  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|.+++||||+++.++-
T Consensus         2 ~~kv~ivG~~gvGKStLl~~l~~   24 (184)
T 2zej_A            2 RMKLMIVGNTGSGKTTLLQQLMK   24 (184)
T ss_dssp             -CEEEEESCTTSSHHHHHHHHTC
T ss_pred             ceEEEEECCCCCCHHHHHHHHhc
Confidence            57999999999999999999885

>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens}

Probab=97.12  E-value=0.00011  Score=48.10  Aligned_cols=29  Identities=14%  Similarity=0.070  Sum_probs=23.0

Q ss_pred             hHHhhhCccceeeccCCCccchhhhhhhh
Q psy6625          26 DGIQAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        26 ekk~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +.+.+.+.+|++++|...+|||||+.+++
T Consensus        18 ~~~~~~~~~ki~v~G~~~~GKSsLi~~l~   46 (200)
T 2o52_A           18 GSIWSDFLFKFLVIGSAGTGKSCLLHQFI   46 (200)
T ss_dssp             ----CCEEEEEEEEESTTSSHHHHHHHHH
T ss_pred             cccccCcceEEEEECcCCCCHHHHHHHHH
Confidence            34445678999999999999999999986

>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A*

Probab=97.11  E-value=0.00014  Score=44.89  Aligned_cols=24  Identities=29%  Similarity=0.318  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus         5 ~~~~i~v~G~~~~GKssli~~l~~   28 (170)
T 1r2q_A            5 CQFKLVLLGESAVGKSSLVLRFVK   28 (170)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHHHHc
Confidence            468999999999999999999874

>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A*

Probab=97.10  E-value=0.00014  Score=45.33  Aligned_cols=25  Identities=8%  Similarity=0.084  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        13 ~~~~~i~v~G~~~~GKSsli~~l~~   37 (179)
T 1z0f_A           13 SYIFKYIIIGDMGVGKSCLLHQFTE   37 (179)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ccceEEEEECCCCCCHHHHHHHHHc
Confidence            4578999999999999999999874

>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum}

Probab=97.09  E-value=0.00018  Score=45.26  Aligned_cols=26  Identities=27%  Similarity=0.240  Sum_probs=22.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+|++++|...+|||||+.+++--
T Consensus         5 ~~~~ki~v~G~~~~GKSsli~~l~~~   30 (208)
T 3clv_A            5 KSSYKTVLLGESSVGKSSIVLRLTKD   30 (208)
T ss_dssp             CSSEEEEEECCTTSSHHHHHHHHHHS
T ss_pred             CcceEEEEECCCCCCHHHHHHHHHhC
Confidence            35789999999999999999998754

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=97.08  E-value=0.00015  Score=44.70  Aligned_cols=23  Identities=35%  Similarity=0.421  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|...+|||||+.+++-
T Consensus         3 ~~~i~v~G~~~~GKssli~~l~~   25 (170)
T 1ek0_A            3 SIKLVLLGEAAVGKSSIVLRFVS   25 (170)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHH
T ss_pred             eEEEEEECCCCCCHHHHHHHHhc
Confidence            57999999999999999998864

>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A*

Probab=97.07  E-value=0.0002  Score=44.93  Aligned_cols=25  Identities=12%  Similarity=0.056  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        16 ~~~~ki~v~G~~~~GKSsli~~l~~   40 (187)
T 2a9k_A           16 LALHKVIMVGSGGVGKSALTLQFMY   40 (187)
T ss_dssp             -CEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHHHhh
Confidence            3579999999999999999999874

>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A*

Probab=97.07  E-value=0.00049  Score=47.64  Aligned_cols=38  Identities=8%  Similarity=0.077  Sum_probs=28.6

Q ss_pred             HHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          18 QIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        18 ~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+...+.+..+.....+|++++|...+|||||+.+++-
T Consensus        24 ~l~~~~~~~~~~~~~~~~I~vvG~~g~GKSSLin~l~~   61 (270)
T 1h65_A           24 KLLELLGNLKQEDVNSLTILVMGKGGVGKSSTVNSIIG   61 (270)
T ss_dssp             HHHHHHHHHHHTTCCEEEEEEEESTTSSHHHHHHHHHT
T ss_pred             HHHHHHHHHhhcCCCCeEEEEECCCCCCHHHHHHHHhC
Confidence            34444444444445689999999999999999999874

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A

Probab=97.05  E-value=0.00019  Score=44.35  Aligned_cols=24  Identities=17%  Similarity=0.224  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|...+|||||+.+++-
T Consensus         2 ~~~~i~v~G~~~~GKssli~~l~~   25 (170)
T 1g16_A            2 SIMKILLIGDSGVGKSCLLVRFVE   25 (170)
T ss_dssp             CEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CceEEEEECcCCCCHHHHHHHHHh
Confidence            358999999999999999999873

>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens}

Probab=97.05  E-value=0.00014  Score=45.37  Aligned_cols=26  Identities=19%  Similarity=0.183  Sum_probs=22.6

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++-
T Consensus         6 ~~~~~~i~v~G~~~~GKssl~~~l~~   31 (181)
T 3tw8_B            6 YDHLFKLLIIGDSGVGKSSLLLRFAD   31 (181)
T ss_dssp             CCEEEEEEEECCTTSCHHHHHHHHCS
T ss_pred             cCcceEEEEECCCCCCHHHHHHHHhc
Confidence            34578999999999999999999863

>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A*

Probab=97.05  E-value=0.00087  Score=46.18  Aligned_cols=37  Identities=19%  Similarity=0.167  Sum_probs=27.6

Q ss_pred             HHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          19 IEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        19 IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++....-.......+|++++|...+|||||+.+++-
T Consensus       141 ~~~~~~~~~~~~~~~~~i~i~G~~~~GKssli~~~~~  177 (332)
T 2wkq_A          141 IKKTAENIDEAAKELIKCVVVGDGAVGKTCLLISYTT  177 (332)
T ss_dssp             HHHHHHHHHHHHTTCEEEEEEESTTSSHHHHHHHHHH
T ss_pred             HhhhcccchhcccceeEEEEECCCCCChHHHHHHHHh
Confidence            3333333344566789999999999999999988764

>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A*

Probab=97.05  E-value=0.00019  Score=44.78  Aligned_cols=26  Identities=12%  Similarity=0.170  Sum_probs=22.7

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+|++++|...+|||||+.+++--
T Consensus         7 ~~~~~i~v~G~~~~GKssli~~l~~~   32 (181)
T 2fn4_A            7 SETHKLVVVGGGGVGKSALTIQFIQS   32 (181)
T ss_dssp             SCEEEEEEEECTTSSHHHHHHHHHHS
T ss_pred             CCceEEEEECCCCCCHHHHHHHHHhC
Confidence            35789999999999999999998743

>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A*

Probab=97.04  E-value=0.00017  Score=46.04  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|.+.+|||||+.+++-
T Consensus        20 ~~~ki~vvG~~~~GKSsli~~l~~   43 (190)
T 3con_A           20 TEYKLVVVGAGGVGKSALTIQLIQ   43 (190)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECcCCCCHHHHHHHHHc
Confidence            568999999999999999999874

>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A*

Probab=97.04  E-value=0.00022  Score=44.65  Aligned_cols=25  Identities=16%  Similarity=0.344  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus         4 ~~~~ki~v~G~~~~GKssl~~~l~~   28 (178)
T 2hxs_A            4 MRQLKIVVLGDGASGKTSLTTCFAQ   28 (178)
T ss_dssp             CCEEEEEEECCTTSSHHHHHHHHHG
T ss_pred             CceEEEEEECcCCCCHHHHHHHHHh
Confidence            3578999999999999999999874

>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A*

Probab=97.03  E-value=0.00023  Score=45.02  Aligned_cols=26  Identities=12%  Similarity=0.162  Sum_probs=23.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++-
T Consensus        15 ~~~~~ki~v~G~~~~GKSsl~~~l~~   40 (183)
T 3kkq_A           15 NLPTYKLVVVGDGGVGKSALTIQFFQ   40 (183)
T ss_dssp             CCCEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCCceEEEEECCCCCCHHHHHHHHHh
Confidence            34689999999999999999999873

>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B*

Probab=97.01  E-value=0.00019  Score=45.12  Aligned_cols=25  Identities=24%  Similarity=0.311  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        10 ~~~~ki~v~G~~~~GKSsli~~l~~   34 (181)
T 2efe_B           10 SINAKLVLLGDVGAGKSSLVLRFVK   34 (181)
T ss_dssp             CEEEEEEEECCTTSCHHHHHHHHHH
T ss_pred             ccceEEEEECcCCCCHHHHHHHHHc
Confidence            3568999999999999999999874

>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A*

Probab=97.01  E-value=0.00018  Score=45.28  Aligned_cols=24  Identities=17%  Similarity=0.246  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|..++|||||+.+++-
T Consensus         3 ~~~ki~v~G~~~~GKSsli~~l~~   26 (189)
T 4dsu_A            3 TEYKLVVVGADGVGKSALTIQLIQ   26 (189)
T ss_dssp             EEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             cEEEEEEECCCCCCHHHHHHHHHh
Confidence            468999999999999999999873

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*

Probab=97.00  E-value=0.00047  Score=44.83  Aligned_cols=25  Identities=12%  Similarity=0.038  Sum_probs=22.3

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+|+.++|..++||||+++.++-.
T Consensus         4 ~~~kv~lvG~~g~GKSTLl~~l~~~   28 (199)
T 2f9l_A            4 YLFKVVLIGDSGVGKSNLLSRFTRN   28 (199)
T ss_dssp             EEEEEEEESSTTSSHHHHHHHHHHS
T ss_pred             ceEEEEEECcCCCCHHHHHHHHhcC
Confidence            3589999999999999999998864

>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8

Probab=97.00  E-value=0.00017  Score=46.61  Aligned_cols=27  Identities=19%  Similarity=0.230  Sum_probs=22.8

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+.+|++++|...+|||||+.+++-
T Consensus        19 ~~~~~~ki~vvG~~~~GKSsli~~l~~   45 (192)
T 2fg5_A           19 SAIRELKVCLLGDTGVGKSSIVCRFVQ   45 (192)
T ss_dssp             --CEEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             ccCCceEEEEECcCCCCHHHHHHHHhc
Confidence            345689999999999999999999874

>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C

Probab=96.99  E-value=0.00028  Score=44.35  Aligned_cols=25  Identities=12%  Similarity=0.150  Sum_probs=21.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++.
T Consensus         6 ~~~~ki~v~G~~~~GKssl~~~~~~   30 (182)
T 3bwd_D            6 SRFIKCVTVGDGAVGKTCLLISYTS   30 (182)
T ss_dssp             -CCCEEEEECSTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHHHHHhc
Confidence            4579999999999999999998874

>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A*

Probab=96.99  E-value=0.00026  Score=43.96  Aligned_cols=22  Identities=18%  Similarity=0.143  Sum_probs=20.3

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+|++++|...+||||++.+++
T Consensus         2 ~~ki~ivG~~~~GKSsli~~l~   23 (169)
T 3q85_A            2 VFKVMLVGESGVGKSTLAGTFG   23 (169)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHH
T ss_pred             cEEEEEECCCCCCHHHHHHHHH
Confidence            4799999999999999999986

>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens}

Probab=96.98  E-value=0.00026  Score=44.04  Aligned_cols=24  Identities=13%  Similarity=0.091  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|...+|||||+.+++-
T Consensus         3 ~~~ki~i~G~~~vGKSsl~~~l~~   26 (175)
T 2nzj_A            3 ALYRVVLLGDPGVGKTSLASLFAG   26 (175)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHC
T ss_pred             eEEEEEEECCCCccHHHHHHHHhc
Confidence            468999999999999999999864

>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A*

Probab=96.98  E-value=0.00064  Score=46.95  Aligned_cols=32  Identities=13%  Similarity=0.057  Sum_probs=25.6

Q ss_pred             HHhHHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          24 KEDGIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        24 ~kekk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++......+.+|++++|...+|||||+.+++-
T Consensus        27 ~~~~~~~~~~~~I~lvG~~g~GKSSLin~l~~   58 (262)
T 3def_A           27 GKLKQKDMNSMTVLVLGKGGVGKSSTVNSLIG   58 (262)
T ss_dssp             HHHHHTTCCEEEEEEEECTTSSHHHHHHHHHT
T ss_pred             HHHhhccCCCcEEEEECCCCCCHHHHHHHHhC
Confidence            33333344789999999999999999999874

>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A*

Probab=96.98  E-value=0.00019  Score=44.73  Aligned_cols=24  Identities=21%  Similarity=0.243  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus        13 ~~~~i~v~G~~~~GKssli~~l~~   36 (179)
T 2y8e_A           13 RKFKLVFLGEQSVGKTSLITRFMY   36 (179)
T ss_dssp             EEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             cceEEEEECCCCCCHHHHHHHHHc
Confidence            568999999999999999999873

>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens}

Probab=96.98  E-value=0.00025  Score=45.52  Aligned_cols=25  Identities=12%  Similarity=0.056  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...||||||+.+++-
T Consensus        12 ~~~~ki~v~G~~~~GKSsli~~l~~   36 (206)
T 2bov_A           12 LALHKVIMVGSGGVGKSALTLQFMY   36 (206)
T ss_dssp             CCEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHHHHHHh
Confidence            4678999999999999999999863

>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens}

Probab=96.98  E-value=0.00024  Score=46.20  Aligned_cols=26  Identities=12%  Similarity=0.120  Sum_probs=22.4

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++++|..++|||||+.+++-
T Consensus        21 ~~~~~ki~vvG~~~~GKSsli~~l~~   46 (201)
T 3oes_A           21 LVRYRKVVILGYRCVGKTSLAHQFVE   46 (201)
T ss_dssp             --CEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCCcEEEEEECCCCcCHHHHHHHHHh
Confidence            35689999999999999999999875

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*

Probab=96.98  E-value=0.00046  Score=44.96  Aligned_cols=25  Identities=12%  Similarity=0.038  Sum_probs=22.2

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+|+.|+|..+|||||+++.++-.
T Consensus        28 ~~~kv~lvG~~g~GKSTLl~~l~~~   52 (191)
T 1oix_A           28 YLFKVVLIGDSGVGKSNLLSRFTRN   52 (191)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHHS
T ss_pred             cceEEEEECcCCCCHHHHHHHHhcC
Confidence            4689999999999999999998753

>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A*

Probab=96.97  E-value=0.00029  Score=44.10  Aligned_cols=25  Identities=8%  Similarity=0.010  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+..|++++|...+|||||+.+++-
T Consensus         6 ~~~~~i~v~G~~~~GKssl~~~l~~   30 (178)
T 2lkc_A            6 ERPPVVTIMGHVDHGKTTLLDAIRH   30 (178)
T ss_dssp             CCCCEEEEESCTTTTHHHHHHHHHT
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhC
Confidence            4678999999999999999999864

>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ...

Probab=96.96  E-value=0.00022  Score=44.82  Aligned_cols=24  Identities=17%  Similarity=0.239  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++-
T Consensus         4 ~~~~i~~~G~~~~GKssl~~~l~~   27 (186)
T 1mh1_A            4 QAIKCVVVGDGAVGKTCLLISYTT   27 (186)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             cEEEEEEECCCCCCHHHHHHHHHc
Confidence            468999999999999999988863

>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A*

Probab=96.96  E-value=0.00021  Score=44.99  Aligned_cols=26  Identities=19%  Similarity=0.057  Sum_probs=22.9

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++++|...+|||||+.+++-
T Consensus         8 ~~~~~ki~v~G~~~~GKSsli~~l~~   33 (195)
T 3bc1_A            8 YDYLIKFLALGDSGVGKTSVLYQYTD   33 (195)
T ss_dssp             CSEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             cceeEEEEEECCCCCCHHHHHHHHhc
Confidence            34578999999999999999999874

>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A

Probab=96.96  E-value=0.00022  Score=44.88  Aligned_cols=24  Identities=21%  Similarity=0.210  Sum_probs=22.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|.+.+|||||+.+++-
T Consensus         6 ~~~ki~~vG~~~vGKTsli~~l~~   29 (178)
T 2iwr_A            6 PELRLGVLGDARSGKSSLIHRFLT   29 (178)
T ss_dssp             CEEEEEEECCGGGCHHHHHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999999875

>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A*

Probab=96.94  E-value=0.0002  Score=46.88  Aligned_cols=26  Identities=23%  Similarity=0.065  Sum_probs=23.2

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+.+|++++|...+|||||+.+++-
T Consensus        22 ~~~~~ki~vvG~~~~GKSsLi~~l~~   47 (217)
T 2f7s_A           22 YDYLIKLLALGDSGVGKTTFLYRYTD   47 (217)
T ss_dssp             CSEEEEEEEESCTTSSHHHHHHHHHC
T ss_pred             cceeEEEEEECcCCCCHHHHHHHHhc
Confidence            45679999999999999999999874

>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B*

Probab=96.93  E-value=0.0003  Score=45.28  Aligned_cols=25  Identities=12%  Similarity=0.088  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus         6 ~~~~ki~v~G~~~~GKSsli~~l~~   30 (207)
T 1vg8_A            6 KVLLKVIILGDSGVGKTSLMNQYVN   30 (207)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CcceEEEEECcCCCCHHHHHHHHHc
Confidence            4578999999999999999999864

>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens}

Probab=96.93  E-value=0.00027  Score=46.75  Aligned_cols=27  Identities=11%  Similarity=0.258  Sum_probs=22.9

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+.+|++++|...+|||||+.+++-
T Consensus        30 ~~~~~~ki~vvG~~~vGKSsli~~l~~   56 (214)
T 2j1l_A           30 PGVRSVKVVLVGDGGCGKTSLLMVFAD   56 (214)
T ss_dssp             --CCEEEEEEEECTTSSHHHHHHHHHC
T ss_pred             CCcceEEEEEECcCCCCHHHHHHHHHc
Confidence            345689999999999999999999874

>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A*

Probab=96.93  E-value=0.00021  Score=45.21  Aligned_cols=25  Identities=12%  Similarity=0.050  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus         8 ~~~~ki~v~G~~~~GKSsli~~l~~   32 (186)
T 2bme_A            8 DFLFKFLVIGNAGTGKSCLLHQFIE   32 (186)
T ss_dssp             SEEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             ccceEEEEECCCCCCHHHHHHHHHc
Confidence            4568999999999999999999874

>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A*

Probab=96.93  E-value=0.00033  Score=44.51  Aligned_cols=25  Identities=16%  Similarity=0.240  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        16 ~~~~~i~v~G~~~~GKssl~~~l~~   40 (186)
T 1ksh_A           16 ERELRLLMLGLDNAGKTTILKKFNG   40 (186)
T ss_dssp             -CCEEEEEECSTTSSHHHHHHHHTT
T ss_pred             CCeeEEEEECCCCCCHHHHHHHHhc
Confidence            4689999999999999999999874

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}

Probab=96.92  E-value=0.00032  Score=44.52  Aligned_cols=24  Identities=21%  Similarity=0.138  Sum_probs=22.0

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..|+.++|..++||||++.+++-
T Consensus         6 ~~~~i~lvG~~gvGKStL~~~l~~   29 (188)
T 2wjg_A            6 KSYEIALIGNPNVGKSTIFNALTG   29 (188)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHT
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            468999999999999999999985

>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=96.92  E-value=0.00027  Score=45.09  Aligned_cols=25  Identities=12%  Similarity=0.190  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus         6 ~~~~ki~vvG~~~~GKSsli~~l~~   30 (199)
T 2gf0_A            6 SNDYRVVVFGAGGVGKSSLVLRFVK   30 (199)
T ss_dssp             CCCEEEEEEECTTSSHHHHHHHHHH
T ss_pred             CCeeEEEEECCCCCcHHHHHHHHHc
Confidence            4578999999999999999999875

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}

Probab=96.92  E-value=0.00034  Score=44.68  Aligned_cols=27  Identities=15%  Similarity=0.113  Sum_probs=23.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ...+|++++|...||||||+.+++--.
T Consensus        46 ~~~~~i~vvG~~g~GKSsll~~l~~~~   72 (193)
T 2ged_A           46 SYQPSIIIAGPQNSGKTSLLTLLTTDS   72 (193)
T ss_dssp             CCCCEEEEECCTTSSHHHHHHHHHHSS
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhcCC
Confidence            467899999999999999999998654

>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0

Probab=96.91  E-value=0.00032  Score=45.48  Aligned_cols=26  Identities=15%  Similarity=0.170  Sum_probs=23.0

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+++|++++|.+.+|||||+..++.
T Consensus        17 ~~~~~ki~ivG~~~vGKSsL~~~~~~   42 (184)
T 3ihw_A           17 QGPELKVGIVGNLSSGKSALVHRYLT   42 (184)
T ss_dssp             CCCEEEEEEECCTTSCHHHHHHHHHH
T ss_pred             CCCeeEEEEECCCCCCHHHHHHHHhc
Confidence            45789999999999999999988764

>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens}

Probab=96.91  E-value=0.0003  Score=46.10  Aligned_cols=25  Identities=16%  Similarity=0.090  Sum_probs=21.6

Q ss_pred             hhCccceeeccCCCccchhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....+|++++|.+.+|||||+.+++
T Consensus        20 ~~~~~ki~vvG~~~vGKSsLi~~l~   44 (195)
T 3cbq_A           20 KDGIFKVMLVGESGVGKSTLAGTFG   44 (195)
T ss_dssp             --CEEEEEEECSTTSSHHHHHHHTC
T ss_pred             CCcEEEEEEECCCCCCHHHHHHHHH
Confidence            4467999999999999999999986

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*

Probab=96.91  E-value=0.00026  Score=44.29  Aligned_cols=25  Identities=20%  Similarity=0.106  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus         5 ~~~~~i~v~G~~~~GKSsli~~l~~   29 (177)
T 1wms_A            5 SSLFKVILLGDGGVGKSSLMNRYVT   29 (177)
T ss_dssp             EEEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             cceeEEEEECCCCCCHHHHHHHHHc
Confidence            3568999999999999999999874

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}

Probab=96.91  E-value=0.00032  Score=43.09  Aligned_cols=22  Identities=14%  Similarity=0.039  Sum_probs=20.1

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|++++|..++||||++.+++-
T Consensus         2 ~ki~v~G~~~~GKSsli~~l~~   23 (161)
T 2dyk_A            2 HKVVIVGRPNVGKSSLFNRLLK   23 (161)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHhC
Confidence            4899999999999999999874

>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ...

Probab=96.90  E-value=0.00034  Score=43.22  Aligned_cols=22  Identities=14%  Similarity=0.191  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...+|||||+.+++.
T Consensus         1 ~ki~~~G~~~~GKssl~~~l~~   22 (164)
T 1r8s_A            1 MRILMVGLDAAGKTTILYKLKL   22 (164)
T ss_dssp             CEEEEECSTTSSHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHc
Confidence            5899999999999999999874

>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=96.89  E-value=0.00015  Score=46.69  Aligned_cols=28  Identities=14%  Similarity=0.108  Sum_probs=24.0

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .....+|++++|...+|||||+.+++--
T Consensus        19 ~~~~~~ki~v~G~~~~GKSsli~~l~~~   46 (191)
T 3dz8_A           19 NFDYMFKLLIIGNSSVGKTSFLFRYADD   46 (191)
T ss_dssp             EEEECEEEEEEESTTSSHHHHHHHHHHH
T ss_pred             ccCeeeEEEEECCCCcCHHHHHHHHhcC
Confidence            3456899999999999999999998743

>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=96.88  E-value=0.00025  Score=44.71  Aligned_cols=24  Identities=21%  Similarity=0.268  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.+|++++|...+||||++.+++
T Consensus        16 ~~~~~i~v~G~~~~GKssli~~l~   39 (183)
T 1moz_A           16 NKELRILILGLDGAGKTTILYRLQ   39 (183)
T ss_dssp             SSCEEEEEEEETTSSHHHHHHHTC
T ss_pred             CCccEEEEECCCCCCHHHHHHHHh
Confidence            468999999999999999999987

>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens}

Probab=96.88  E-value=0.00035  Score=45.04  Aligned_cols=27  Identities=15%  Similarity=0.241  Sum_probs=21.4

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+.+|++++|...+|||||+.+++-
T Consensus        16 ~~~~~~ki~~~G~~~~GKssl~~~l~~   42 (201)
T 2q3h_A           16 AEGRGVKCVLVGDGAVGKTSLVVSYTT   42 (201)
T ss_dssp             ----CEEEEEECSTTSSHHHHHHHHHC
T ss_pred             CCCcceEEEEECCCCCCHHHHHHHHHh
Confidence            345689999999999999999998873

>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B*

Probab=96.88  E-value=0.00036  Score=44.67  Aligned_cols=25  Identities=12%  Similarity=0.424  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        18 ~~~~ki~v~G~~~~GKSsli~~l~~   42 (189)
T 1z06_A           18 SRIFKIIVIGDSNVGKTCLTYRFCA   42 (189)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHHHHHHc
Confidence            4679999999999999999999873

>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=96.87  E-value=0.00027  Score=44.30  Aligned_cols=25  Identities=12%  Similarity=0.146  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus         8 ~~~~~i~v~G~~~~GKssli~~l~~   32 (180)
T 2g6b_A            8 DVAFKVMLVGDSGVGKTCLLVRFKD   32 (180)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CcceEEEEECcCCCCHHHHHHHHHh
Confidence            4578999999999999999999874

>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=96.87  E-value=0.00035  Score=44.69  Aligned_cols=24  Identities=8%  Similarity=0.156  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.+|++++|...+|||||+.+++
T Consensus        14 ~~~~~i~v~G~~~~GKssl~~~l~   37 (187)
T 1zj6_A           14 HQEHKVIIVGLDNAGKTTILYQFS   37 (187)
T ss_dssp             TSCEEEEEEESTTSSHHHHHHHHH
T ss_pred             CCccEEEEECCCCCCHHHHHHHHh
Confidence            468999999999999999999987

>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B*

Probab=96.87  E-value=0.00033  Score=44.80  Aligned_cols=25  Identities=8%  Similarity=0.155  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|.+.+|||||+.+++-
T Consensus         5 ~~~~ki~v~G~~~vGKSsli~~l~~   29 (184)
T 1m7b_A            5 NVKCKIVVVGDSQCGKTALLHVFAK   29 (184)
T ss_dssp             -CEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             ceEEEEEEECCCCCCHHHHHHHHhc
Confidence            4578999999999999999999875

>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2

Probab=96.87  E-value=0.00035  Score=45.55  Aligned_cols=25  Identities=20%  Similarity=0.190  Sum_probs=20.8

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+.+||||++.+++-
T Consensus         5 ~~~~ki~vvG~~~~GKTsli~~l~~   29 (214)
T 2fh5_B            5 SSQRAVLFVGLCDSGKTLLFVRLLT   29 (214)
T ss_dssp             ---CEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhC
Confidence            3568999999999999999999874

>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens}

Probab=96.87  E-value=0.00037  Score=45.04  Aligned_cols=25  Identities=16%  Similarity=0.264  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        19 ~~~~ki~vvG~~~vGKTsLi~~l~~   43 (187)
T 3c5c_A           19 PLEVNLAILGRRGAGKSALTVKFLT   43 (187)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCcHHHHHHHHHh
Confidence            4679999999999999999999874

>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8

Probab=96.86  E-value=0.00032  Score=44.34  Aligned_cols=22  Identities=9%  Similarity=0.077  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|...+|||||+.+++-
T Consensus         2 ~ki~v~G~~~~GKSsli~~l~~   23 (190)
T 2cxx_A            2 ATIIFAGRSNVGKSTLIYRLTG   23 (190)
T ss_dssp             CEEEEEEBTTSSHHHHHHHHHS
T ss_pred             cEEEEECCCCCCHHHHHHHHhC
Confidence            5899999999999999999874

>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=96.86  E-value=0.0004  Score=44.85  Aligned_cols=25  Identities=16%  Similarity=0.234  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        26 ~~~~ki~v~G~~~vGKSsli~~l~~   50 (196)
T 2atv_A           26 SAEVKLAIFGRAGVGKSALVVRFLT   50 (196)
T ss_dssp             -CCEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHHHHh
Confidence            4579999999999999999999874

>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A*

Probab=96.84  E-value=0.00031  Score=45.17  Aligned_cols=26  Identities=19%  Similarity=0.318  Sum_probs=22.7

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++++|...+|||||+.+++-
T Consensus        20 ~~~~~ki~~vG~~~~GKSsl~~~l~~   45 (194)
T 3reg_A           20 GKKALKIVVVGDGAVGKTCLLLAFSK   45 (194)
T ss_dssp             -CEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             cceeeEEEEECcCCCCHHHHHHHHhc
Confidence            34679999999999999999999875

>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi}

Probab=96.84  E-value=0.00032  Score=45.88  Aligned_cols=24  Identities=13%  Similarity=0.012  Sum_probs=21.8

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+|++++|...+|||||+.+++
T Consensus         9 ~~~~ki~vvG~~~~GKSsli~~l~   32 (218)
T 4djt_A            9 ELTYKICLIGDGGVGKTTYINRVL   32 (218)
T ss_dssp             -CEEEEEEECCTTSSHHHHHCBCT
T ss_pred             cCccEEEEECCCCCCHHHHHHHHh
Confidence            457999999999999999999988

>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=96.83  E-value=0.00043  Score=45.24  Aligned_cols=28  Identities=14%  Similarity=0.105  Sum_probs=23.8

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..+..|++++|...+||||++.+++--.
T Consensus         9 ~~~~~~i~~~G~~g~GKTsl~~~l~~~~   36 (218)
T 1nrj_B            9 KSYQPSIIIAGPQNSGKTSLLTLLTTDS   36 (218)
T ss_dssp             -CCCCEEEEECSTTSSHHHHHHHHHHSS
T ss_pred             cCCCCEEEEECCCCCCHHHHHHHHhcCC
Confidence            4567899999999999999999988644

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*

Probab=96.82  E-value=0.00039  Score=44.34  Aligned_cols=24  Identities=13%  Similarity=-0.076  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..|++++|...+|||||+.+++-
T Consensus        22 ~~~~i~v~G~~~~GKSsli~~l~~   45 (195)
T 1svi_A           22 GLPEIALAGRSNVGKSSFINSLIN   45 (195)
T ss_dssp             CCCEEEEEEBTTSSHHHHHHHHHT
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            578999999999999999999874

>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens}

Probab=96.81  E-value=0.00036  Score=44.71  Aligned_cols=28  Identities=21%  Similarity=0.197  Sum_probs=22.4

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..+.+|++++|...+|||||+.+++--.
T Consensus        18 ~~~~~ki~v~G~~~~GKSsli~~l~~~~   45 (190)
T 2h57_A           18 GSKEVHVLCLGLDNSGKTTIINKLKPSN   45 (190)
T ss_dssp             ---CEEEEEEECTTSSHHHHHHHTSCGG
T ss_pred             CCCccEEEEECCCCCCHHHHHHHHhcCC
Confidence            3467999999999999999999987543

>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8

Probab=96.81  E-value=0.00035  Score=44.31  Aligned_cols=26  Identities=19%  Similarity=0.250  Sum_probs=22.8

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+|++++|...+|||||+.+++--
T Consensus        13 ~~~~~i~v~G~~~~GKssli~~l~~~   38 (195)
T 1x3s_A           13 LTTLKILIIGESGVGKSSLLLRFTDD   38 (195)
T ss_dssp             EEEEEEEEECSTTSSHHHHHHHHHHS
T ss_pred             CCceEEEEECCCCCCHHHHHHHHHcC
Confidence            45789999999999999999998753

>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A*

Probab=96.80  E-value=0.0013  Score=43.30  Aligned_cols=27  Identities=11%  Similarity=0.021  Sum_probs=23.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+..|++++|.++|||||++..++.-.
T Consensus        36 ~~~~~i~ivG~~gvGKTtl~~~l~~~~   62 (226)
T 2hf9_A           36 HGVVAFDFMGAIGSGKTLLIEKLIDNL   62 (226)
T ss_dssp             TTCEEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             CCCeEEEEEcCCCCCHHHHHHHHHHHh
Confidence            357899999999999999999988653

>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A*

Probab=96.80  E-value=0.00035  Score=44.94  Aligned_cols=26  Identities=15%  Similarity=0.317  Sum_probs=23.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++.+|++++|...+|||||+.+++-
T Consensus        19 ~~~~~ki~v~G~~~~GKSsli~~l~~   44 (188)
T 1zd9_A           19 SKEEMELTLVGLQYSGKTTFVNVIAS   44 (188)
T ss_dssp             CCEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCCccEEEEECCCCCCHHHHHHHHHc
Confidence            34579999999999999999999874

>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A*

Probab=96.80  E-value=0.00033  Score=44.23  Aligned_cols=23  Identities=17%  Similarity=0.212  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +.+|++++|...+|||||+.+++
T Consensus         5 ~~~ki~~~G~~~~GKSsli~~l~   27 (181)
T 3t5g_A            5 KSRKIAILGYRSVGKSSLTIQFV   27 (181)
T ss_dssp             EEEEEEEEESTTSSHHHHHHHHH
T ss_pred             ceEEEEEECcCCCCHHHHHHHHH
Confidence            46899999999999999999987

>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens}

Probab=96.79  E-value=0.00015  Score=47.15  Aligned_cols=26  Identities=23%  Similarity=0.176  Sum_probs=22.6

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++-
T Consensus        30 ~~~~~ki~vvG~~~~GKSsli~~l~~   55 (199)
T 3l0i_B           30 YDYLFKLLLIGDSGVGKSCLLLRFAD   55 (199)
T ss_dssp             CSEEEEEEEECCTTSCCTTTTTSSBC
T ss_pred             cCcceEEEEECCCCCCHHHHHHHHhc
Confidence            34579999999999999999998863

>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A*

Probab=96.79  E-value=0.00034  Score=44.62  Aligned_cols=26  Identities=8%  Similarity=0.167  Sum_probs=21.6

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++++|...+|||||+.+++-
T Consensus        18 ~~~~~~i~v~G~~~~GKSsli~~l~~   43 (181)
T 2h17_A           18 GSQEHKVIIVGLDNAGKTTILYQFSM   43 (181)
T ss_dssp             ---CEEEEEEEETTSSHHHHHHHHHT
T ss_pred             CCceeEEEEECCCCCCHHHHHHHHhc
Confidence            34679999999999999999999874

>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A*

Probab=96.77  E-value=0.00095  Score=43.56  Aligned_cols=23  Identities=13%  Similarity=0.147  Sum_probs=21.3

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..+|++++|.+.+||||++.+++
T Consensus         5 ~~~kv~lvG~~~vGKSsL~~~~~   27 (192)
T 2cjw_A            5 TYYRVVLIGEQGVGKSTLANIFA   27 (192)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHHHh
Confidence            46899999999999999999987

>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A*

Probab=96.77  E-value=0.00047  Score=45.76  Aligned_cols=25  Identities=20%  Similarity=0.252  Sum_probs=21.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        25 ~~~~ki~vvG~~~vGKSsL~~~l~~   49 (214)
T 3q3j_B           25 VARCKLVLVGDVQCGKTAMLQVLAK   49 (214)
T ss_dssp             --CEEEEEECSTTSSHHHHHHHHHH
T ss_pred             cceEEEEEECcCCCCHHHHHHHHhc
Confidence            4579999999999999999999874

>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8

Probab=96.76  E-value=0.0005  Score=44.43  Aligned_cols=26  Identities=15%  Similarity=0.175  Sum_probs=21.5

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++-
T Consensus        17 ~~~~~~i~v~G~~~~GKSsli~~l~~   42 (213)
T 3cph_A           17 YDSIMKILLIGDSGVGKSCLLVRFVE   42 (213)
T ss_dssp             ---CEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCcceEEEEECCCCCCHHHHHHHHHh
Confidence            34579999999999999999999873

>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A*

Probab=96.74  E-value=0.00048  Score=44.80  Aligned_cols=25  Identities=16%  Similarity=0.218  Sum_probs=22.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++.
T Consensus        27 ~~~~ki~v~G~~~vGKSsLi~~l~~   51 (192)
T 2b6h_A           27 KKQMRILMVGLDAAGKTTILYKLKL   51 (192)
T ss_dssp             TSCEEEEEEESTTSSHHHHHHHHCS
T ss_pred             CCccEEEEECCCCCCHHHHHHHHHh
Confidence            4679999999999999999999873

>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A*

Probab=96.74  E-value=0.00051  Score=44.17  Aligned_cols=26  Identities=12%  Similarity=0.139  Sum_probs=22.9

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++-
T Consensus        18 ~~~~~ki~v~G~~~~GKSsli~~l~~   43 (191)
T 2a5j_A           18 GSYLFKYIIIGDTGVGKSCLLLQFTD   43 (191)
T ss_dssp             TCEEEEEEEESSTTSSHHHHHHHHHH
T ss_pred             cCcceEEEEECcCCCCHHHHHHHHhc
Confidence            34578999999999999999999874

>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major}

Probab=96.73  E-value=0.0004  Score=44.32  Aligned_cols=24  Identities=21%  Similarity=0.264  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.+|++++|...+||||++.+++
T Consensus        20 ~~~~~i~v~G~~~~GKssli~~l~   43 (189)
T 2x77_A           20 DRKIRVLMLGLDNAGKTSILYRLH   43 (189)
T ss_dssp             TSCEEEEEEEETTSSHHHHHHHTC
T ss_pred             CCceEEEEECCCCCCHHHHHHHHH
Confidence            468999999999999999999986

>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A

Probab=96.73  E-value=0.0005  Score=43.44  Aligned_cols=25  Identities=12%  Similarity=-0.017  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...|++++|...+|||||+.+++--
T Consensus        22 ~~~~i~v~G~~~~GKSsli~~l~~~   46 (195)
T 3pqc_A           22 LKGEVAFVGRSNVGKSSLLNALFNR   46 (195)
T ss_dssp             TTCEEEEEEBTTSSHHHHHHHHHTS
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHcC
Confidence            4679999999999999999988643

>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A*

Probab=96.72  E-value=0.00049  Score=45.16  Aligned_cols=25  Identities=16%  Similarity=0.236  Sum_probs=21.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++.
T Consensus        28 ~~~~ki~vvG~~~~GKSsLi~~l~~   52 (204)
T 4gzl_A           28 GQAIKCVVVGDGAVGKTCLLISYTT   52 (204)
T ss_dssp             --CEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCeEEEEEECcCCCCHHHHHHHHHh
Confidence            4679999999999999999988774

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*

Probab=96.72  E-value=0.00058  Score=43.18  Aligned_cols=23  Identities=17%  Similarity=0.098  Sum_probs=21.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..|+.++|.+.+||||++++++-
T Consensus         3 ~~~v~lvG~~gvGKStL~~~l~~   25 (165)
T 2wji_A            3 SYEIALIGNPNVGKSTIFNALTG   25 (165)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHC
T ss_pred             ccEEEEECCCCCCHHHHHHHHhC
Confidence            57999999999999999999874

>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A*

Probab=96.71  E-value=0.00038  Score=45.15  Aligned_cols=25  Identities=24%  Similarity=0.183  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus         6 ~~~~ki~v~G~~~~GKSsli~~l~~   30 (206)
T 2bcg_Y            6 DYLFKLLLIGNSGVGKSCLLLRFSD   30 (206)
T ss_dssp             SEEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHHHHhc
Confidence            4568999999999999999999874

>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens}

Probab=96.69  E-value=0.0011  Score=42.05  Aligned_cols=25  Identities=24%  Similarity=0.212  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        14 ~~~~ki~v~G~~~~GKSsli~~l~~   38 (196)
T 3tkl_A           14 DYLFKLLLIGDSGVGKSCLLLRFAD   38 (196)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ccceEEEEECcCCCCHHHHHHHHHc
Confidence            3568999999999999999999874

>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A*

Probab=96.69  E-value=0.00057  Score=43.15  Aligned_cols=24  Identities=13%  Similarity=0.142  Sum_probs=20.7

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+|++++|...+|||||++.+.
T Consensus        12 ~~~~ki~vvG~~~~GKssL~~~l~   35 (198)
T 3t1o_A           12 EINFKIVYYGPGLSGKTTNLKWIY   35 (198)
T ss_dssp             EEEEEEEEECSTTSSHHHHHHHHH
T ss_pred             ccccEEEEECCCCCCHHHHHHHHH
Confidence            457999999999999999996554

>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8

Probab=96.68  E-value=0.00037  Score=46.22  Aligned_cols=28  Identities=11%  Similarity=0.000  Sum_probs=23.6

Q ss_pred             HhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          28 IQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        28 k~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+.+|++++|...+|||||+.+++-
T Consensus        21 ~~~~~~~ki~lvG~~~vGKSsLi~~l~~   48 (201)
T 2ew1_A           21 EDYDFLFKIVLIGNAGVGKTCLVRRFTQ   48 (201)
T ss_dssp             -CCSEEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             cccccceEEEEECcCCCCHHHHHHHHHh
Confidence            3445679999999999999999999874

>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8

Probab=96.68  E-value=0.00056  Score=45.35  Aligned_cols=25  Identities=8%  Similarity=0.155  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        26 ~~~~ki~vvG~~~vGKSsLi~~l~~   50 (205)
T 1gwn_A           26 NVKCKIVVVGDSQCGKTALLHVFAK   50 (205)
T ss_dssp             -CEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             ceeeEEEEECCCCCCHHHHHHHHhc
Confidence            4679999999999999999999875

>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A*

Probab=96.68  E-value=0.00055  Score=44.01  Aligned_cols=25  Identities=20%  Similarity=0.323  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+.+||||++.+++-
T Consensus        14 ~~~~ki~ivG~~~vGKSsL~~~l~~   38 (181)
T 1fzq_A           14 DQEVRILLLGLDNAGKTTLLKQLAS   38 (181)
T ss_dssp             SSCEEEEEEESTTSSHHHHHHHHCC
T ss_pred             CCceEEEEECCCCCCHHHHHHHHhc
Confidence            4679999999999999999999874

>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens}

Probab=96.68  E-value=0.00062  Score=44.14  Aligned_cols=25  Identities=24%  Similarity=0.372  Sum_probs=21.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|...+|||||+.+++-
T Consensus        26 ~~~~ki~v~G~~~~GKSsli~~l~~   50 (199)
T 2p5s_A           26 QKAYKIVLAGDAAVGKSSFLMRLCK   50 (199)
T ss_dssp             --CEEEEEESSTTSSHHHHHHHHHH
T ss_pred             CCCeEEEEECcCCCCHHHHHHHHHh
Confidence            4579999999999999999999874

>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ...

Probab=96.67  E-value=0.00052  Score=45.18  Aligned_cols=26  Identities=19%  Similarity=0.125  Sum_probs=22.5

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|++++|...+|||||+.+++.
T Consensus        12 ~~~~~ki~v~G~~~~GKSsli~~~~~   37 (221)
T 3gj0_A           12 PQVQFKLVLVGDGGTGKTTFVKRHLT   37 (221)
T ss_dssp             CCCEEEEEEEECTTSSHHHHHTTBHH
T ss_pred             cccceEEEEECCCCCCHHHHHHHHHc
Confidence            34679999999999999999999653

>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B*

Probab=96.66  E-value=0.00057  Score=44.37  Aligned_cols=25  Identities=28%  Similarity=0.149  Sum_probs=20.8

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++++|.+++||||++.+++-
T Consensus        21 ~~~~ki~~vG~~~vGKSsli~~l~~   45 (190)
T 1m2o_B           21 NKHGKLLFLGLDNAGKTTLLHMLKN   45 (190)
T ss_dssp             ---CEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCccEEEEECCCCCCHHHHHHHHhc
Confidence            4568999999999999999999885

>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens}

Probab=96.66  E-value=0.00043  Score=45.34  Aligned_cols=29  Identities=21%  Similarity=0.087  Sum_probs=23.1

Q ss_pred             HHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          27 GIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        27 kk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+...+.+|++++|...+|||||+.+++-
T Consensus        23 ~~~~~~~~ki~vvG~~~vGKSsli~~l~~   51 (201)
T 2hup_A           23 DEQYDFLFKLVLVGDASVGKTCVVQRFKT   51 (201)
T ss_dssp             ---CCEEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             ccccccceEEEEECcCCCCHHHHHHHHhh
Confidence            33455679999999999999999999864

>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A*

Probab=96.66  E-value=0.00063  Score=43.52  Aligned_cols=26  Identities=19%  Similarity=0.152  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+|++++|...+|||||+.+++--
T Consensus        20 ~~~~ki~vvG~~~~GKSsli~~l~~~   45 (189)
T 2gf9_A           20 DYMFKLLLIGNSSVGKTSFLFRYADD   45 (189)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHHHS
T ss_pred             CceeEEEEECCCCCCHHHHHHHHHcC
Confidence            34689999999999999999998743

>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A*

Probab=96.65  E-value=0.0005  Score=43.42  Aligned_cols=24  Identities=21%  Similarity=0.206  Sum_probs=12.3

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+|++++|...+|||||+.+++
T Consensus         6 ~~~~ki~v~G~~~~GKssl~~~l~   29 (183)
T 2fu5_C            6 DYLFKLLLIGDSGVGKTCVLFRFS   29 (183)
T ss_dssp             SEEEEEEEECCCCC----------
T ss_pred             CCceEEEEECCCCCCHHHHHHHHH
Confidence            346899999999999999999886

>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927}

Probab=96.65  E-value=0.00065  Score=43.30  Aligned_cols=26  Identities=8%  Similarity=0.046  Sum_probs=22.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .....|++++|...+|||||+.+++-
T Consensus        14 ~~~~~ki~v~G~~~~GKSsl~~~l~~   39 (199)
T 4bas_A           14 SKTKLQVVMCGLDNSGKTTIINQVKP   39 (199)
T ss_dssp             --CEEEEEEECCTTSCHHHHHHHHSC
T ss_pred             CCCCcEEEEECCCCCCHHHHHHHHhc
Confidence            45678999999999999999999874

>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens}

Probab=96.64  E-value=0.00061  Score=44.04  Aligned_cols=25  Identities=4%  Similarity=0.068  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        24 ~~~~ki~vvG~~~~GKSsLi~~l~~   48 (192)
T 2il1_A           24 DFKLQVIIIGSRGVGKTSLMERFTD   48 (192)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHCC
T ss_pred             CCceEEEEECCCCCCHHHHHHHHhc
Confidence            4578999999999999999999873

>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8

Probab=96.64  E-value=0.00067  Score=43.76  Aligned_cols=26  Identities=12%  Similarity=0.121  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+|++++|...+|||||+.+++--
T Consensus         6 ~~~~ki~v~G~~~~GKSsli~~l~~~   31 (203)
T 1zbd_A            6 DYMFKILIIGNSSVGKTSFLFRYADD   31 (203)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHHTC
T ss_pred             ceeeEEEEECCCCCCHHHHHHHHhcC
Confidence            34689999999999999999988743

>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A*

Probab=96.59  E-value=0.0007  Score=43.90  Aligned_cols=23  Identities=17%  Similarity=0.186  Sum_probs=19.3

Q ss_pred             hCccceeeccCCCccchhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~   53 (76)
                      .+.+|++++|.+.+|||||+..+
T Consensus        18 ~~~~ki~~vG~~~vGKTsLi~~l   40 (196)
T 3llu_A           18 GSKPRILLMGLRRSGKSSIQKVV   40 (196)
T ss_dssp             --CCEEEEEESTTSSHHHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHHHH
Confidence            45799999999999999998854

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}

Probab=96.59  E-value=0.0036  Score=39.52  Aligned_cols=48  Identities=15%  Similarity=0.088  Sum_probs=33.3

Q ss_pred             HHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhc---ccceeee
Q psy6625          17 KQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTT---SKPMMIN   64 (76)
Q Consensus        17 k~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~---~~~~~~~   64 (76)
                      ..+.+.+..-........-+||.|..++|||+++++++--.   ..|+.+|
T Consensus         8 ~~~~~~~~~~~~~a~~~~~vll~G~~GtGKt~lA~~i~~~~~~~~~~~v~~   58 (145)
T 3n70_A            8 EWINQYRRRLQQLSETDIAVWLYGAPGTGRMTGARYLHQFGRNAQGEFVYR   58 (145)
T ss_dssp             HHHHHHHHHHHHHTTCCSCEEEESSTTSSHHHHHHHHHHSSTTTTSCCEEE
T ss_pred             HHHHHHHHHHHHHhCCCCCEEEECCCCCCHHHHHHHHHHhCCccCCCEEEE
Confidence            33444444434444566678999999999999999988765   4566544

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25

Probab=96.58  E-value=0.00066  Score=43.73  Aligned_cols=26  Identities=31%  Similarity=0.225  Sum_probs=21.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -+.|+|..+|||||+++.+.-....+
T Consensus        11 ~i~l~G~~GsGKSTl~~~La~~~~~g   36 (191)
T 1zp6_A           11 ILLLSGHPGSGKSTIAEALANLPGVP   36 (191)
T ss_dssp             EEEEEECTTSCHHHHHHHHHTCSSSC
T ss_pred             EEEEECCCCCCHHHHHHHHHhccCCC
Confidence            47899999999999999987654333

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}

Probab=96.57  E-value=0.00076  Score=43.77  Aligned_cols=23  Identities=9%  Similarity=-0.026  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.|+|..+|||||+++.++-..
T Consensus         9 ii~l~Gp~GsGKSTl~~~L~~~~   31 (205)
T 3tr0_A            9 LFIISAPSGAGKTSLVRALVKAL   31 (205)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHHS
T ss_pred             EEEEECcCCCCHHHHHHHHHhhC
Confidence            46899999999999999988653

>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum}

Probab=96.56  E-value=0.00085  Score=44.69  Aligned_cols=25  Identities=8%  Similarity=-0.017  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+..|++++|...+|||||+.+++-
T Consensus        27 ~~~~kI~vvG~~~vGKSsLin~l~~   51 (228)
T 2qu8_A           27 PHKKTIILSGAPNVGKSSFMNIVSR   51 (228)
T ss_dssp             TTSEEEEEECSTTSSHHHHHHHHTT
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhC
Confidence            4678999999999999999999875

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*

Probab=96.56  E-value=0.00074  Score=43.98  Aligned_cols=18  Identities=17%  Similarity=0.104  Sum_probs=16.2

Q ss_pred             ceeeccCCCccchhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLA   52 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~   52 (76)
                      -+.|+|..+|||||++++
T Consensus        11 i~~l~G~nGsGKSTl~~~   28 (171)
T 4gp7_A           11 LVVLIGSSGSGKSTFAKK   28 (171)
T ss_dssp             EEEEECCTTSCHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHH
Confidence            368999999999999996

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11

Probab=96.55  E-value=0.0008  Score=44.85  Aligned_cols=23  Identities=13%  Similarity=0.117  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++.|+|..+|||||+++.++-..
T Consensus         2 ~i~l~G~nGsGKTTLl~~l~g~l   24 (178)
T 1ye8_A            2 KIIITGEPGVGKTTLVKKIVERL   24 (178)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            67899999999999999988554

>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C

Probab=96.54  E-value=0.00043  Score=44.32  Aligned_cols=26  Identities=12%  Similarity=0.081  Sum_probs=7.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+|++++|...+|||||+.+++--
T Consensus        18 ~~~~~i~v~G~~~~GKssli~~l~~~   43 (208)
T 2yc2_C           18 TLRCKVAVVGEATVGKSALISMFTSK   43 (208)
T ss_dssp             EEEEEEEEC-----------------
T ss_pred             ccceEEEEECCCCCCHHHHHHHHHhC
Confidence            35789999999999999999988743

>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8

Probab=96.52  E-value=0.00077  Score=44.06  Aligned_cols=24  Identities=13%  Similarity=0.185  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|...+|||||+.+++-
T Consensus        24 ~~~ki~vvG~~~~GKSsli~~l~~   47 (207)
T 2fv8_A           24 IRKKLVVVGDGACGKTCLLIVFSK   47 (207)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             cCcEEEEECcCCCCHHHHHHHHhc
Confidence            468999999999999999999874

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2

Probab=96.50  E-value=0.00091  Score=42.43  Aligned_cols=24  Identities=13%  Similarity=0.185  Sum_probs=20.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .+.|.|..+|||||+++.+.-...
T Consensus         6 ~i~l~G~~GsGKSTl~~~La~~l~   29 (173)
T 1kag_A            6 NIFLVGPMGAGKSTIGRQLAQQLN   29 (173)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHTT
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhC
Confidence            589999999999999998876543

>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ...

Probab=96.50  E-value=0.00082  Score=43.73  Aligned_cols=24  Identities=13%  Similarity=0.199  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|...+|||||+.+++-
T Consensus        24 ~~~ki~vvG~~~~GKSsli~~l~~   47 (201)
T 2gco_A           24 IRKKLVIVGDGACGKTCLLIVFSK   47 (201)
T ss_dssp             EEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             cceEEEEECCCCCCHHHHHHHHHh
Confidence            468999999999999999999874

>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana}

Probab=96.49  E-value=0.00088  Score=43.57  Aligned_cols=25  Identities=16%  Similarity=0.147  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++.
T Consensus         7 ~~~~ki~i~G~~~~GKTsli~~l~~   31 (212)
T 2j0v_A            7 SKFIKCVTVGDGAVGKTCMLICYTS   31 (212)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CceEEEEEECCCCCCHHHHHHHHhc
Confidence            3578999999999999999998873

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A

Probab=96.48  E-value=0.00094  Score=41.37  Aligned_cols=19  Identities=21%  Similarity=0.032  Sum_probs=17.5

Q ss_pred             ceeeccCCCccchhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~   53 (76)
                      -++|.|..+|||||+.+.+
T Consensus         3 ~I~l~G~~GsGKsT~a~~L   21 (179)
T 3lw7_A            3 VILITGMPGSGKSEFAKLL   21 (179)
T ss_dssp             EEEEECCTTSCHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHH
Confidence            4789999999999999988

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}

Probab=96.47  E-value=0.0015  Score=45.00  Aligned_cols=40  Identities=13%  Similarity=0.022  Sum_probs=27.4

Q ss_pred             HHHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcc
Q psy6625          19 IEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        19 IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +-+.+.........-..++|.|..+|||||+++.+.--..
T Consensus        18 ~~~~~~~~~~~~~~~~~i~l~G~~GsGKSTla~~L~~~l~   57 (253)
T 2p5t_B           18 NLRSLTRGKKSSKQPIAILLGGQSGAGKTTIHRIKQKEFQ   57 (253)
T ss_dssp             HHHHHHTTCCCCSSCEEEEEESCGGGTTHHHHHHHHHHTT
T ss_pred             HHHHHHccCCcccCCeEEEEECCCCCCHHHHHHHHHHhcC
Confidence            3333444333334456789999999999999999876543

>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8

Probab=96.46  E-value=0.00075  Score=43.22  Aligned_cols=24  Identities=8%  Similarity=0.121  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|...+|||||+.+++-
T Consensus        17 ~~~ki~v~G~~~~GKssli~~l~~   40 (194)
T 2atx_A           17 LMLKCVVVGDGAVGKTCLLMSYAN   40 (194)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             ceEEEEEECCCCCCHHHHHHHHhc
Confidence            568999999999999999999874

>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A*

Probab=96.45  E-value=0.00081  Score=44.01  Aligned_cols=25  Identities=24%  Similarity=0.106  Sum_probs=22.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+..|++++|.+.+||||++.+++-
T Consensus        23 ~~~~ki~lvG~~~vGKSsLi~~l~~   47 (198)
T 1f6b_A           23 KKTGKLVFLGLDNAGKTTLLHMLKD   47 (198)
T ss_dssp             TCCEEEEEEEETTSSHHHHHHHHSC
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHhc
Confidence            4678999999999999999999873

>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens}

Probab=95.45  E-value=0.00048  Score=44.69  Aligned_cols=24  Identities=13%  Similarity=0.211  Sum_probs=21.7

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.+|++++|...+|||||+.+++
T Consensus        28 ~~~~ki~v~G~~~~GKSsli~~l~   51 (204)
T 3th5_A           28 GQAIKCVVVGDGAVGKTCLLISYT   51 (204)
Confidence            467999999999999999998876

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1

Probab=96.42  E-value=0.0011  Score=41.89  Aligned_cols=21  Identities=14%  Similarity=-0.004  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+++.|..+|||||+.+.+.-
T Consensus         4 ~I~i~G~~GsGKST~a~~L~~   24 (181)
T 1ly1_A            4 IILTIGCPGSGKSTWAREFIA   24 (181)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEecCCCCCHHHHHHHHHh
Confidence            478899999999999998875

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8

Probab=96.41  E-value=0.001  Score=43.10  Aligned_cols=26  Identities=12%  Similarity=0.116  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ....++.|+|..+|||||++++++-.
T Consensus        24 ~~~~~v~lvG~~g~GKSTLl~~l~g~   49 (210)
T 1pui_A           24 DTGIEVAFAGRSNAGKSSALNTLTNQ   49 (210)
T ss_dssp             SCSEEEEEEECTTSSHHHHHTTTCCC
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHhCC
Confidence            35678999999999999999998744

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A

Probab=96.40  E-value=0.0011  Score=42.53  Aligned_cols=24  Identities=17%  Similarity=0.160  Sum_probs=21.0

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...|+.++|...+||||++++++-
T Consensus         3 ~~~ki~ivG~~g~GKStLl~~l~~   26 (172)
T 2gj8_A            3 HGMKVVIAGRPNAGKSSLLNALAG   26 (172)
T ss_dssp             -CEEEEEEESTTSSHHHHHHHHHT
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            357999999999999999999874

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}

Probab=96.40  E-value=0.0012  Score=43.55  Aligned_cols=22  Identities=9%  Similarity=0.105  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|+|.|..+|||||+++.+.--
T Consensus         2 ~I~l~G~~GsGKsT~a~~L~~~   23 (216)
T 3fb4_A            2 NIVLMGLPGAGKGTQAEQIIEK   23 (216)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            6899999999999999988543

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*

Probab=96.39  E-value=0.001  Score=43.55  Aligned_cols=21  Identities=19%  Similarity=0.188  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+.|+|..+||||||+++++-
T Consensus        27 ~~~l~G~nGsGKSTll~~l~g   47 (231)
T 4a74_A           27 ITEVFGEFGSGKTQLAHTLAV   47 (231)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999999975

>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens}

Probab=96.39  E-value=0.0012  Score=44.47  Aligned_cols=25  Identities=8%  Similarity=0.239  Sum_probs=21.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++|+|...+|||||+.+++-
T Consensus        27 ~~~~~i~lvG~~g~GKStlin~l~g   51 (239)
T 3lxx_A           27 NSQLRIVLVGKTGAGKSATGNSILG   51 (239)
T ss_dssp             -CEEEEEEECCTTSSHHHHHHHHHT
T ss_pred             CCceEEEEECCCCCCHHHHHHHHcC
Confidence            4679999999999999999998764

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}

Probab=96.39  E-value=0.0013  Score=43.81  Aligned_cols=26  Identities=19%  Similarity=-0.001  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-..+.++|..+|||||+++.++-.-
T Consensus        21 ~g~~v~I~G~sGsGKSTl~~~l~~~~   46 (208)
T 3c8u_A           21 GRQLVALSGAPGSGKSTLSNPLAAAL   46 (208)
T ss_dssp             SCEEEEEECCTTSCTHHHHHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHHHH
Confidence            44578899999999999999887654

>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A*

Probab=96.36  E-value=0.0012  Score=45.07  Aligned_cols=24  Identities=21%  Similarity=0.253  Sum_probs=20.9

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+++|++|||.+.+|||+++..++
T Consensus        11 ~k~~KivlvGd~~VGKTsLi~r~~   34 (216)
T 4dkx_A           11 LRKFKLVFLGEQSVGKTSLITRFM   34 (216)
T ss_dssp             --CEEEEEECSTTSSHHHHHHHHH
T ss_pred             CCcEEEEEECcCCcCHHHHHHHHH
Confidence            357899999999999999999886

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}

Probab=96.36  E-value=0.0019  Score=44.78  Aligned_cols=38  Identities=13%  Similarity=0.103  Sum_probs=26.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+|||||+++.++-.-   +--+.+++   .||++.|
T Consensus        33 ~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~I~~~g---~i~~v~Q   73 (237)
T 2cbz_A           33 LVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKG---SVAYVPQ   73 (237)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTCSEEEEEEEEECS---CEEEECS
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCceEEECC---EEEEEcC
Confidence            56899999999999999887653   22234443   2566655

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*

Probab=96.36  E-value=0.0013  Score=43.50  Aligned_cols=22  Identities=14%  Similarity=0.123  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|+|.|..+|||||+++.+.--
T Consensus         2 ~I~l~G~~GsGKsT~a~~L~~~   23 (216)
T 3dl0_A            2 NLVLMGLPGAGKGTQGERIVEK   23 (216)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            6899999999999999988643

>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis}

Probab=96.35  E-value=0.00073  Score=44.18  Aligned_cols=25  Identities=12%  Similarity=0.207  Sum_probs=22.1

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +..|++++|...+|||||+.+++--
T Consensus        28 ~~~~i~v~G~~~~GKSslin~l~~~   52 (223)
T 4dhe_A           28 VQPEIAFAGRSNAGKSTAINVLCNQ   52 (223)
T ss_dssp             CSCEEEEEESCHHHHHHHHHHHTTC
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCC
Confidence            5689999999999999999998743

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}

Probab=96.34  E-value=0.003  Score=43.40  Aligned_cols=26  Identities=27%  Similarity=0.234  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+-..|+|.|..+|||||+++.+.--
T Consensus        27 ~~~~~I~l~G~~GsGKsT~a~~L~~~   52 (243)
T 3tlx_A           27 KPDGRYIFLGAPGSGKGTQSLNLKKS   52 (243)
T ss_dssp             SCCEEEEEECCTTSSHHHHHHHHHHH
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHHHH
Confidence            45678999999999999999988643

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}

Probab=96.34  E-value=0.0013  Score=42.63  Aligned_cols=23  Identities=9%  Similarity=-0.025  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus         8 ~i~l~G~~GsGKSTl~~~L~~~~   30 (207)
T 2j41_A            8 LIVLSGPSGVGKGTVRKRIFEDP   30 (207)
T ss_dssp             EEEEECSTTSCHHHHHHHHHHCT
T ss_pred             EEEEECCCCCCHHHHHHHHHHhh
Confidence            57899999999999999886543

>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae}

Probab=96.32  E-value=0.001  Score=44.05  Aligned_cols=25  Identities=12%  Similarity=0.045  Sum_probs=22.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|++++|...+|||||+.+++-
T Consensus        11 ~~~~ki~v~G~~~vGKSsli~~l~~   35 (223)
T 3cpj_B           11 DLLFKIVLIGDSGVGKSNLLSRFTK   35 (223)
T ss_dssp             CEEEEEEEESCTTSSHHHHHHHHHH
T ss_pred             CeeeEEEEECcCCCCHHHHHHHHhc
Confidence            4578999999999999999999874

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}

Probab=96.28  E-value=0.0012  Score=46.73  Aligned_cols=25  Identities=12%  Similarity=0.194  Sum_probs=21.6

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +..+.|+|..+||||||++.++-..
T Consensus         2 ~f~v~lvG~nGaGKSTLln~L~g~~   26 (270)
T 3sop_A            2 DFNIMVVGQSGLGKSTLVNTLFKSQ   26 (270)
T ss_dssp             EEEEEEEESSSSSHHHHHHHHHHHH
T ss_pred             eeEEEEECCCCCCHHHHHHHHhCCC
Confidence            3578999999999999999998643

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*

Probab=96.28  E-value=0.0013  Score=43.18  Aligned_cols=23  Identities=22%  Similarity=0.158  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+.|.|..+|||||+++.++-.
T Consensus         7 ~~i~i~G~~GsGKSTl~~~l~~~   29 (211)
T 3asz_A            7 FVIGIAGGTASGKTTLAQALART   29 (211)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHHHHHH
Confidence            45789999999999999988764

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*

Probab=96.26  E-value=0.0015  Score=41.66  Aligned_cols=24  Identities=13%  Similarity=0.066  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .+.|.|..+|||||+++.+.-...
T Consensus        10 ~i~l~G~~GsGKSTl~~~l~~~~g   33 (175)
T 1knq_A           10 IYVLMGVSGSGKSAVASEVAHQLH   33 (175)
T ss_dssp             EEEEECSTTSCHHHHHHHHHHHHT
T ss_pred             EEEEEcCCCCCHHHHHHHHHHhhC
Confidence            578999999999999998875443

>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A*

Probab=96.25  E-value=0.0012  Score=45.76  Aligned_cols=24  Identities=17%  Similarity=0.117  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..++|+|+|.+.+|||||+.+++.
T Consensus         7 ~~~~I~vvG~~g~GKSTLin~L~~   30 (274)
T 3t5d_A            7 FEFTLMVVGESGLGKSTLINSLFL   30 (274)
T ss_dssp             CEEEEEEEECTTSSHHHHHHHHSS
T ss_pred             cEEEEEEECCCCCCHHHHHHHHhC
Confidence            468999999999999999999764

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*

Probab=96.24  E-value=0.0016  Score=40.84  Aligned_cols=24  Identities=13%  Similarity=0.074  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .|.|.|..+|||||+++.+.--..
T Consensus         3 ~i~l~G~~GsGKsT~~~~L~~~l~   26 (173)
T 3kb2_A            3 LIILEGPDCCFKSTVAAKLSKELK   26 (173)
T ss_dssp             EEEEECSSSSSHHHHHHHHHHHHC
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            478999999999999998865433

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1

Probab=96.23  E-value=0.0016  Score=42.51  Aligned_cols=22  Identities=27%  Similarity=0.167  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||+++.++-.
T Consensus         7 ~i~i~GpsGsGKSTL~~~L~~~   28 (180)
T 1kgd_A            7 TLVLLGAHGVGRRHIKNTLITK   28 (180)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            4689999999999999998753

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A

Probab=96.19  E-value=0.0017  Score=44.16  Aligned_cols=21  Identities=14%  Similarity=0.172  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      -.+.|+|..+|||||+++.++
T Consensus        28 ~~i~l~G~~GsGKSTl~k~La   48 (246)
T 2bbw_A           28 LRAVILGPPGSGKGTVCQRIA   48 (246)
T ss_dssp             CEEEEECCTTSSHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHH
Confidence            468999999999999999987

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A

Probab=96.19  E-value=0.0017  Score=42.80  Aligned_cols=23  Identities=9%  Similarity=0.075  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.|+|..+||||||++.++-.-
T Consensus        35 ~v~L~G~nGaGKTTLlr~l~g~l   57 (158)
T 1htw_A           35 MVYLNGDLGAGKTTLTRGMLQGI   57 (158)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHT
T ss_pred             EEEEECCCCCCHHHHHHHHHHhC
Confidence            57899999999999999988653

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1

Probab=96.16  E-value=0.0018  Score=41.21  Aligned_cols=23  Identities=9%  Similarity=0.127  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..|+|.|..+|||||+.+.+.--
T Consensus         4 ~~I~l~G~~GsGKsT~a~~L~~~   26 (196)
T 1tev_A            4 LVVFVLGGPGAGKGTQCARIVEK   26 (196)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            35789999999999999887653

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}

Probab=96.16  E-value=0.0018  Score=42.43  Aligned_cols=25  Identities=12%  Similarity=0.082  Sum_probs=20.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhcc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      ..++|.|..+|||||+++.+.-...
T Consensus        19 ~~I~l~G~~GsGKSTla~~L~~~lg   43 (202)
T 3t61_A           19 GSIVVMGVSGSGKSSVGEAIAEACG   43 (202)
T ss_dssp             SCEEEECSTTSCHHHHHHHHHHHHT
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHhC
Confidence            3689999999999999998865543

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}

Probab=96.15  E-value=0.0018  Score=42.67  Aligned_cols=24  Identities=13%  Similarity=0.131  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      --+.|+|..+|||||+++.+.-..
T Consensus        30 ~~i~l~G~~GsGKSTl~~~L~~~~   53 (200)
T 4eun_A           30 RHVVVMGVSGSGKTTIAHGVADET   53 (200)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHHHhh
Confidence            357899999999999999987544

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*

Probab=96.15  E-value=0.002  Score=41.53  Aligned_cols=24  Identities=13%  Similarity=0.008  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      --++|.|..++||||++++++-..
T Consensus        39 ~~~~l~G~~G~GKTtL~~~i~~~~   62 (180)
T 3ec2_A           39 KGLTFVGSPGVGKTHLAVATLKAI   62 (180)
T ss_dssp             CEEEECCSSSSSHHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Confidence            357999999999999999987543

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}

Probab=96.14  E-value=0.0019  Score=41.37  Aligned_cols=22  Identities=14%  Similarity=0.128  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..++|.|..+|||||+.+.+.-
T Consensus         5 ~~I~l~G~~GsGKST~~~~La~   26 (186)
T 3cm0_A            5 QAVIFLGPPGAGKGTQASRLAQ   26 (186)
T ss_dssp             EEEEEECCTTSCHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4689999999999999998864

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A

Probab=96.13  E-value=0.003  Score=43.45  Aligned_cols=22  Identities=9%  Similarity=0.015  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        36 ~~~i~G~nGsGKSTLl~~l~Gl   57 (229)
T 2pze_A           36 LLAVAGSTGAGKTSLLMMIMGE   57 (229)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5679999999999999998765

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25

Probab=96.12  E-value=0.0032  Score=40.72  Aligned_cols=20  Identities=10%  Similarity=0.087  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +.|+|..+|||||+++.+.-
T Consensus         5 i~l~G~~GaGKSTl~~~L~~   24 (189)
T 2bdt_A            5 YIITGPAGVGKSTTCKRLAA   24 (189)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHhc
Confidence            67899999999999999875

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1

Probab=96.04  E-value=0.0022  Score=42.68  Aligned_cols=21  Identities=14%  Similarity=0.031  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..+|||||+++.++-
T Consensus         6 ~i~lvGpsGaGKSTLl~~L~~   26 (198)
T 1lvg_A            6 PVVLSGPSGAGKSTLLKKLFQ   26 (198)
T ss_dssp             CEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999875

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*

Probab=96.04  E-value=0.0022  Score=42.30  Aligned_cols=22  Identities=9%  Similarity=-0.061  Sum_probs=19.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.|.|..+|||||+++.+.-
T Consensus         6 ~~i~i~G~~GsGKSTl~~~L~~   27 (227)
T 1cke_A            6 PVITIDGPSGAGKGTLCKAMAE   27 (227)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4689999999999999998753

>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A*

Probab=96.03  E-value=0.0024  Score=43.73  Aligned_cols=24  Identities=4%  Similarity=-0.049  Sum_probs=21.6

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....|+.++|...+|||||+.+++
T Consensus        24 ~~~~~i~vvG~~~~GKSSLln~l~   47 (299)
T 2aka_B           24 LDLPQIAVVGGQSAGKSSVLENFV   47 (299)
T ss_dssp             CCCCEEEEEEBTTSCHHHHHHHHH
T ss_pred             CCCCeEEEEeCCCCCHHHHHHHHH
Confidence            356799999999999999999986

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}

Probab=96.02  E-value=0.0023  Score=41.57  Aligned_cols=21  Identities=24%  Similarity=0.191  Sum_probs=18.5

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -++|+|..+||||||+++++-
T Consensus        25 ~~~i~G~~GsGKTtl~~~l~~   45 (235)
T 2w0m_A           25 FIALTGEPGTGKTIFSLHFIA   45 (235)
T ss_dssp             EEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHHHH
Confidence            468899999999999999884

>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A

Probab=96.01  E-value=0.0029  Score=43.32  Aligned_cols=24  Identities=21%  Similarity=0.142  Sum_probs=20.7

Q ss_pred             eeeccCCCccchhhhhhhhhhcccc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|++|.+.||||||..+++.- ..|
T Consensus         2 ilV~Gg~~SGKS~~A~~la~~-~~~   25 (180)
T 1c9k_A            2 ILVTGGARSGKSRHAEALIGD-APQ   25 (180)
T ss_dssp             EEEEECTTSSHHHHHHHHHCS-CSS
T ss_pred             EEEECCCCCcHHHHHHHHHhc-CCC
Confidence            689999999999999999865 544

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*

Probab=96.00  E-value=0.0024  Score=40.65  Aligned_cols=26  Identities=15%  Similarity=0.134  Sum_probs=20.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -++|-|..+|||||+.+.+.--...|
T Consensus         5 ~i~l~G~~GsGKST~a~~La~~l~~~   30 (178)
T 1qhx_A            5 MIILNGGSSAGKSGIVRCLQSVLPEP   30 (178)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHSSSC
T ss_pred             EEEEECCCCCCHHHHHHHHHHhcCCC
Confidence            36889999999999999887554444

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*

Probab=96.00  E-value=0.0023  Score=44.28  Aligned_cols=22  Identities=9%  Similarity=-0.082  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        33 ~~~iiG~nGsGKSTLl~~l~Gl   54 (235)
T 3tif_A           33 FVSIMGPSGSGKSTMLNIIGCL   54 (235)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCcHHHHHHHHhcC
Confidence            4689999999999999988854

>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8

Probab=95.98  E-value=0.0025  Score=43.17  Aligned_cols=24  Identities=13%  Similarity=0.137  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+|++|+|.+.+||||++.+++
T Consensus        35 ~~~~kVvlvG~~~vGKSSLl~r~~   58 (211)
T 2g3y_A           35 NTYYRVVLIGEQGVGKSTLANIFA   58 (211)
T ss_dssp             CCEEEEEEECCTTSSHHHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHHHH
Confidence            457999999999999999999987

>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A

Probab=95.98  E-value=0.0024  Score=43.35  Aligned_cols=25  Identities=8%  Similarity=0.292  Sum_probs=21.8

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...++|+|+|...+||||++.+++-
T Consensus        20 ~~~~~I~lvG~~g~GKStl~n~l~~   44 (260)
T 2xtp_A           20 RSELRIILVGKTGTGKSAAGNSILR   44 (260)
T ss_dssp             -CCEEEEEEECTTSCHHHHHHHHHT
T ss_pred             CCceEEEEECCCCCCHHHHHHHHhC
Confidence            4578999999999999999999863

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A

Probab=95.97  E-value=0.0025  Score=42.31  Aligned_cols=23  Identities=13%  Similarity=0.026  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.|+|..+|||||+++.++-..
T Consensus        22 i~~l~GpnGsGKSTLl~~l~gl~   44 (207)
T 1znw_A           22 VVVLSGPSAVGKSTVVRCLRERI   44 (207)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEEECCCCCCHHHHHHHHHhhC
Confidence            46799999999999999987654

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}

Probab=95.97  E-value=0.0022  Score=41.85  Aligned_cols=21  Identities=10%  Similarity=0.045  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      ++.+.|..+|||||+++.+.-
T Consensus         3 ~i~i~G~~GsGKSTl~~~L~~   23 (204)
T 2if2_A            3 RIGLTGNIGCGKSTVAQMFRE   23 (204)
T ss_dssp             EEEEEECTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCcCHHHHHHHHHH
Confidence            578999999999999998754

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1

Probab=95.95  E-value=0.0024  Score=40.61  Aligned_cols=22  Identities=5%  Similarity=-0.229  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|++.|..+|||||+.+.+.--
T Consensus         3 ~I~i~G~~GsGKsT~~~~L~~~   24 (194)
T 1nks_A            3 IGIVTGIPGVGKSTVLAKVKEI   24 (194)
T ss_dssp             EEEEEECTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999988653

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12

Probab=95.90  E-value=0.0027  Score=43.97  Aligned_cols=31  Identities=10%  Similarity=-0.038  Sum_probs=23.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl~~p~~G~i~~~g   63 (243)
T 1mv5_A           30 IIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDG   63 (243)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSSCCSBSCEEETT
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCcEEEECC
Confidence            57899999999999999988653   33345544

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}

Probab=95.90  E-value=0.0027  Score=44.75  Aligned_cols=24  Identities=13%  Similarity=-0.033  Sum_probs=20.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-.++++|..+|||||+++++.-.
T Consensus        25 g~~v~i~Gp~GsGKSTll~~l~g~   48 (261)
T 2eyu_A           25 MGLILVTGPTGSGKSTTIASMIDY   48 (261)
T ss_dssp             SEEEEEECSTTCSHHHHHHHHHHH
T ss_pred             CCEEEEECCCCccHHHHHHHHHHh
Confidence            336899999999999999988753

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}

Probab=95.88  E-value=0.0025  Score=43.59  Aligned_cols=22  Identities=18%  Similarity=0.075  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        24 ~~~liG~nGsGKSTLl~~l~Gl   45 (208)
T 3b85_A           24 IVFGLGPAGSGKTYLAMAKAVQ   45 (208)
T ss_dssp             EEEEECCTTSSTTHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4689999999999999998866

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}

Probab=95.88  E-value=0.0029  Score=41.65  Aligned_cols=27  Identities=15%  Similarity=0.255  Sum_probs=21.9

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -.++|.|..+|||||+.+.+.--...|
T Consensus        26 ~~i~l~G~~GsGKsTl~~~La~~l~~~   52 (199)
T 3vaa_A           26 VRIFLTGYMGAGKTTLGKAFARKLNVP   52 (199)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHHHTCC
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHHcCCC
Confidence            368999999999999999987544433

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12

Probab=95.87  E-value=0.0028  Score=43.69  Aligned_cols=22  Identities=9%  Similarity=-0.091  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        37 ~~~iiG~NGsGKSTLlk~l~Gl   58 (214)
T 1sgw_A           37 VVNFHGPNGIGKTTLLKTISTY   58 (214)
T ss_dssp             CEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4679999999999999998865

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}

Probab=95.87  E-value=0.0025  Score=42.76  Aligned_cols=20  Identities=15%  Similarity=-0.028  Sum_probs=14.3

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -+.|+|..+|||||+++.++
T Consensus        29 ii~l~Gp~GsGKSTl~~~L~   48 (231)
T 3lnc_A           29 ILVLSSPSGCGKTTVANKLL   48 (231)
T ss_dssp             EEEEECSCC----CHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            46899999999999999988

>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus}

Probab=95.87  E-value=0.0028  Score=43.76  Aligned_cols=25  Identities=16%  Similarity=-0.059  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +.+|+.|+|.+.+||||++.+++-.
T Consensus         2 ~~~~i~lvG~~g~GKTTL~n~l~g~   26 (271)
T 3k53_A            2 VLKTVALVGNPNVGKTTIFNALTGL   26 (271)
T ss_dssp             CCEEEEEEECSSSSHHHHHHHHHTT
T ss_pred             ceeEEEEECCCCCCHHHHHHHHhCC
Confidence            3579999999999999999998643

>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus}

Probab=95.86  E-value=0.0093  Score=38.96  Aligned_cols=25  Identities=8%  Similarity=0.026  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +..+++++|.++|||||++..++--
T Consensus        29 ~~~~i~i~G~~g~GKTTl~~~l~~~   53 (221)
T 2wsm_A           29 GTVAVNIMGAIGSGKTLLIERTIER   53 (221)
T ss_dssp             TCEEEEEEECTTSCHHHHHHHHHHH
T ss_pred             CceEEEEEcCCCCCHHHHHHHHHHH
Confidence            5678999999999999999988754

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A

Probab=95.85  E-value=0.0027  Score=43.61  Aligned_cols=22  Identities=14%  Similarity=-0.022  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        32 ~~~iiG~nGsGKSTLl~~l~Gl   53 (224)
T 2pcj_A           32 FVSIIGASGSGKSTLLYILGLL   53 (224)
T ss_dssp             EEEEEECTTSCHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4679999999999999988754

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1

Probab=95.82  E-value=0.0025  Score=46.08  Aligned_cols=25  Identities=20%  Similarity=0.105  Sum_probs=21.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-|+.++|..+|||||+++.++-..
T Consensus       170 g~k~~IvG~nGsGKSTLlk~L~gl~  194 (365)
T 1lw7_A          170 AKTVAILGGESSGKSVLVNKLAAVF  194 (365)
T ss_dssp             CEEEEEECCTTSHHHHHHHHHHHHT
T ss_pred             hCeEEEECCCCCCHHHHHHHHHHHh
Confidence            4588999999999999999887653

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*

Probab=95.82  E-value=0.0032  Score=40.42  Aligned_cols=22  Identities=14%  Similarity=0.197  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+.|..+|||||+++.+.--
T Consensus         2 ~I~i~G~~GsGKsT~~~~L~~~   23 (205)
T 2jaq_A            2 KIAIFGTVGAGKSTISAEISKK   23 (205)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCccCHHHHHHHHHHh
Confidence            4789999999999999988763

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2

Probab=95.82  E-value=0.004  Score=39.85  Aligned_cols=26  Identities=15%  Similarity=0.119  Sum_probs=21.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .++|.|..+|||||+.+.+.--..-|
T Consensus         6 ~i~i~G~~GsGKsTla~~La~~l~~~   31 (175)
T 1via_A            6 NIVFIGFMGSGKSTLARALAKDLDLV   31 (175)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHHTCE
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHcCCC
Confidence            58999999999999999887554433

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.82  E-value=0.0031  Score=43.68  Aligned_cols=23  Identities=13%  Similarity=0.101  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        34 ~~~l~G~nGsGKSTLl~~l~Gl~   56 (240)
T 1ji0_A           34 IVTLIGANGAGKTTTLSAIAGLV   56 (240)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            46799999999999999988653

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*

Probab=95.81  E-value=0.0029  Score=40.57  Aligned_cols=22  Identities=14%  Similarity=-0.079  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.++.|..+|||||++.+++..
T Consensus        28 ~~~i~G~NGsGKStll~ai~~~   49 (182)
T 3kta_A           28 FTAIVGANGSGKSNIGDAILFV   49 (182)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHHHHHH
Confidence            3578899999999999998764

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*

Probab=95.81  E-value=0.0032  Score=40.93  Aligned_cols=21  Identities=19%  Similarity=0.159  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+++.|.++||||||+++++-
T Consensus        22 ~~~i~G~~GsGKTtl~~~l~~   42 (220)
T 2cvh_A           22 LTQVYGPYASGKTTLALQTGL   42 (220)
T ss_dssp             EEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            468999999999999999887

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A

Probab=95.81  E-value=0.0033  Score=40.36  Aligned_cols=28  Identities=14%  Similarity=0.044  Sum_probs=22.1

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ...|++.|..+|||||+++.+.--...|
T Consensus        11 ~~~i~i~G~~GsGKst~~~~l~~~~~~~   38 (180)
T 3iij_A           11 LPNILLTGTPGVGKTTLGKELASKSGLK   38 (180)
T ss_dssp             CCCEEEECSTTSSHHHHHHHHHHHHCCE
T ss_pred             CCeEEEEeCCCCCHHHHHHHHHHHhCCe
Confidence            3468999999999999999887544333

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}

Probab=95.81  E-value=0.0033  Score=39.58  Aligned_cols=26  Identities=19%  Similarity=0.290  Sum_probs=21.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +|+|.|..+|||||+++.+.--...|
T Consensus         2 ~I~l~G~~GsGKsT~a~~L~~~l~~~   27 (168)
T 2pt5_A            2 RIYLIGFMCSGKSTVGSLLSRSLNIP   27 (168)
T ss_dssp             EEEEESCTTSCHHHHHHHHHHHHTCC
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhCCC
Confidence            58899999999999999887644433

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1

Probab=95.79  E-value=0.0034  Score=41.13  Aligned_cols=21  Identities=14%  Similarity=-0.042  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|.|..+|||||+++.+.-
T Consensus         4 ~i~l~G~~GsGKST~~~~La~   24 (206)
T 1jjv_A            4 IVGLTGGIGSGKTTIANLFTD   24 (206)
T ss_dssp             EEEEECSTTSCHHHHHHHHHT
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999998865

>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=95.78  E-value=0.006  Score=44.62  Aligned_cols=25  Identities=16%  Similarity=0.119  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...++++++|..++|||||+.+++.
T Consensus        35 ~~~~~I~vvG~~g~GKSTLln~L~~   59 (361)
T 2qag_A           35 GFEFTLMVVGESGLGKSTLINSLFL   59 (361)
T ss_dssp             CCEECEEECCCTTSCHHHHHHHHTT
T ss_pred             CCCEEEEEEcCCCCCHHHHHHHHhC
Confidence            4578999999999999999999754

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*

Probab=95.77  E-value=0.0033  Score=43.77  Aligned_cols=22  Identities=14%  Similarity=0.028  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        31 ~~~l~G~nGsGKSTLlk~l~Gl   52 (250)
T 2d2e_A           31 VHALMGPNGAGKSTLGKILAGD   52 (250)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTC
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4679999999999999999875

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*

Probab=95.76  E-value=0.0032  Score=41.77  Aligned_cols=22  Identities=14%  Similarity=0.279  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|+|.|..+|||||+++.+.--
T Consensus         2 ~I~l~G~~GsGKsT~a~~L~~~   23 (214)
T 1e4v_A            2 RIILLGAPVAGKGTQAQFIMEK   23 (214)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            6899999999999999988653

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12

Probab=95.76  E-value=0.0033  Score=44.34  Aligned_cols=23  Identities=13%  Similarity=0.041  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        43 i~~l~G~NGsGKSTLlk~l~Gl~   65 (256)
T 1vpl_A           43 IFGLIGPNGAGKTTTLRIISTLI   65 (256)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            46799999999999999988653

>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum}

Probab=95.75  E-value=0.0067  Score=46.04  Aligned_cols=26  Identities=19%  Similarity=0.252  Sum_probs=23.3

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.+|++|+|.+.+||||++.+++-
T Consensus        38 ~~~~~kV~lvG~~~vGKSSLl~~l~~   63 (535)
T 3dpu_A           38 HLQEIKVHLIGDGMAGKTSLLKQLIG   63 (535)
T ss_dssp             CCCEEEEEEESSSCSSHHHHHHHHHC
T ss_pred             cccceEEEEECCCCCCHHHHHHHHhc
Confidence            45789999999999999999998874

>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A

Probab=95.75  E-value=0.0028  Score=44.15  Aligned_cols=24  Identities=21%  Similarity=0.012  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++|+|...+||||++.+++-
T Consensus         4 ~~~kI~lvG~~nvGKTsL~n~l~g   27 (258)
T 3a1s_A            4 HMVKVALAGCPNVGKTSLFNALTG   27 (258)
T ss_dssp             EEEEEEEECCTTSSHHHHHHHHHT
T ss_pred             CceEEEEECCCCCCHHHHHHHHHC
Confidence            468999999999999999999864

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*

Probab=95.75  E-value=0.0034  Score=43.81  Aligned_cols=23  Identities=9%  Similarity=-0.057  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        37 ~~~i~G~nGsGKSTLl~~l~Gl~   59 (247)
T 2ff7_A           37 VIGIVGRSGSGKSTLTKLIQRFY   59 (247)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            56899999999999999988663

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*

Probab=95.75  E-value=0.0034  Score=44.45  Aligned_cols=22  Identities=18%  Similarity=0.025  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        47 ~~~i~G~nGsGKSTLlk~l~Gl   68 (271)
T 2ixe_A           47 VTALVGPNGSGKSTVAALLQNL   68 (271)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4689999999999999998865

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A

Probab=95.74  E-value=0.0036  Score=39.79  Aligned_cols=23  Identities=9%  Similarity=-0.086  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..|++.|..+|||||+++.+.--
T Consensus         4 ~~I~i~G~~GsGKsT~~~~L~~~   26 (192)
T 1kht_A            4 KVVVVTGVPGVGSTTSSQLAMDN   26 (192)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            35899999999999999987653

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}

Probab=95.74  E-value=0.0035  Score=40.47  Aligned_cols=22  Identities=14%  Similarity=-0.013  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..|++.|..+|||||+++.+.-
T Consensus         5 ~~I~i~G~~GsGKsT~~~~L~~   26 (213)
T 2plr_A            5 VLIAFEGIDGSGKSSQATLLKD   26 (213)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHH
T ss_pred             eEEEEEcCCCCCHHHHHHHHHH
Confidence            4689999999999999998865

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*

Probab=95.73  E-value=0.0049  Score=39.53  Aligned_cols=26  Identities=19%  Similarity=0.051  Sum_probs=21.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .|+|.|..+|||||+.+.+.--..-|
T Consensus         4 ~I~l~G~~GsGKsT~a~~La~~lg~~   29 (184)
T 2iyv_A            4 KAVLVGLPGSGKSTIGRRLAKALGVG   29 (184)
T ss_dssp             SEEEECSTTSSHHHHHHHHHHHHTCC
T ss_pred             eEEEECCCCCCHHHHHHHHHHHcCCC
Confidence            58999999999999999886544444

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*

Probab=95.73  E-value=0.0041  Score=41.31  Aligned_cols=26  Identities=15%  Similarity=0.170  Sum_probs=21.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -..|+|.|..+|||||+.+.+.--..
T Consensus         4 ~~~I~l~G~~GsGKsT~a~~La~~l~   29 (220)
T 1aky_A            4 SIRMVLIGPPGAGKGTQAPNLQERFH   29 (220)
T ss_dssp             CCEEEEECCTTSSHHHHHHHHHHHHC
T ss_pred             CcEEEEECCCCCCHHHHHHHHHHHcC
Confidence            45789999999999999998865443

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}

Probab=95.73  E-value=0.0036  Score=41.34  Aligned_cols=23  Identities=9%  Similarity=-0.132  Sum_probs=19.2

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -.-++|.|..+|||||+.+.+.-
T Consensus        12 ~~~i~l~G~sGsGKsTl~~~L~~   34 (204)
T 2qor_A           12 IPPLVVCGPSGVGKGTLIKKVLS   34 (204)
T ss_dssp             CCCEEEECCTTSCHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Confidence            34578999999999999998764

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}

Probab=95.71  E-value=0.0035  Score=44.78  Aligned_cols=34  Identities=12%  Similarity=0.081  Sum_probs=24.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCcee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV   68 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~   68 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++..+
T Consensus        36 ~~~iiGpnGsGKSTLl~~l~Gl~~p~~G~I~~~G~~i   72 (275)
T 3gfo_A           36 VTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI   72 (275)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSSCCSEEEEEETTEEC
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCCCCeEEEECCEEC
Confidence            46899999999999999988543   22345555433

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*

Probab=95.71  E-value=0.0036  Score=43.75  Aligned_cols=22  Identities=14%  Similarity=0.015  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        35 ~~~liG~nGsGKSTLlk~l~Gl   56 (257)
T 1g6h_A           35 VTLIIGPNGSGKSTLINVITGF   56 (257)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4679999999999999998765

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*

Probab=95.71  E-value=0.0034  Score=39.83  Aligned_cols=22  Identities=14%  Similarity=0.108  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|+|.|..+|||||+.+.+.--
T Consensus         8 ~I~l~G~~GsGKsT~~~~L~~~   29 (194)
T 1qf9_A            8 VVFVLGGPGSGKGTQCANIVRD   29 (194)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            5789999999999999887653

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}

Probab=95.70  E-value=0.0035  Score=40.13  Aligned_cols=24  Identities=21%  Similarity=0.181  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-+++.|..+|||||+.+.+.--.
T Consensus         6 ~~I~l~G~~GsGKST~~~~L~~~l   29 (193)
T 2rhm_A            6 ALIIVTGHPATGKTTLSQALATGL   29 (193)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHc
Confidence            457899999999999999886543

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}

Probab=95.70  E-value=0.0036  Score=44.03  Aligned_cols=23  Identities=17%  Similarity=0.023  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        35 ~~~liG~nGsGKSTLl~~i~Gl~   57 (266)
T 2yz2_A           35 CLLVAGNTGSGKSTLLQIVAGLI   57 (266)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCcHHHHHHHHhCCC
Confidence            46799999999999999988653

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}

Probab=95.69  E-value=0.0038  Score=42.22  Aligned_cols=23  Identities=13%  Similarity=-0.041  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        25 ~~~lvGpsGsGKSTLl~~L~g~~   47 (218)
T 1z6g_A           25 PLVICGPSGVGKGTLIKKLLNEF   47 (218)
T ss_dssp             CEEEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEEECCCCCCHHHHHHHHHhhC
Confidence            57899999999999999987654

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*

Probab=95.69  E-value=0.0037  Score=42.55  Aligned_cols=25  Identities=8%  Similarity=-0.065  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.-+-|.|..+|||||+++.++-.-
T Consensus        25 g~iigI~G~~GsGKSTl~k~L~~~l   49 (245)
T 2jeo_A           25 PFLIGVSGGTASGKSTVCEKIMELL   49 (245)
T ss_dssp             SEEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHh
Confidence            3458899999999999999887643

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12

Probab=95.69  E-value=0.0037  Score=43.64  Aligned_cols=22  Identities=18%  Similarity=0.031  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        26 ~~~liG~nGsGKSTLl~~l~Gl   47 (240)
T 2onk_A           26 YCVLLGPTGAGKSVFLELIAGI   47 (240)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4679999999999999998865

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12

Probab=95.69  E-value=0.0036  Score=44.01  Aligned_cols=22  Identities=9%  Similarity=-0.044  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||+++.++-.
T Consensus        34 ~~~liG~nGsGKSTLlk~l~Gl   55 (262)
T 1b0u_A           34 VISIIGSSGSGKSTFLRCINFL   55 (262)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4679999999999999998865

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*

Probab=95.68  E-value=0.0037  Score=42.97  Aligned_cols=23  Identities=13%  Similarity=-0.060  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.|+|..+|||||+++.++-.-
T Consensus        18 ii~l~GpsGsGKSTLlk~L~g~~   40 (219)
T 1s96_A           18 LYIVSAPSGAGKSSLIQALLKTQ   40 (219)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHHS
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            56899999999999999987543

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}

Probab=95.68  E-value=0.0037  Score=44.31  Aligned_cols=23  Identities=22%  Similarity=0.184  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        32 ~~~i~G~NGsGKSTLlk~l~Gl~   54 (263)
T 2pjz_A           32 KVIILGPNGSGKTTLLRAISGLL   54 (263)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            57899999999999999998664

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1

Probab=95.68  E-value=0.0039  Score=40.66  Aligned_cols=24  Identities=13%  Similarity=0.171  Sum_probs=20.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...++|.|..+|||||+.+.+.--
T Consensus        10 ~~~I~l~G~~GsGKSTv~~~La~~   33 (184)
T 1y63_A           10 GINILITGTPGTGKTSMAEMIAAE   33 (184)
T ss_dssp             SCEEEEECSTTSSHHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHh
Confidence            346899999999999999987654

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}

Probab=95.67  E-value=0.004  Score=39.64  Aligned_cols=21  Identities=14%  Similarity=0.001  Sum_probs=18.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|.|..+|||||+++.+.-
T Consensus         2 ~I~l~G~~GsGKsT~~~~L~~   22 (195)
T 2pbr_A            2 LIAFEGIDGSGKTTQAKKLYE   22 (195)
T ss_dssp             EEEEECSTTSCHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999988754

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}

Probab=95.66  E-value=0.005  Score=39.16  Aligned_cols=29  Identities=7%  Similarity=0.064  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhhhhccccee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..|+|.|..+|||||+.+.+.--...|..
T Consensus         6 ~~I~l~G~~GsGKST~a~~La~~l~~~~i   34 (183)
T 2vli_A            6 PIIWINGPFGVGKTHTAHTLHERLPGSFV   34 (183)
T ss_dssp             CEEEEECCC----CHHHHHHHHHSTTCEE
T ss_pred             eEEEEECCCCCCHHHHHHHHHHhcCCCEE
Confidence            35789999999999999998765555544

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}

Probab=95.64  E-value=0.0042  Score=40.14  Aligned_cols=23  Identities=13%  Similarity=-0.006  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -++|.|..+|||||++++++-..
T Consensus        38 ~~~l~G~~G~GKTtL~~~i~~~~   60 (149)
T 2kjq_A           38 FIYVWGEEGAGKSHLLQAWVAQA   60 (149)
T ss_dssp             EEEEESSSTTTTCHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Confidence            57899999999999999988654

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*

Probab=95.64  E-value=0.0041  Score=40.92  Aligned_cols=25  Identities=16%  Similarity=-0.007  Sum_probs=20.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.-+.|.|..+|||||+++.+.-..
T Consensus        25 g~~i~l~G~sGsGKSTl~~~La~~l   49 (200)
T 3uie_A           25 GCVIWVTGLSGSGKSTLACALNQML   49 (200)
T ss_dssp             CEEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHHHHHHH
Confidence            3457889999999999999886543

>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A*

Probab=95.62  E-value=0.0032  Score=44.98  Aligned_cols=24  Identities=17%  Similarity=0.117  Sum_probs=20.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -.+++.|+|..++|||||++.++.
T Consensus        17 ~~~~I~lvG~nG~GKSTLl~~L~g   40 (301)
T 2qnr_A           17 FEFTLMVVGESGLGKSTLINSLFL   40 (301)
T ss_dssp             -CEEEEEEEETTSSHHHHHHHHHC
T ss_pred             CCEEEEEECCCCCCHHHHHHHHhC
Confidence            357889999999999999999764

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*

Probab=95.62  E-value=0.0058  Score=41.31  Aligned_cols=26  Identities=19%  Similarity=0.203  Sum_probs=22.5

Q ss_pred             eeeccCCCccchhhhhhhhhhcccce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ++|.|..++||||++++++-....|.
T Consensus        52 ~ll~G~~G~GKTtl~~~i~~~~~~~~   77 (254)
T 1ixz_A           52 VLLVGPPGVGKTHLARAVAGEARVPF   77 (254)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHTTCCE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCE
Confidence            89999999999999999997665443

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*

Probab=95.61  E-value=0.004  Score=46.05  Aligned_cols=22  Identities=18%  Similarity=0.070  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+++.|..+|||||++++++-.
T Consensus       125 ~i~I~GptGSGKTTlL~~l~g~  146 (356)
T 3jvv_A          125 LVLVTGPTGSGKSTTLAAMLDY  146 (356)
T ss_dssp             EEEEECSTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHhc
Confidence            6899999999999999988643

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*

Probab=95.61  E-value=0.0041  Score=44.10  Aligned_cols=23  Identities=13%  Similarity=0.004  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        52 i~~liG~NGsGKSTLlk~l~Gl~   74 (263)
T 2olj_A           52 VVVVIGPSGSGKSTFLRCLNLLE   74 (263)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSS
T ss_pred             EEEEEcCCCCcHHHHHHHHHcCC
Confidence            46799999999999999988653

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}

Probab=95.61  E-value=0.0042  Score=41.40  Aligned_cols=22  Identities=14%  Similarity=-0.005  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||+++.++-.
T Consensus        10 ~i~l~GpsGsGKsTl~~~L~~~   31 (208)
T 3tau_A           10 LIVLSGPSGVGKGTVREAVFKD   31 (208)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHS
T ss_pred             EEEEECcCCCCHHHHHHHHHhh
Confidence            3678899999999999988754

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C

Probab=95.60  E-value=0.0041  Score=43.66  Aligned_cols=23  Identities=17%  Similarity=0.072  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        28 ~~~liG~NGsGKSTLlk~l~Gl~   50 (249)
T 2qi9_C           28 ILHLVGPNGAGKSTLLARMAGMT   50 (249)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCcHHHHHHHHhCCC
Confidence            46899999999999999987653

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*

Probab=95.60  E-value=0.0053  Score=44.14  Aligned_cols=38  Identities=11%  Similarity=0.031  Sum_probs=26.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeEEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVEIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~~~~~~~   75 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++   .||++.|
T Consensus        66 ~~~i~G~NGsGKSTLlk~l~Gl~~p~~G~I~~~g---~i~~v~Q  106 (290)
T 2bbs_A           66 LLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG---RISFCSQ  106 (290)
T ss_dssp             EEEEEESTTSSHHHHHHHHTTSSCEEEEEEECCS---CEEEECS
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCCCCCcEEEECC---EEEEEeC
Confidence            56899999999999999987653   22234443   3566554

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*

Probab=95.60  E-value=0.0044  Score=39.09  Aligned_cols=26  Identities=8%  Similarity=0.068  Sum_probs=20.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      .|+|.|..+|||||+.+.+.--..-|
T Consensus         4 ~I~l~G~~GsGKsT~a~~La~~lg~~   29 (173)
T 1e6c_A            4 PIFMVGARGCGMTTVGRELARALGYE   29 (173)
T ss_dssp             CEEEESCTTSSHHHHHHHHHHHHTCE
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhCCc
Confidence            57899999999999999876544433

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A

Probab=95.59  E-value=0.0042  Score=43.81  Aligned_cols=22  Identities=18%  Similarity=0.086  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        48 ~~~l~G~NGsGKSTLlk~l~Gl   69 (267)
T 2zu0_C           48 VHAIMGPNGSGKSTLSATLAGR   69 (267)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTC
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4679999999999999998875

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*

Probab=95.57  E-value=0.0046  Score=42.31  Aligned_cols=23  Identities=17%  Similarity=0.144  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .|+++|+++|||+|..+.++--.
T Consensus         2 ~Iil~GpPGsGKgTqa~~La~~~   24 (206)
T 3sr0_A            2 ILVFLGPPGAGKGTQAKRLAKEK   24 (206)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Confidence            58999999999999998877543

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11

Probab=95.56  E-value=0.0045  Score=40.83  Aligned_cols=21  Identities=14%  Similarity=0.203  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -++|+|.++||||||+++++.
T Consensus        26 ~~~i~G~~GsGKTtl~~~l~~   46 (243)
T 1n0w_A           26 ITEMFGEFRTGKTQICHTLAV   46 (243)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHHHHH
Confidence            468999999999999999887

>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens}

Probab=95.55  E-value=0.0041  Score=44.75  Aligned_cols=24  Identities=17%  Similarity=0.257  Sum_probs=21.3

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|...+|||||+.+++.
T Consensus       164 ~~~kI~ivG~~~vGKSsLl~~l~~  187 (329)
T 3o47_A          164 KEMRILMVGLDAAGKTTILYKLKL  187 (329)
T ss_dssp             CSEEEEEEESTTSSHHHHHHHTCS
T ss_pred             CcceEEEECCCCccHHHHHHHHhC
Confidence            467999999999999999998863

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}

Probab=95.55  E-value=0.0044  Score=43.45  Aligned_cols=23  Identities=17%  Similarity=-0.002  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        33 ~~~l~G~nGsGKSTLl~~l~Gl~   55 (253)
T 2nq2_C           33 ILAVLGQNGCGKSTLLDLLLGIH   55 (253)
T ss_dssp             EEEEECCSSSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            46799999999999999987653

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}

Probab=95.54  E-value=0.0047  Score=39.55  Aligned_cols=25  Identities=16%  Similarity=0.203  Sum_probs=20.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      .|+|.|..+|||||+.+.+.--..-
T Consensus         7 ~i~l~G~~GsGKst~a~~La~~l~~   31 (185)
T 3trf_A            7 NIYLIGLMGAGKTSVGSQLAKLTKR   31 (185)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHHCC
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhCC
Confidence            5789999999999999988654433

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}

Probab=95.53  E-value=0.0045  Score=43.77  Aligned_cols=22  Identities=9%  Similarity=-0.019  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        39 ~~~liG~nGsGKSTLl~~l~Gl   60 (266)
T 4g1u_C           39 MVAIIGPNGAGKSTLLRLLTGY   60 (266)
T ss_dssp             EEEEECCTTSCHHHHHHHHTSS
T ss_pred             EEEEECCCCCcHHHHHHHHhcC
Confidence            4679999999999999998854

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}

Probab=95.52  E-value=0.0046  Score=43.43  Aligned_cols=23  Identities=17%  Similarity=0.005  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+.|+|..+|||||+++.++-..
T Consensus        48 ~~~i~G~nGsGKSTLl~~l~Gl~   70 (260)
T 2ghi_A           48 TCALVGHTGSGKSTIAKLLYRFY   70 (260)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTSS
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            57899999999999999988664

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A

Probab=95.52  E-value=0.0044  Score=44.99  Aligned_cols=23  Identities=9%  Similarity=0.017  Sum_probs=20.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .++++|..+|||||++++++-.-
T Consensus       173 ~v~i~G~~GsGKTTll~~l~g~~  195 (330)
T 2pt7_A          173 NVIVCGGTGSGKTTYIKSIMEFI  195 (330)
T ss_dssp             CEEEEESTTSCHHHHHHHGGGGS
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            67999999999999999987653

>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens}

Probab=95.51  E-value=0.0047  Score=42.47  Aligned_cols=27  Identities=4%  Similarity=-0.114  Sum_probs=23.9

Q ss_pred             hhhCccceeeccCC---------Cccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEY---------FSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaG---------ESGKST~~~~~~~   55 (76)
                      .....+|++++|.+         .+|||||+.+++-
T Consensus        15 ~~~~~~ki~lvG~~~~~~~~~~~~vGKSsLi~~l~~   50 (255)
T 3c5h_A           15 YFQGTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVR   50 (255)
T ss_dssp             SCCSCEEEEEEESCCCTTTTTTCCCSHHHHHHHHHC
T ss_pred             CCCceeEEEEECCCccccccCCCCcCHHHHHHHHHh
Confidence            34567999999999         9999999999985

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}

Probab=95.50  E-value=0.0047  Score=44.06  Aligned_cols=22  Identities=18%  Similarity=0.027  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        49 ~~~liG~NGsGKSTLlk~l~Gl   70 (279)
T 2ihy_A           49 KWILYGLNGAGKTTLLNILNAY   70 (279)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCcHHHHHHHHhCC
Confidence            4689999999999999998865

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*

Probab=95.49  E-value=0.0045  Score=40.63  Aligned_cols=24  Identities=13%  Similarity=-0.011  Sum_probs=20.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -..+.+.|..+|||||+++.+.-.
T Consensus        21 ~~~i~i~G~~GsGKSTl~~~L~~~   44 (207)
T 2qt1_A           21 TFIIGISGVTNSGKTTLAKNLQKH   44 (207)
T ss_dssp             CEEEEEEESTTSSHHHHHHHHHTT
T ss_pred             CeEEEEECCCCCCHHHHHHHHHHh
Confidence            346789999999999999988654

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6

Probab=95.49  E-value=0.0045  Score=40.98  Aligned_cols=24  Identities=17%  Similarity=0.002  Sum_probs=20.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..-+.+.|..+|||||+++.+.-
T Consensus        21 ~~~~i~i~G~~GsGKstl~~~l~~   44 (201)
T 1rz3_A           21 GRLVLGIDGLSRSGKTTLANQLSQ   44 (201)
T ss_dssp             SSEEEEEEECTTSSHHHHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHH
Confidence            345688999999999999998865

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}

Probab=95.46  E-value=0.0047  Score=39.66  Aligned_cols=24  Identities=13%  Similarity=0.045  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..+.|.|..+|||||+.+.+.--.
T Consensus        13 ~~I~l~G~~GsGKsT~a~~L~~~l   36 (199)
T 2bwj_A           13 KIIFIIGGPGSGKGTQCEKLVEKY   36 (199)
T ss_dssp             CEEEEEECTTSSHHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHh
Confidence            468999999999999998876543

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}

Probab=95.45  E-value=0.0044  Score=43.09  Aligned_cols=22  Identities=18%  Similarity=0.113  Sum_probs=18.3

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      |+|+|+++|||+|..+.++---
T Consensus        32 I~llGpPGsGKgTqa~~L~~~~   53 (217)
T 3umf_A           32 IFVLGGPGSGKGTQCEKLVQKF   53 (217)
T ss_dssp             EEEECCTTCCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            5678999999999998877543

>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A*

Probab=95.43  E-value=0.0053  Score=43.38  Aligned_cols=23  Identities=13%  Similarity=0.027  Sum_probs=21.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|+.|+|.+.+||||++.+++-
T Consensus         3 ~~kI~lvG~~nvGKSTL~n~L~g   25 (272)
T 3b1v_A            3 MTEIALIGNPNSGKTSLFNLITG   25 (272)
T ss_dssp             CEEEEEECCTTSSHHHHHHHHHC
T ss_pred             ceEEEEECCCCCCHHHHHHHHHC
Confidence            57999999999999999999974

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A

Probab=95.42  E-value=0.0074  Score=39.41  Aligned_cols=29  Identities=21%  Similarity=0.325  Sum_probs=23.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ....|+|.|..+|||||+.+.+.--..-|
T Consensus        19 ~~~~I~l~G~~GsGKST~a~~La~~l~~~   47 (201)
T 2cdn_A           19 SHMRVLLLGPPGAGKGTQAVKLAEKLGIP   47 (201)
T ss_dssp             SCCEEEEECCTTSSHHHHHHHHHHHHTCC
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHHHhCCc
Confidence            34578999999999999999887654444

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*

Probab=95.41  E-value=0.0059  Score=41.72  Aligned_cols=27  Identities=7%  Similarity=-0.021  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +...|.|.|..+|||||+++.+.-.-.
T Consensus        21 ~~~iI~I~G~~GSGKST~a~~L~~~lg   47 (252)
T 1uj2_A           21 EPFLIGVSGGTASGKSSVCAKIVQLLG   47 (252)
T ss_dssp             CCEEEEEECSTTSSHHHHHHHHHHHTT
T ss_pred             CcEEEEEECCCCCCHHHHHHHHHHHhh
Confidence            345789999999999999988765433

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A

Probab=95.41  E-value=0.0053  Score=42.52  Aligned_cols=21  Identities=14%  Similarity=0.214  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|..+|||||+.++++--
T Consensus         4 i~I~G~~GSGKSTla~~La~~   24 (253)
T 2ze6_A            4 HLIYGPTCSGKTDMAIQIAQE   24 (253)
T ss_dssp             EEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCcCHHHHHHHHHhc
Confidence            578999999999999988643

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A

Probab=95.40  E-value=0.0051  Score=39.43  Aligned_cols=27  Identities=11%  Similarity=0.038  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +...|.|.|..+|||||+.+.+.--..
T Consensus         8 ~~~~I~l~G~~GsGKsT~~~~La~~l~   34 (196)
T 2c95_A            8 KTNIIFVVGGPGSGKGTQCEKIVQKYG   34 (196)
T ss_dssp             TSCEEEEEECTTSSHHHHHHHHHHHHC
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHhC
Confidence            345689999999999999998865433

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*

Probab=95.39  E-value=0.0057  Score=39.28  Aligned_cols=23  Identities=22%  Similarity=0.096  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+.|.|..+|||||+++.+.-.
T Consensus         6 ~~i~l~G~~GsGKST~~~~L~~~   28 (179)
T 2pez_A            6 CTVWLTGLSGAGKTTVSMALEEY   28 (179)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            35789999999999999988654

>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A*

Probab=95.37  E-value=0.0058  Score=43.38  Aligned_cols=23  Identities=26%  Similarity=0.232  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++|+|.+.+||||++.+++.
T Consensus         3 ~~KI~lvG~~~vGKSSLi~~l~~   25 (307)
T 3r7w_A            3 GSKLLLMGRSGSGKSSMRSIIFS   25 (307)
T ss_dssp             EEEEEEECCTTSSHHHHHHHHHS
T ss_pred             ceEEEEECCCCCCHHHHHHHHHh
Confidence            57999999999999999998653

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A

Probab=95.36  E-value=0.0052  Score=42.51  Aligned_cols=21  Identities=14%  Similarity=0.004  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -++|.|.++||||||+++++.
T Consensus        32 i~~i~G~~GsGKTtl~~~l~~   52 (279)
T 1nlf_A           32 VGALVSPGGAGKSMLALQLAA   52 (279)
T ss_dssp             EEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHHHH
Confidence            468899999999999999884

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*

Probab=95.36  E-value=0.0059  Score=38.74  Aligned_cols=28  Identities=18%  Similarity=0.081  Sum_probs=21.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .-++|.|..+|||||+.+.+.--..-|.
T Consensus         8 ~~i~l~G~~GsGKSTva~~La~~lg~~~   35 (168)
T 1zuh_A            8 QHLVLIGFMGSGKSSLAQELGLALKLEV   35 (168)
T ss_dssp             CEEEEESCTTSSHHHHHHHHHHHHTCCE
T ss_pred             ceEEEECCCCCCHHHHHHHHHHHhCCCE
Confidence            3578999999999999998765444443

>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A*

Probab=95.36  E-value=0.0057  Score=42.77  Aligned_cols=24  Identities=21%  Similarity=0.151  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+++.|+|...+||||++.+++-
T Consensus         2 ~~~~I~lvG~~n~GKSTLin~l~g   25 (274)
T 3i8s_A            2 KKLTIGLIGNPNSGKTTLFNQLTG   25 (274)
T ss_dssp             CCEEEEEEECTTSSHHHHHHHHHT
T ss_pred             CccEEEEECCCCCCHHHHHHHHhC
Confidence            357999999999999999999864

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*

Probab=95.34  E-value=0.0057  Score=44.26  Aligned_cols=24  Identities=8%  Similarity=-0.004  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-+.++|..+|||||+++.++-.-
T Consensus        91 ~ivgI~G~sGsGKSTL~~~L~gll  114 (312)
T 3aez_A           91 FIIGVAGSVAVGKSTTARVLQALL  114 (312)
T ss_dssp             EEEEEECCTTSCHHHHHHHHHHHH
T ss_pred             EEEEEECCCCchHHHHHHHHHhhc
Confidence            457899999999999999988754

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}

Probab=95.32  E-value=0.006  Score=40.71  Aligned_cols=27  Identities=15%  Similarity=0.034  Sum_probs=21.9

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ..|+|.|..+|||||+.+.+.--..-|
T Consensus         6 ~~I~l~G~~GsGKsT~a~~La~~l~~~   32 (217)
T 3be4_A            6 HNLILIGAPGSGKGTQCEFIKKEYGLA   32 (217)
T ss_dssp             CEEEEEECTTSSHHHHHHHHHHHHCCE
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHhCce
Confidence            578999999999999999886544433

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=95.32  E-value=0.0058  Score=46.25  Aligned_cols=24  Identities=21%  Similarity=0.198  Sum_probs=21.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+++.|+|..++|||||++.++-.
T Consensus        31 sf~I~lvG~sGaGKSTLln~L~g~   54 (418)
T 2qag_C           31 EFTLMVVGESGLGKSTLINSLFLT   54 (418)
T ss_dssp             CEEEEEECCTTSSHHHHHHHHTTC
T ss_pred             CEEEEEECCCCCcHHHHHHHHhCC
Confidence            457899999999999999999854

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}

Probab=95.30  E-value=0.0054  Score=44.88  Aligned_cols=25  Identities=20%  Similarity=0.107  Sum_probs=21.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .--.+++.|..+|||||++++++-.
T Consensus       174 ~G~~i~ivG~sGsGKSTll~~l~~~  198 (361)
T 2gza_A          174 LERVIVVAGETGSGKTTLMKALMQE  198 (361)
T ss_dssp             TTCCEEEEESSSSCHHHHHHHHHTT
T ss_pred             cCCEEEEECCCCCCHHHHHHHHHhc
Confidence            3347899999999999999998754

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20

Probab=95.30  E-value=0.0094  Score=41.07  Aligned_cols=26  Identities=19%  Similarity=0.203  Sum_probs=22.5

Q ss_pred             eeeccCCCccchhhhhhhhhhcccce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ++|.|..+|||||++++++-....|.
T Consensus        76 vll~Gp~GtGKTtl~~~i~~~~~~~~  101 (278)
T 1iy2_A           76 VLLVGPPGVGKTHLARAVAGEARVPF  101 (278)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHTTCCE
T ss_pred             EEEECCCcChHHHHHHHHHHHcCCCE
Confidence            89999999999999999987665443

>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A

Probab=95.29  E-value=0.0095  Score=42.94  Aligned_cols=31  Identities=10%  Similarity=0.121  Sum_probs=25.8

Q ss_pred             hCccceeeccCCCccchhhhhhhh----------hhcccce
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC----------TTTSKPM   61 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~----------~~~~~~~   61 (76)
                      ....++.++|...+|||||+.+++          ++|..|.
T Consensus        29 ~~~~~I~vvG~~~~GKSSLln~L~g~~~~p~~~~~~t~~p~   69 (353)
T 2x2e_A           29 LDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPL   69 (353)
T ss_dssp             CCCCEEEEECBTTSSHHHHHHTTTTSCCSCCCSSSCCCSCE
T ss_pred             CCCCeEEEECCCCCCHHHHHHHHhCCCcCCCCCCcccccce
Confidence            456799999999999999999986          4566675

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*

Probab=95.28  E-value=0.0059  Score=40.81  Aligned_cols=26  Identities=15%  Similarity=0.089  Sum_probs=21.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -..|+|.|..+|||||+++.+.--..
T Consensus         7 ~~~I~l~G~~GsGKsT~a~~La~~l~   32 (227)
T 1zd8_A            7 LLRAVIMGAPGSGKGTVSSRITTHFE   32 (227)
T ss_dssp             CCEEEEEECTTSSHHHHHHHHHHHSS
T ss_pred             CcEEEEECCCCCCHHHHHHHHHHHcC
Confidence            35789999999999999998864433

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*

Probab=95.24  E-value=0.0061  Score=39.59  Aligned_cols=23  Identities=17%  Similarity=0.026  Sum_probs=19.7

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -..|.|.|..+|||||+.+.+.-
T Consensus        10 ~~~I~l~G~~GsGKST~~~~L~~   32 (212)
T 2wwf_A           10 GKFIVFEGLDRSGKSTQSKLLVE   32 (212)
T ss_dssp             SCEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCEEEEEcCCCCCHHHHHHHHHH
Confidence            45689999999999999998764

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*

Probab=95.24  E-value=0.0062  Score=46.02  Aligned_cols=35  Identities=14%  Similarity=0.139  Sum_probs=24.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeE
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVE   69 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~   69 (76)
                      -++++|..+|||||+++++.-.-   +.-+.+....+|
T Consensus       169 ii~I~GpnGSGKTTlL~allg~l~~~~g~I~~~ed~ie  206 (418)
T 1p9r_A          169 IILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIE  206 (418)
T ss_dssp             EEEEECSTTSCHHHHHHHHHHHHCCTTSCEEEEESSCC
T ss_pred             eEEEECCCCCCHHHHHHHHHhhcCCCCCEEEEecccch
Confidence            47999999999999999986543   233445444444

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*

Probab=95.23  E-value=0.006  Score=42.32  Aligned_cols=22  Identities=0%  Similarity=-0.203  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++|+|..+||||||+++++-.
T Consensus        37 ~~~i~G~~G~GKTTl~~~ia~~   58 (296)
T 1cr0_A           37 VIMVTSGSGMGKSTFVRQQALQ   58 (296)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHHH
Confidence            4688999999999999988754

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*

Probab=95.22  E-value=0.007  Score=39.39  Aligned_cols=23  Identities=13%  Similarity=0.073  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..|+|.|..+|||||+.+.+.--
T Consensus        16 ~~I~l~G~~GsGKsT~~~~L~~~   38 (203)
T 1ukz_A           16 SVIFVLGGPGAGKGTQCEKLVKD   38 (203)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            46789999999999999887643

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*

Probab=95.22  E-value=0.0059  Score=43.42  Aligned_cols=23  Identities=9%  Similarity=0.037  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-+-|+|..+|||||+++.++-.
T Consensus        81 ~iigI~G~~GsGKSTl~~~L~~~  103 (308)
T 1sq5_A           81 YIISIAGSVAVGKSTTARVLQAL  103 (308)
T ss_dssp             EEEEEEECTTSSHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCHHHHHHHHHHH
Confidence            46789999999999999988864

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*

Probab=95.21  E-value=0.0067  Score=39.16  Aligned_cols=22  Identities=18%  Similarity=0.046  Sum_probs=19.3

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      .++.|..+|||||++.|+|...
T Consensus        26 ~~I~G~NGsGKStil~Ai~~~l   47 (149)
T 1f2t_A           26 NLIIGQNGSGKSSLLDAILVGL   47 (149)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            4788999999999999998654

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}

Probab=95.20  E-value=0.0071  Score=39.04  Aligned_cols=24  Identities=21%  Similarity=0.072  Sum_probs=20.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..-++|.|..+|||||+++.+.-.
T Consensus        13 ~~~i~l~G~~GsGKsT~~~~L~~~   36 (186)
T 2yvu_A           13 GIVVWLTGLPGSGKTTIATRLADL   36 (186)
T ss_dssp             CEEEEEECCTTSSHHHHHHHHHHH
T ss_pred             CcEEEEEcCCCCCHHHHHHHHHHH
Confidence            456889999999999999988644

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1

Probab=95.18  E-value=0.0071  Score=38.92  Aligned_cols=24  Identities=17%  Similarity=0.032  Sum_probs=20.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+.|.|..+|||||+.+.+.--
T Consensus         8 ~~~I~i~G~~GsGKST~~~~La~~   31 (203)
T 1uf9_A            8 PIIIGITGNIGSGKSTVAALLRSW   31 (203)
T ss_dssp             CEEEEEEECTTSCHHHHHHHHHHT
T ss_pred             ceEEEEECCCCCCHHHHHHHHHHC
Confidence            456899999999999999987643

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*

Probab=95.17  E-value=0.0076  Score=39.13  Aligned_cols=24  Identities=17%  Similarity=0.131  Sum_probs=20.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +-..|.|.|..+|||||+++.+.-
T Consensus         8 ~~~~I~l~G~~GsGKsT~~~~L~~   31 (215)
T 1nn5_A            8 RGALIVLEGVDRAGKSTQSRKLVE   31 (215)
T ss_dssp             CCCEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHH
Confidence            345689999999999999998864

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*

Probab=95.16  E-value=0.0075  Score=40.58  Aligned_cols=22  Identities=14%  Similarity=0.117  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|++.|..+|||||+.+.+.--
T Consensus         2 ~I~l~G~~GsGKsT~a~~La~~   23 (223)
T 2xb4_A            2 NILIFGPNGSGKGTQGNLVKDK   23 (223)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            5789999999999999987643

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}

Probab=95.14  E-value=0.0083  Score=43.70  Aligned_cols=23  Identities=9%  Similarity=-0.119  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+.|+|..+||||||+.++.-
T Consensus        74 ~~~v~lvG~pgaGKSTLln~L~~   96 (349)
T 2www_A           74 AFRVGLSGPPGAGKSTFIEYFGK   96 (349)
T ss_dssp             CEEEEEECCTTSSHHHHHHHHHH
T ss_pred             ceEEEEEcCCCCCHHHHHHHHHH
Confidence            67899999999999999999874

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*

Probab=95.13  E-value=0.0079  Score=38.83  Aligned_cols=24  Identities=8%  Similarity=0.112  Sum_probs=19.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -..|.|.|..+|||||+++.+.--
T Consensus         4 ~~~I~l~G~~GsGKsT~~~~L~~~   27 (204)
T 2v54_A            4 GALIVFEGLDKSGKTTQCMNIMES   27 (204)
T ss_dssp             CCEEEEECCTTSSHHHHHHHHHHT
T ss_pred             CcEEEEEcCCCCCHHHHHHHHHHH
Confidence            346899999999999999887643

>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A

Probab=95.12  E-value=0.02  Score=42.15  Aligned_cols=23  Identities=17%  Similarity=0.081  Sum_probs=19.9

Q ss_pred             ccc-eeeccCCCccchhhhhhhhh
Q psy6625          33 DIK-LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evK-LLLLGaGESGKST~~~~~~~   55 (76)
                      .++ +.++|...+||||++++++-
T Consensus       178 ~~~~V~lvG~~naGKSTLln~L~~  201 (364)
T 2qtf_A          178 NIPSIGIVGYTNSGKTSLFNSLTG  201 (364)
T ss_dssp             -CCEEEEECBTTSSHHHHHHHHHC
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHC
Confidence            566 88999999999999999874

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}

Probab=95.11  E-value=0.008  Score=40.59  Aligned_cols=25  Identities=8%  Similarity=0.017  Sum_probs=20.9

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.-|.|.|..+|||||+.+.+.--
T Consensus        11 ~~~iIgltG~~GSGKSTva~~L~~~   35 (192)
T 2grj_A           11 HHMVIGVTGKIGTGKSTVCEILKNK   35 (192)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHHH
T ss_pred             cceEEEEECCCCCCHHHHHHHHHHh
Confidence            4677889999999999999887543

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A

Probab=95.11  E-value=0.0075  Score=41.60  Aligned_cols=21  Identities=14%  Similarity=-0.004  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+++.|..+|||||+.+.+.-
T Consensus         4 ~I~l~G~~GsGKST~a~~L~~   24 (301)
T 1ltq_A            4 IILTIGCPGSGKSTWAREFIA   24 (301)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999998865

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*

Probab=95.09  E-value=0.0075  Score=44.43  Aligned_cols=23  Identities=13%  Similarity=0.008  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+++.|..+|||||+++++.-.
T Consensus       137 ~~i~ivG~~GsGKTTll~~l~~~  159 (372)
T 2ewv_A          137 GLILVTGPTGSGKSTTIASMIDY  159 (372)
T ss_dssp             EEEEEECSSSSSHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHhh
Confidence            35899999999999999998753

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}

Probab=95.08  E-value=0.0072  Score=39.82  Aligned_cols=21  Identities=19%  Similarity=0.050  Sum_probs=17.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      =+++.|.++||||||+.+++.
T Consensus        25 ~~~i~G~~GsGKTtl~~~~~~   45 (247)
T 2dr3_A           25 VVLLSGGPGTGKTIFSQQFLW   45 (247)
T ss_dssp             EEEEEECTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            368899999999999887764

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*

Probab=95.07  E-value=0.0085  Score=42.46  Aligned_cols=23  Identities=22%  Similarity=0.091  Sum_probs=19.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -.-++|.|.++|||||+++.+.-
T Consensus        33 ~~livl~G~sGsGKSTla~~L~~   55 (287)
T 1gvn_B           33 PTAFLLGGQPGSGKTSLRSAIFE   55 (287)
T ss_dssp             CEEEEEECCTTSCTHHHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            34578899999999999998864

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*

Probab=95.05  E-value=0.0079  Score=43.91  Aligned_cols=23  Identities=13%  Similarity=0.067  Sum_probs=19.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      --.+.|+|..+||||||++.+.-
T Consensus       126 Ge~vaIvGpsGsGKSTLl~lL~g  148 (305)
T 2v9p_A          126 KNCLAFIGPPNTGKSMLCNSLIH  148 (305)
T ss_dssp             CSEEEEECSSSSSHHHHHHHHHH
T ss_pred             CCEEEEECCCCCcHHHHHHHHhh
Confidence            34678999999999999999873

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}

Probab=95.02  E-value=0.012  Score=41.37  Aligned_cols=25  Identities=16%  Similarity=0.139  Sum_probs=21.7

Q ss_pred             eeeccCCCccchhhhhhhhhhcccc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      +||.|..++||||++++++-....+
T Consensus        47 vlL~Gp~GtGKTtLakala~~~~~~   71 (274)
T 2x8a_A           47 VLLAGPPGCGKTLLAKAVANESGLN   71 (274)
T ss_dssp             EEEESSTTSCHHHHHHHHHHHTTCE
T ss_pred             EEEECCCCCcHHHHHHHHHHHcCCC
Confidence            8999999999999999998765443

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1

Probab=95.02  E-value=0.0088  Score=39.73  Aligned_cols=23  Identities=17%  Similarity=0.170  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..|+|.|..+|||||+.+.+.--
T Consensus         6 ~~I~l~G~~GsGKsT~~~~La~~   28 (222)
T 1zak_A            6 LKVMISGAPASGKGTQCELIKTK   28 (222)
T ss_dssp             CCEEEEESTTSSHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            56899999999999999987644

>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A*

Probab=95.00  E-value=0.02  Score=45.45  Aligned_cols=25  Identities=24%  Similarity=0.210  Sum_probs=22.9

Q ss_pred             hhCccceeeccCCCccchhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....++++++|...+|||||+.+++
T Consensus        66 ~~~~~~V~VvG~~naGKSSLlNaLl   90 (695)
T 2j69_A           66 QQGVFRLLVLGDMKRGKSTFLNALI   90 (695)
T ss_dssp             HHCCEEEEEECCTTSCHHHHHHHHH
T ss_pred             ccCCCEEEEECCCCCCHHHHHHHHh
Confidence            4578999999999999999999986

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*

Probab=94.99  E-value=0.0085  Score=41.36  Aligned_cols=23  Identities=17%  Similarity=0.056  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-|++.|..+|||||+.+.+.--
T Consensus         5 ~lIvl~G~pGSGKSTla~~La~~   27 (260)
T 3a4m_A            5 MLIILTGLPGVGKSTFSKNLAKI   27 (260)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEEEEcCCCCCHHHHHHHHHHH
Confidence            35789999999999999988754

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}

Probab=94.99  E-value=0.0076  Score=46.02  Aligned_cols=34  Identities=21%  Similarity=0.435  Sum_probs=27.0

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc----c-cceeeeC
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT----S-KPMMINN   65 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~----~-~~~~~~~   65 (76)
                      .--.+.|+|..+|||||+++.++-..    . .|+.++.
T Consensus       137 ~Ge~v~IvGpnGsGKSTLlr~L~Gl~~p~~G~~pI~vdg  175 (460)
T 2npi_A          137 EGPRVVIVGGSQTGKTSLSRTLCSYALKFNAYQPLYINL  175 (460)
T ss_dssp             SCCCEEEEESTTSSHHHHHHHHHHTTHHHHCCCCEEEEC
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCcccccCCceeEEEcC
Confidence            33478999999999999999988653    3 5677765

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6

Probab=94.96  E-value=0.016  Score=41.49  Aligned_cols=39  Identities=13%  Similarity=0.063  Sum_probs=25.9

Q ss_pred             HHHHHHHhHH-hhhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          19 IEKNLKEDGI-QAAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        19 IDk~L~kekk-~~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.+.+..... ...+...+.+.|..+|||||+++.+.-.-
T Consensus        16 l~~~i~~~~~~~~~~~~ii~I~G~sGsGKSTla~~L~~~l   55 (290)
T 1odf_A           16 LDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHL   55 (290)
T ss_dssp             HHHHHHHHHTTTCCSCEEEEEECCTTSSHHHHHHHHHHHH
T ss_pred             HHHHHHHhhhccCCCCeEEEEECCCCCCHHHHHHHHHHHh
Confidence            4444444322 23345678899999999999998776543

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}

Probab=94.94  E-value=0.031  Score=35.13  Aligned_cols=32  Identities=19%  Similarity=0.152  Sum_probs=25.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      .....-+||.|..++|||+++++++--.. |+.
T Consensus        24 ~~~~~~vll~G~~GtGKt~lA~~i~~~~~-~~~   55 (143)
T 3co5_A           24 AKRTSPVFLTGEAGSPFETVARYFHKNGT-PWV   55 (143)
T ss_dssp             HTCSSCEEEEEETTCCHHHHHGGGCCTTS-CEE
T ss_pred             hCCCCcEEEECCCCccHHHHHHHHHHhCC-CeE
Confidence            34556789999999999999999886554 443

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11

Probab=94.91  E-value=0.0098  Score=40.05  Aligned_cols=22  Identities=9%  Similarity=-0.034  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++.++|..+|||||+++.++-.
T Consensus         3 ~i~i~G~nG~GKTTll~~l~g~   24 (189)
T 2i3b_A            3 HVFLTGPPGVGKTTLIHKASEV   24 (189)
T ss_dssp             CEEEESCCSSCHHHHHHHHHHH
T ss_pred             EEEEECCCCChHHHHHHHHHhh
Confidence            5789999999999999987754

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}

Probab=94.90  E-value=0.0099  Score=45.52  Aligned_cols=22  Identities=23%  Similarity=0.131  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++.|+|..+||||||++.++-.
T Consensus        44 ~vaLvG~nGaGKSTLln~L~G~   65 (427)
T 2qag_B           44 NILCVGETGLGKSTLMDTLFNT   65 (427)
T ss_dssp             EEEEECSTTSSSHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCc
Confidence            4899999999999999998765

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*

Probab=94.89  E-value=0.011  Score=39.82  Aligned_cols=26  Identities=19%  Similarity=0.208  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +...|+|.|..+|||||+.+.+.--.
T Consensus        15 ~~~~I~l~G~~GsGKsT~a~~La~~l   40 (233)
T 1ak2_A           15 KGVRAVLLGPPGAGKGTQAPKLAKNF   40 (233)
T ss_dssp             CCCEEEEECCTTSSHHHHHHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHHHh
Confidence            34578999999999999999886543

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20

Probab=94.86  E-value=0.01  Score=36.67  Aligned_cols=23  Identities=17%  Similarity=0.075  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --+||.|..++||||+++++.--
T Consensus        44 ~~~ll~G~~G~GKT~l~~~~~~~   66 (195)
T 1jbk_A           44 NNPVLIGEPGVGKTAIVEGLAQR   66 (195)
T ss_dssp             CEEEEECCTTSCHHHHHHHHHHH
T ss_pred             CceEEECCCCCCHHHHHHHHHHH
Confidence            35799999999999999887654

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}

Probab=94.86  E-value=0.023  Score=36.86  Aligned_cols=24  Identities=17%  Similarity=0.113  Sum_probs=20.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .-++|.|..++||||++++++--.
T Consensus        55 ~~~~l~G~~GtGKT~la~~i~~~~   78 (202)
T 2w58_A           55 KGLYLHGSFGVGKTYLLAAIANEL   78 (202)
T ss_dssp             CEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHH
Confidence            468999999999999999987644

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A

Probab=94.83  E-value=0.011  Score=39.04  Aligned_cols=22  Identities=18%  Similarity=0.067  Sum_probs=19.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+.|.|..+|||||+++.+.-
T Consensus         5 ~~I~i~G~~GSGKST~~~~L~~   26 (218)
T 1vht_A            5 YIVALTGGIGSGKSTVANAFAD   26 (218)
T ss_dssp             EEEEEECCTTSCHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4578999999999999998864

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20

Probab=94.83  E-value=0.013  Score=39.58  Aligned_cols=28  Identities=14%  Similarity=0.272  Sum_probs=23.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++||||++++++-....|..
T Consensus        47 ~vll~G~~GtGKT~la~~la~~~~~~~~   74 (257)
T 1lv7_A           47 GVLMVGPPGTGKTLLAKAIAGEAKVPFF   74 (257)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHHHTCCEE
T ss_pred             eEEEECcCCCCHHHHHHHHHHHcCCCEE
Confidence            4899999999999999999877665643

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1

Probab=94.80  E-value=0.0092  Score=46.10  Aligned_cols=23  Identities=17%  Similarity=0.157  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -++++|..+|||||++++++-.-
T Consensus       262 ~i~I~GptGSGKTTlL~aL~~~i  284 (511)
T 2oap_1          262 SAIVVGETASGKTTTLNAIMMFI  284 (511)
T ss_dssp             CEEEEESTTSSHHHHHHHHGGGS
T ss_pred             EEEEECCCCCCHHHHHHHHHhhC
Confidence            48999999999999999987544

>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A*

Probab=94.79  E-value=0.028  Score=42.97  Aligned_cols=28  Identities=7%  Similarity=0.018  Sum_probs=23.2

Q ss_pred             HhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          28 IQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        28 k~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..++.+|+.++|...+||||++.+++-
T Consensus       228 ~~~r~~~kV~ivG~~nvGKSSLln~L~~  255 (476)
T 3gee_A          228 RIVSEGVSTVIAGKPNAGKSTLLNTLLG  255 (476)
T ss_dssp             HHHHHCEEEEEECCTTSSHHHHHHHCC-
T ss_pred             HhhcCCCEEEEECCCCCCHHHHHHHHhC
Confidence            3345678999999999999999999863

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}

Probab=94.77  E-value=0.01  Score=44.16  Aligned_cols=32  Identities=16%  Similarity=0.041  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        43 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~i~g~   77 (355)
T 1z47_A           43 MVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK   77 (355)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSSCCSEEEEEETTE
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCccEEEECCE
Confidence            46799999999999999887542   223455543

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*

Probab=94.75  E-value=0.011  Score=39.89  Aligned_cols=24  Identities=13%  Similarity=-0.005  Sum_probs=20.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.-+.+.|..+|||||+++.++-.
T Consensus        20 g~~i~i~G~~GsGKSTl~~~L~~~   43 (230)
T 2vp4_A           20 PFTVLIEGNIGSGKTTYLNHFEKY   43 (230)
T ss_dssp             CEEEEEECSTTSCHHHHHHTTGGG
T ss_pred             ceEEEEECCCCCCHHHHHHHHHhc
Confidence            345789999999999999998765

>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii}

Probab=94.75  E-value=0.044  Score=39.49  Aligned_cols=25  Identities=16%  Similarity=0.017  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+++++|..++||||++.+++-
T Consensus       165 ~~~~~v~lvG~~gvGKSTLin~L~~  189 (357)
T 2e87_A          165 LEIPTVVIAGHPNVGKSTLLKALTT  189 (357)
T ss_dssp             SSSCEEEEECSTTSSHHHHHHHHCS
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhC
Confidence            3568999999999999999999875

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A

Probab=94.75  E-value=0.01  Score=44.17  Aligned_cols=22  Identities=14%  Similarity=0.104  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||+++.++-.
T Consensus        31 ~~~llGpnGsGKSTLLr~iaGl   52 (372)
T 1g29_1           31 FMILLGPSGCGKTTTLRMIAGL   52 (372)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCcHHHHHHHHHHcC
Confidence            4679999999999999988754

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}

Probab=94.74  E-value=0.011  Score=40.75  Aligned_cols=22  Identities=14%  Similarity=-0.061  Sum_probs=19.4

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+.|.|..+|||||+++.+.
T Consensus        27 g~~I~I~G~~GsGKSTl~k~La   48 (252)
T 4e22_A           27 APVITVDGPSGAGKGTLCKALA   48 (252)
T ss_dssp             SCEEEEECCTTSSHHHHHHHHH
T ss_pred             CcEEEEECCCCCCHHHHHHHHH
Confidence            3468999999999999999886

>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila}

Probab=94.72  E-value=0.01  Score=41.33  Aligned_cols=22  Identities=23%  Similarity=0.163  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|+.|+|...||||||+.++.-
T Consensus         2 ~kI~lvG~~n~GKSTL~n~L~g   23 (256)
T 3iby_A            2 THALLIGNPNCGKTTLFNALTN   23 (256)
T ss_dssp             CEEEEEESTTSSHHHHHHHHHT
T ss_pred             CEEEEECCCCCCHHHHHHHHHC
Confidence            3789999999999999999853

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}

Probab=94.70  E-value=0.011  Score=44.06  Aligned_cols=32  Identities=16%  Similarity=0.123  Sum_probs=23.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        31 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~i~g~   65 (362)
T 2it1_A           31 FMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK   65 (362)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTE
T ss_pred             EEEEECCCCchHHHHHHHHhcCCCCCceEEEECCE
Confidence            46799999999999999887543   223455543

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*

Probab=94.66  E-value=0.011  Score=44.14  Aligned_cols=41  Identities=17%  Similarity=0.214  Sum_probs=28.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCcee--------EEeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV--------EIGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~--------~~~~~~~   75 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++..+        .||++.|
T Consensus        39 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~i~g~~i~~~~~~~r~ig~v~Q   90 (372)
T 1v43_A           39 FLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQ   90 (372)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCGGGGTEEEEEC
T ss_pred             EEEEECCCCChHHHHHHHHHcCCCCCceEEEECCEECCCCChhhCcEEEEec
Confidence            46799999999999999887542   23345554332        3666655

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}

Probab=94.66  E-value=0.011  Score=43.91  Aligned_cols=32  Identities=19%  Similarity=0.148  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        31 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~i~g~   65 (359)
T 2yyz_A           31 FVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDV   65 (359)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSSCCSEEEEEETTE
T ss_pred             EEEEEcCCCchHHHHHHHHHCCCCCCccEEEECCE
Confidence            46799999999999999887543   223455543

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*

Probab=94.65  E-value=0.022  Score=37.68  Aligned_cols=23  Identities=17%  Similarity=0.167  Sum_probs=19.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -.-+++.|..+|||||+++.+.-
T Consensus        25 ~~~i~~~G~~GsGKsT~~~~l~~   47 (211)
T 1m7g_A           25 GLTIWLTGLSASGKSTLAVELEH   47 (211)
T ss_dssp             CEEEEEECSTTSSHHHHHHHHHH
T ss_pred             CCEEEEECCCCCCHHHHHHHHHH
Confidence            34578999999999999998764

>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A*

Probab=94.60  E-value=0.034  Score=40.23  Aligned_cols=26  Identities=12%  Similarity=-0.055  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+...+.+.|.+++||||++.++...
T Consensus        77 ~~~~~I~i~G~~G~GKSTl~~~L~~~  102 (355)
T 3p32_A           77 GNAHRVGITGVPGVGKSTAIEALGMH  102 (355)
T ss_dssp             CCSEEEEEECCTTSSHHHHHHHHHHH
T ss_pred             CCceEEEEECCCCCCHHHHHHHHHHH
Confidence            45678999999999999999988644

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}

Probab=94.58  E-value=0.011  Score=44.16  Aligned_cols=34  Identities=15%  Similarity=0.174  Sum_probs=24.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCcee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTV   68 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~   68 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++..+
T Consensus        32 ~~~llGpsGsGKSTLLr~iaGl~~p~~G~I~i~G~~i   68 (359)
T 3fvq_A           32 ILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTI   68 (359)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTSSCCSEEEEEETTEEE
T ss_pred             EEEEECCCCchHHHHHHHHhcCCCCCCcEEEECCEEC
Confidence            36799999999999999887542   33345555433

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=94.55  E-value=0.011  Score=44.82  Aligned_cols=20  Identities=15%  Similarity=0.135  Sum_probs=17.8

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -++|+|..+||||||+++++
T Consensus        41 ~~~l~G~nGsGKSTL~~~~l   60 (525)
T 1tf7_A           41 STLVSGTSGTGKTLFSIQFL   60 (525)
T ss_dssp             EEEEEESTTSSHHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHHH
Confidence            46899999999999999954

>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B*

Probab=94.54  E-value=0.013  Score=40.48  Aligned_cols=24  Identities=8%  Similarity=0.033  Sum_probs=21.2

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....++.++|...+|||||+.+++
T Consensus        22 ~~~~~I~vvG~~~~GKSTlln~l~   45 (315)
T 1jwy_B           22 LDLPQIVVVGSQSSGKSSVLENIV   45 (315)
T ss_dssp             TCCCEEEEEECSSSSHHHHHHHHH
T ss_pred             CCCCeEEEEcCCCCCHHHHHHHHH
Confidence            456789999999999999999984

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*

Probab=94.53  E-value=0.013  Score=37.73  Aligned_cols=22  Identities=9%  Similarity=0.015  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+.|..+|||||+.+.+.-.
T Consensus         4 ~i~i~G~~GsGKst~~~~la~~   25 (208)
T 3ake_A            4 IVTIDGPSASGKSSVARRVAAA   25 (208)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHh
Confidence            4788899999999999987654

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*

Probab=94.52  E-value=0.013  Score=39.43  Aligned_cols=23  Identities=17%  Similarity=0.017  Sum_probs=19.5

Q ss_pred             eeeccCCCccchhhhhhhhhhcc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .++.|..+|||||++.|++....
T Consensus        26 ~~I~G~NgsGKStil~ai~~~l~   48 (203)
T 3qks_A           26 NLIIGQNGSGKSSLLDAILVGLY   48 (203)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHHHHhc
Confidence            47789999999999999986544

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A

Probab=94.48  E-value=0.036  Score=35.83  Aligned_cols=26  Identities=19%  Similarity=0.139  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..--+||.|..++||||++++++--.
T Consensus        51 ~~~~~ll~G~~G~GKT~la~~l~~~~   76 (242)
T 3bos_A           51 GVQAIYLWGPVKSGRTHLIHAACARA   76 (242)
T ss_dssp             SCSEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CCCeEEEECCCCCCHHHHHHHHHHHH
Confidence            34568999999999999999886543

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*

Probab=94.47  E-value=0.047  Score=38.90  Aligned_cols=24  Identities=13%  Similarity=0.084  Sum_probs=20.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -++|.|..++||||++++++-...
T Consensus        53 ~~ll~Gp~G~GKTTLa~~ia~~l~   76 (334)
T 1in4_A           53 HVLLAGPPGLGKTTLAHIIASELQ   76 (334)
T ss_dssp             CEEEESSTTSSHHHHHHHHHHHHT
T ss_pred             eEEEECCCCCcHHHHHHHHHHHhC
Confidence            479999999999999999986543

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*

Probab=94.46  E-value=0.0098  Score=43.25  Aligned_cols=32  Identities=19%  Similarity=0.067  Sum_probs=23.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        82 ~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~G~  116 (306)
T 3nh6_A           82 TLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQ  116 (306)
T ss_dssp             EEEEESSSCHHHHHHHHHHTTSSCCSEEEEEETTE
T ss_pred             EEEEECCCCchHHHHHHHHHcCCCCCCcEEEECCE
Confidence            57899999999999999887543   223455543

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*

Probab=94.41  E-value=0.0063  Score=39.60  Aligned_cols=19  Identities=11%  Similarity=-0.046  Sum_probs=16.9

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.+.|..+|||||+++.+.
T Consensus         3 I~i~G~~GsGKsTl~~~L~   21 (214)
T 1gtv_A            3 IAIEGVDGAGKRTLVEKLS   21 (214)
T ss_dssp             EEEEEEEEEEHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHH
Confidence            6788999999999998874

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A

Probab=94.39  E-value=0.014  Score=43.96  Aligned_cols=22  Identities=5%  Similarity=-0.038  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+-|+|..+|||||+++.+.-.
T Consensus        31 ~~~llGpsGsGKSTLLr~iaGl   52 (381)
T 3rlf_A           31 FVVFVGPSGCGKSTLLRMIAGL   52 (381)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEEcCCCchHHHHHHHHHcC
Confidence            3679999999999999988754

>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A*

Probab=94.37  E-value=0.014  Score=41.95  Aligned_cols=23  Identities=9%  Similarity=-0.036  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      --++.++|...||||||+.+++-
T Consensus        34 lp~I~vvG~~~sGKSSLln~l~g   56 (360)
T 3t34_A           34 LPAIAVVGGQSSGKSSVLESIVG   56 (360)
T ss_dssp             CCEEEEECBTTSSHHHHHHHHHT
T ss_pred             CCEEEEECCCCCcHHHHHHHHhC
Confidence            34889999999999999999875

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12

Probab=94.37  E-value=0.01  Score=43.87  Aligned_cols=33  Identities=9%  Similarity=0.135  Sum_probs=23.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++..
T Consensus        28 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~~~g~~   63 (348)
T 3d31_A           28 YFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKD   63 (348)
T ss_dssp             EEEEECCCTHHHHHHHHHHHTSSCCSEEEEEETTEE
T ss_pred             EEEEECCCCccHHHHHHHHHcCCCCCCcEEEECCEE
Confidence            46799999999999999887543   2234555543

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8

Probab=94.31  E-value=0.015  Score=41.29  Aligned_cols=21  Identities=10%  Similarity=-0.197  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+.|+|..+|||||+++++.-
T Consensus       171 iv~l~G~sG~GKSTll~~l~g  191 (301)
T 1u0l_A          171 ISTMAGLSGVGKSSLLNAINP  191 (301)
T ss_dssp             EEEEECSTTSSHHHHHHHHST
T ss_pred             eEEEECCCCCcHHHHHHHhcc
Confidence            467999999999999998864

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}

Probab=94.28  E-value=0.022  Score=38.77  Aligned_cols=30  Identities=20%  Similarity=0.227  Sum_probs=25.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..-+||.|..++||||++++++--...|..
T Consensus        51 ~~~~ll~G~~GtGKT~la~~la~~~~~~~~   80 (285)
T 3h4m_A           51 PKGILLYGPPGTGKTLLAKAVATETNATFI   80 (285)
T ss_dssp             CSEEEEESSSSSSHHHHHHHHHHHTTCEEE
T ss_pred             CCeEEEECCCCCcHHHHHHHHHHHhCCCEE
Confidence            345899999999999999999887766654

>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A*

Probab=94.27  E-value=0.012  Score=43.29  Aligned_cols=26  Identities=8%  Similarity=0.119  Sum_probs=23.2

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+|+.++|...+|||||+++++-
T Consensus         5 ~~~~~~I~vvG~~~~GKSTLi~~L~~   30 (403)
T 3sjy_A            5 VQPEVNIGVVGHVDHGKTTLVQAITG   30 (403)
T ss_dssp             CCCCCEEEEECSTTSSHHHHHHHHHS
T ss_pred             cCCCcEEEEECCCCCCHHHHHHHHhC
Confidence            34678999999999999999999975

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*

Probab=94.26  E-value=0.044  Score=37.09  Aligned_cols=28  Identities=21%  Similarity=0.204  Sum_probs=23.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhcc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      ....-+||.|..++|||+++++++-...
T Consensus        27 ~~~~~vll~G~~GtGKt~la~~i~~~~~   54 (265)
T 2bjv_A           27 PLDKPVLIIGERGTGKELIASRLHYLSS   54 (265)
T ss_dssp             TSCSCEEEECCTTSCHHHHHHHHHHTST
T ss_pred             CCCCCEEEECCCCCcHHHHHHHHHHhcC
Confidence            3456789999999999999999987653

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}

Probab=94.25  E-value=0.016  Score=42.52  Aligned_cols=23  Identities=13%  Similarity=0.005  Sum_probs=19.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      =+.+.|..+||||||++.+.-.-
T Consensus        94 iigI~GpsGSGKSTl~~~L~~ll  116 (321)
T 3tqc_A           94 IIGIAGSVAVGKSTTSRVLKALL  116 (321)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            47899999999999998876553

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*

Probab=94.22  E-value=0.0097  Score=43.98  Aligned_cols=32  Identities=6%  Similarity=0.100  Sum_probs=23.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      -+.|+|..+|||||+++.++-..   +--+.+++.
T Consensus        33 ~~~llGpnGsGKSTLLr~iaGl~~p~~G~I~i~g~   67 (353)
T 1oxx_K           33 RFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR   67 (353)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTSSCCSEEEEEETTE
T ss_pred             EEEEECCCCCcHHHHHHHHhCCCCCCceEEEECCE
Confidence            46799999999999999887542   223455543

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}

Probab=94.22  E-value=0.069  Score=37.19  Aligned_cols=31  Identities=10%  Similarity=-0.061  Sum_probs=25.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      ..-+||.|..++||||++++++--...|...
T Consensus        55 ~~~vll~G~~GtGKT~la~~ia~~~~~~~~~   85 (338)
T 3pfi_A           55 LDHILFSGPAGLGKTTLANIISYEMSANIKT   85 (338)
T ss_dssp             CCCEEEECSTTSSHHHHHHHHHHHTTCCEEE
T ss_pred             CCeEEEECcCCCCHHHHHHHHHHHhCCCeEE
Confidence            3468999999999999999998877777543

>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X

Probab=94.19  E-value=0.017  Score=40.96  Aligned_cols=23  Identities=9%  Similarity=-0.155  Sum_probs=20.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..++.++|.+.+||||++.+++-
T Consensus         8 ~~~VaIvG~~nvGKSTLln~L~g   30 (301)
T 1ega_A            8 CGFIAIVGRPNVGKSTLLNKLLG   30 (301)
T ss_dssp             EEEEEEECSSSSSHHHHHHHHHT
T ss_pred             CCEEEEECCCCCCHHHHHHHHHC
Confidence            45799999999999999999873

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}

Probab=94.18  E-value=0.037  Score=34.28  Aligned_cols=24  Identities=17%  Similarity=0.092  Sum_probs=20.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .--+||.|..++||||++++++--
T Consensus        43 ~~~vll~G~~G~GKT~la~~~~~~   66 (187)
T 2p65_A           43 KNNPILLGDPGVGKTAIVEGLAIK   66 (187)
T ss_dssp             SCEEEEESCGGGCHHHHHHHHHHH
T ss_pred             CCceEEECCCCCCHHHHHHHHHHH
Confidence            345799999999999999888654

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C

Probab=94.16  E-value=0.017  Score=43.39  Aligned_cols=22  Identities=5%  Similarity=-0.136  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+-|+|..+|||||+++.++-.
T Consensus        56 i~~IiGpnGaGKSTLlr~i~GL   77 (366)
T 3tui_C           56 IYGVIGASGAGKSTLIRCVNLL   77 (366)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEEcCCCchHHHHHHHHhcC
Confidence            3578999999999999988765

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}

Probab=94.15  E-value=0.026  Score=37.60  Aligned_cols=28  Identities=25%  Similarity=0.306  Sum_probs=23.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++||||++++++--...|..
T Consensus        41 ~vll~G~~GtGKT~la~~la~~~~~~~~   68 (262)
T 2qz4_A           41 GALLLGPPGCGKTLLAKAVATEAQVPFL   68 (262)
T ss_dssp             EEEEESCTTSSHHHHHHHHHHHHTCCEE
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            4799999999999999999877666654

>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1

Probab=94.06  E-value=0.016  Score=41.38  Aligned_cols=24  Identities=8%  Similarity=-0.128  Sum_probs=21.1

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..++.++|.+.+||||++.+++-
T Consensus         6 ~~g~V~ivG~~nvGKSTLln~l~g   29 (301)
T 1wf3_A            6 YSGFVAIVGKPNVGKSTLLNNLLG   29 (301)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHT
T ss_pred             cCCEEEEECCCCCCHHHHHHHHhC
Confidence            456899999999999999999873

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*

Probab=94.05  E-value=0.02  Score=43.07  Aligned_cols=26  Identities=23%  Similarity=0.272  Sum_probs=20.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -+++.|..+||||||++++|.....|
T Consensus       180 i~~I~G~sGsGKTTLl~~la~~~~~p  205 (400)
T 3lda_A          180 ITELFGEFRTGKSQLCHTLAVTCQIP  205 (400)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHTTSC
T ss_pred             EEEEEcCCCCChHHHHHHHHHHhccC
Confidence            46889999999999999888654443

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11

Probab=94.04  E-value=0.02  Score=41.72  Aligned_cols=24  Identities=17%  Similarity=0.159  Sum_probs=21.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -++|.|..+||||||+++++....
T Consensus       133 i~~I~G~~GsGKTTL~~~l~~~~~  156 (349)
T 1pzn_A          133 ITEVFGEFGSGKTQLAHTLAVMVQ  156 (349)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHTT
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhc
Confidence            468899999999999999998764

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}

Probab=94.03  E-value=0.026  Score=38.71  Aligned_cols=30  Identities=23%  Similarity=0.244  Sum_probs=24.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..-+||.|..++||||++++++--...|..
T Consensus        54 ~~~vll~Gp~GtGKT~la~~la~~~~~~~~   83 (297)
T 3b9p_A           54 AKGLLLFGPPGNGKTLLARAVATECSATFL   83 (297)
T ss_dssp             CSEEEEESSSSSCHHHHHHHHHHHTTCEEE
T ss_pred             CCeEEEECcCCCCHHHHHHHHHHHhCCCeE
Confidence            346899999999999999999877666553

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=94.02  E-value=0.02  Score=42.44  Aligned_cols=24  Identities=17%  Similarity=0.127  Sum_probs=21.3

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|+.++|.+.+||||++++++-
T Consensus       179 ~~~kvaivG~~gvGKSTLln~l~g  202 (439)
T 1mky_A          179 DAIKVAIVGRPNVGKSTLFNAILN  202 (439)
T ss_dssp             SCEEEEEECSTTSSHHHHHHHHHT
T ss_pred             cCceEEEECCCCCCHHHHHHHHhC
Confidence            358999999999999999999863

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}

Probab=94.02  E-value=0.022  Score=40.55  Aligned_cols=20  Identities=15%  Similarity=-0.071  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -+.|+|..+|||||+++++.
T Consensus       167 i~~l~G~sG~GKSTLln~l~  186 (302)
T 2yv5_A          167 ICILAGPSGVGKSSILSRLT  186 (302)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            46889999999999999998

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}

Probab=94.00  E-value=0.017  Score=43.35  Aligned_cols=22  Identities=23%  Similarity=0.087  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.+.-.
T Consensus        49 ~~~llGpsGsGKSTLLr~iaGl   70 (390)
T 3gd7_A           49 RVGLLGRTGSGKSTLLSAFLRL   70 (390)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTC
T ss_pred             EEEEECCCCChHHHHHHHHhCC
Confidence            5689999999999999987643

>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP}

Probab=93.96  E-value=0.021  Score=43.48  Aligned_cols=27  Identities=11%  Similarity=0.024  Sum_probs=23.2

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+..+|+.++|...+||||++.+++-
T Consensus       220 ~~r~~~kV~ivG~~nvGKSSLln~L~~  246 (462)
T 3geh_A          220 LLRTGLKVAIVGRPNVGKSSLLNAWSQ  246 (462)
T ss_dssp             HHHHCEEEEEEECTTSSHHHHHHHHHH
T ss_pred             hhcCCCEEEEEcCCCCCHHHHHHHHhC
Confidence            344678999999999999999999864

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12

Probab=93.94  E-value=0.0071  Score=42.30  Aligned_cols=22  Identities=18%  Similarity=0.060  Sum_probs=19.2

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.++|..+|||||++.++|-.-
T Consensus        30 ~~i~GpnGsGKSTll~~i~g~~   51 (227)
T 1qhl_A           30 TTLSGGNGAGKSTTMAAFVTAL   51 (227)
T ss_dssp             HHHHSCCSHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHhccc
Confidence            3688999999999999998763

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=93.92  E-value=0.028  Score=39.25  Aligned_cols=20  Identities=30%  Similarity=0.340  Sum_probs=18.7

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +|+.|..++||||++++++-
T Consensus        39 ~ll~Gp~G~GKTtl~~~la~   58 (354)
T 1sxj_E           39 LLLYGPNGTGKKTRCMALLE   58 (354)
T ss_dssp             EEEECSTTSSHHHHHHTHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            89999999999999998776

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A

Probab=93.89  E-value=0.021  Score=42.71  Aligned_cols=27  Identities=19%  Similarity=0.032  Sum_probs=22.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      --+++.|..+|||||++++++-..+-.
T Consensus       170 ~~i~l~G~~GsGKSTl~~~l~~~~~g~  196 (377)
T 1svm_A          170 RYWLFKGPIDSGKTTLAAALLELCGGK  196 (377)
T ss_dssp             CEEEEECSTTSSHHHHHHHHHHHHCCE
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhcCCc
Confidence            367999999999999999998655443

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=93.88  E-value=0.02  Score=44.19  Aligned_cols=22  Identities=9%  Similarity=0.027  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus        49 ~~~LvG~NGaGKSTLlk~l~Gl   70 (538)
T 1yqt_A           49 VVGIVGPNGTGKSTAVKILAGQ   70 (538)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998754

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}

Probab=93.87  E-value=0.012  Score=39.28  Aligned_cols=22  Identities=14%  Similarity=0.054  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.+.|..+|||||+++.+.-.
T Consensus         4 ~v~IvG~SGsGKSTL~~~L~~~   25 (171)
T 2f1r_A            4 ILSIVGTSDSGKTTLITRMMPI   25 (171)
T ss_dssp             EEEEEESCHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4678999999999999987654

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}

Probab=93.85  E-value=0.021  Score=40.14  Aligned_cols=22  Identities=23%  Similarity=-0.108  Sum_probs=19.3

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...|.|.|..+|||||+++.+.
T Consensus        75 ~~iI~I~G~~GSGKSTva~~La   96 (281)
T 2f6r_A           75 LYVLGLTGISGSGKSSVAQRLK   96 (281)
T ss_dssp             CEEEEEEECTTSCHHHHHHHHH
T ss_pred             CEEEEEECCCCCCHHHHHHHHH
Confidence            4568999999999999999886

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*

Probab=93.80  E-value=0.022  Score=41.34  Aligned_cols=24  Identities=17%  Similarity=0.059  Sum_probs=20.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .-..+.|+|..+||||||++.+.-
T Consensus        54 ~g~~v~i~G~~GaGKSTLl~~l~g   77 (337)
T 2qm8_A           54 RAIRVGITGVPGVGKSTTIDALGS   77 (337)
T ss_dssp             CSEEEEEECCTTSCHHHHHHHHHH
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHH
Confidence            455789999999999999998873

>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A*

Probab=93.77  E-value=0.028  Score=42.37  Aligned_cols=27  Identities=15%  Similarity=0.106  Sum_probs=23.4

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+..+|+.++|...+||||++.+++--
T Consensus        30 ~k~~~ki~iiG~~~~GKSTLi~~Ll~~   56 (483)
T 3p26_A           30 ALPHLSFVVLGHVDAGKSTLMGRLLYD   56 (483)
T ss_dssp             SCCEEEEEEESCGGGTHHHHHHHHHHH
T ss_pred             CCCceEEEEECCCCCCHHHHHHHHHHh
Confidence            456799999999999999999998643

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}

Probab=93.77  E-value=0.071  Score=33.55  Aligned_cols=20  Identities=25%  Similarity=0.323  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +||.|..++||||++++++-
T Consensus        41 ~ll~G~~G~GKT~l~~~l~~   60 (226)
T 2chg_A           41 LLFSGPPGTGKTATAIALAR   60 (226)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            89999999999999988764

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*

Probab=93.77  E-value=0.023  Score=40.99  Aligned_cols=22  Identities=14%  Similarity=0.043  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.++|.++|||||++..++-.
T Consensus       104 vi~lvG~nGsGKTTll~~Lagl  125 (304)
T 1rj9_A          104 VVLVVGVNGVGKTTTIAKLGRY  125 (304)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHHHHHH
Confidence            5788999999999999988744

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*

Probab=93.77  E-value=0.021  Score=44.55  Aligned_cols=22  Identities=27%  Similarity=0.092  Sum_probs=19.0

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .-.+|+.|+.+|||||+++.+-
T Consensus       167 ~pHlLIaG~TGSGKSt~L~~li  188 (512)
T 2ius_A          167 MPHLLVAGTTGSGASVGVNAMI  188 (512)
T ss_dssp             SCSEEEECCTTSSHHHHHHHHH
T ss_pred             CceEEEECCCCCCHHHHHHHHH
Confidence            3568999999999999998764

>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A*

Probab=93.73  E-value=0.047  Score=36.52  Aligned_cols=35  Identities=11%  Similarity=0.055  Sum_probs=25.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      .+.+-+.+.|-|++||||++..+...   -.+...|++
T Consensus        12 ~~~~i~~~~GkgGvGKTTl~~~La~~l~~g~~v~vvd~   49 (262)
T 1yrb_A           12 MASMIVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNL   49 (262)
T ss_dssp             CCCEEEEEECSTTSSHHHHHHHHHHHHTTTSCEEEEEC
T ss_pred             cceEEEEEeCCCCCCHHHHHHHHHHHHHCCCeEEEEeC
Confidence            45567889999999999999988643   234455554

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0

Probab=93.71  E-value=0.024  Score=38.97  Aligned_cols=21  Identities=24%  Similarity=0.170  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+.|.|..+|||||+++.++-
T Consensus        21 ~ivl~GPSGaGKsTL~~~L~~   41 (197)
T 3ney_A           21 TLVLIGASGVGRSHIKNALLS   41 (197)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECcCCCCHHHHHHHHHh
Confidence            467899999999999998873

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*

Probab=93.70  E-value=0.057  Score=40.87  Aligned_cols=24  Identities=17%  Similarity=-0.006  Sum_probs=20.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....+.|+|..+|||||++++++-
T Consensus        68 ~~~~valvG~nGaGKSTLln~L~G   91 (413)
T 1tq4_A           68 SVLNVAVTGETGSGKSSFINTLRG   91 (413)
T ss_dssp             CCEEEEEEECTTSSHHHHHHHHHT
T ss_pred             CCeEEEEECCCCCcHHHHHHHHhC
Confidence            344688999999999999999886

>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A

Probab=93.70  E-value=0.025  Score=42.33  Aligned_cols=25  Identities=12%  Similarity=0.001  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...+|+|.|-.+|||||+.+.++--
T Consensus        38 ~~~~IvlvGlpGsGKSTia~~La~~   62 (469)
T 1bif_A           38 CPTLIVMVGLPARGKTYISKKLTRY   62 (469)
T ss_dssp             CCEEEEEECCTTSSHHHHHHHHHHH
T ss_pred             CcEEEEEECCCCCCHHHHHHHHHHH
Confidence            4578999999999999999998743

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*

Probab=93.63  E-value=0.083  Score=33.41  Aligned_cols=21  Identities=14%  Similarity=0.034  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|+.|..++||||++++++-
T Consensus        47 ~~ll~G~~G~GKT~l~~~~~~   67 (250)
T 1njg_A           47 AYLFSGTRGVGKTSIARLLAK   67 (250)
T ss_dssp             EEEEECSTTSCHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            378999999999999988764

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}

Probab=93.58  E-value=0.026  Score=39.72  Aligned_cols=26  Identities=12%  Similarity=0.111  Sum_probs=21.3

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .-.+.|.|..+|||||+++.+.-...
T Consensus        48 g~~i~l~G~~GsGKSTl~~~La~~lg   73 (250)
T 3nwj_A           48 GRSMYLVGMMGSGKTTVGKIMARSLG   73 (250)
T ss_dssp             TCCEEEECSTTSCHHHHHHHHHHHHT
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHhcC
Confidence            34789999999999999998865433

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*

Probab=93.58  E-value=0.11  Score=35.57  Aligned_cols=29  Identities=14%  Similarity=0.076  Sum_probs=24.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhccccee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      .-+||.|..++||||++++++--...|..
T Consensus        39 ~~vll~G~~GtGKT~la~~i~~~~~~~~~   67 (324)
T 1hqc_A           39 EHLLLFGPPGLGKTTLAHVIAHELGVNLR   67 (324)
T ss_dssp             CCCEEECCTTCCCHHHHHHHHHHHTCCEE
T ss_pred             CcEEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            46899999999999999999876666654

>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A*

Probab=93.57  E-value=0.025  Score=41.96  Aligned_cols=21  Identities=5%  Similarity=-0.189  Sum_probs=18.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -|+|.|..+|||||+++.+.-
T Consensus       260 lIil~G~pGSGKSTla~~L~~  280 (416)
T 3zvl_A          260 VVVAVGFPGAGKSTFIQEHLV  280 (416)
T ss_dssp             EEEEESCTTSSHHHHHHHHTG
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            467889999999999998764

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A

Probab=93.47  E-value=0.024  Score=43.66  Aligned_cols=22  Identities=14%  Similarity=0.066  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ++.++|..+|||||+++.++-.
T Consensus       371 ~~~ivG~sGsGKSTLl~~l~g~  392 (582)
T 3b60_A          371 TVALVGRSGSGKSTIASLITRF  392 (582)
T ss_dssp             EEEEEECTTSSHHHHHHHHTTT
T ss_pred             EEEEECCCCCCHHHHHHHHhhc
Confidence            5789999999999999998765

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}

Probab=93.39  E-value=0.029  Score=40.36  Aligned_cols=31  Identities=6%  Similarity=0.130  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      -+.|+|..+|||||++..++-.   ++.-+.+++
T Consensus       102 vi~lvG~nGsGKTTll~~Lag~l~~~~g~V~l~g  135 (302)
T 3b9q_A          102 VIMIVGVNGGGKTTSLGKLAHRLKNEGTKVLMAA  135 (302)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHHHHHTTCCEEEEC
T ss_pred             EEEEEcCCCCCHHHHHHHHHHHHHHcCCeEEEEe
Confidence            4789999999999999988754   344444443

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1

Probab=93.38  E-value=0.034  Score=37.45  Aligned_cols=24  Identities=17%  Similarity=0.178  Sum_probs=20.1

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +...+.|.|..+|||||+++.+.-
T Consensus        15 ~~~~i~i~G~~gsGKst~~~~l~~   38 (236)
T 1q3t_A           15 KTIQIAIDGPASSGKSTVAKIIAK   38 (236)
T ss_dssp             CCCEEEEECSSCSSHHHHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHHHHH
Confidence            445789999999999999987764

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}

Probab=93.35  E-value=0.028  Score=43.28  Aligned_cols=31  Identities=13%  Similarity=0.120  Sum_probs=23.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~   65 (76)
                      ++.++|..+|||||+++.++-.   ++--..+|+
T Consensus       371 ~~~ivG~sGsGKSTll~~l~g~~~p~~G~i~~~g  404 (582)
T 3b5x_A          371 TVALVGRSGSGKSTIANLFTRFYDVDSGSICLDG  404 (582)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCCCEEEECC
Confidence            5789999999999999998754   233355555

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=93.33  E-value=0.028  Score=44.24  Aligned_cols=22  Identities=9%  Similarity=0.039  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus       119 ~~~LiG~NGsGKSTLlkiL~Gl  140 (607)
T 3bk7_A          119 VVGIVGPNGTGKTTAVKILAGQ  140 (607)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCChHHHHHHHHhCC
Confidence            5789999999999999998753

>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A

Probab=93.26  E-value=0.031  Score=41.51  Aligned_cols=22  Identities=14%  Similarity=-0.011  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++.++|.+.+||||++++++-
T Consensus         2 ~~v~IVG~pnvGKSTL~n~L~~   23 (368)
T 2dby_A            2 LAVGIVGLPNVGKSTLFNALTR   23 (368)
T ss_dssp             CSEEEECCSSSSHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHhC
Confidence            5789999999999999999864

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*

Probab=93.22  E-value=0.028  Score=37.99  Aligned_cols=28  Identities=18%  Similarity=0.271  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++||||++++++--...|..
T Consensus        46 ~vll~G~~GtGKT~la~~la~~~~~~~~   73 (268)
T 2r62_A           46 GVLLVGPPGTGKTLLAKAVAGEAHVPFF   73 (268)
T ss_dssp             CCCCBCSSCSSHHHHHHHHHHHHTCCCC
T ss_pred             eEEEECCCCCcHHHHHHHHHHHhCCCEE
Confidence            3799999999999999999876665543

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A

Probab=93.19  E-value=0.033  Score=37.16  Aligned_cols=21  Identities=10%  Similarity=-0.164  Sum_probs=17.8

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+.+.|..+|||||++..+.-
T Consensus         8 ~i~i~G~sGsGKTTl~~~l~~   28 (174)
T 1np6_A            8 LLAFAAWSGTGKTTLLKKLIP   28 (174)
T ss_dssp             EEEEECCTTSCHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHH
Confidence            467889999999999988764

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*

Probab=93.17  E-value=0.09  Score=37.04  Aligned_cols=36  Identities=17%  Similarity=0.324  Sum_probs=26.4

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccceeeeCceeEE
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEI   70 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~   70 (76)
                      ..-+++.|...|||||++..+.---.  -.|+...+.|
T Consensus        34 g~~ilI~GpsGsGKStLA~~La~~g~--~iIsdDs~~v   69 (205)
T 2qmh_A           34 GLGVLITGDSGVGKSETALELVQRGH--RLIADDRVDV   69 (205)
T ss_dssp             TEEEEEECCCTTTTHHHHHHHHTTTC--EEEESSEEEE
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHhCC--eEEecchhhe
Confidence            44689999999999999988754332  5566665544

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*

Probab=93.16  E-value=0.031  Score=43.31  Aligned_cols=22  Identities=14%  Similarity=0.025  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||+++.++-.
T Consensus        31 ~~~liG~nGsGKSTLl~~l~Gl   52 (483)
T 3euj_A           31 VTTLSGGNGAGKSTTMAGFVTA   52 (483)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHHHhcC
Confidence            4678999999999999998854

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A

Probab=93.16  E-value=0.033  Score=38.07  Aligned_cols=25  Identities=8%  Similarity=-0.109  Sum_probs=20.5

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +-.-+.+.|..+|||||+++.+.-.
T Consensus        25 ~g~~i~i~G~~GsGKsT~~~~l~~~   49 (229)
T 4eaq_A           25 MSAFITFEGPEGSGKTTVINEVYHR   49 (229)
T ss_dssp             CCEEEEEECCTTSCHHHHHHHHHHH
T ss_pred             CCeEEEEEcCCCCCHHHHHHHHHHH
Confidence            3456889999999999999887654

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1

Probab=93.11  E-value=0.033  Score=39.75  Aligned_cols=21  Identities=14%  Similarity=-0.004  Sum_probs=18.0

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|.|..+|||||+++.+.-.
T Consensus         7 ~~i~G~~GaGKTTll~~l~~~   27 (318)
T 1nij_A            7 TLLTGFLGAGKTTLLRHILNE   27 (318)
T ss_dssp             EEEEESSSSSCHHHHHHHHHS
T ss_pred             EEEEecCCCCHHHHHHHHHhh
Confidence            578899999999999987743

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*

Probab=93.08  E-value=0.036  Score=38.93  Aligned_cols=22  Identities=14%  Similarity=0.046  Sum_probs=19.4

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+.+.|..+|||||+++.+.
T Consensus         9 ~~~i~i~G~~GsGKsTla~~la   30 (233)
T 3r20_A            9 SLVVAVDGPAGTGKSSVSRGLA   30 (233)
T ss_dssp             CCEEEEECCTTSSHHHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            4678999999999999999875

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A

Probab=93.08  E-value=0.034  Score=40.21  Aligned_cols=23  Identities=9%  Similarity=0.013  Sum_probs=19.4

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..-++++|+.+|||||+++.+..
T Consensus        35 ~~~~~i~G~~G~GKs~~~~~~~~   57 (392)
T 4ag6_A           35 NSNWTILAKPGAGKSFTAKMLLL   57 (392)
T ss_dssp             CCCEEEECCTTSSHHHHHHHHHH
T ss_pred             cCceEEEcCCCCCHHHHHHHHHH
Confidence            34579999999999999988764

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V

Probab=93.05  E-value=0.034  Score=41.49  Aligned_cols=21  Identities=14%  Similarity=-0.069  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.|+|..++||||++++++-
T Consensus       217 ~~~lvG~sG~GKSTLln~L~g  237 (358)
T 2rcn_A          217 ISIFAGQSGVGKSSLLNALLG  237 (358)
T ss_dssp             EEEEECCTTSSHHHHHHHHHC
T ss_pred             EEEEECCCCccHHHHHHHHhc
Confidence            578999999999999999874

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*

Probab=93.03  E-value=0.031  Score=42.44  Aligned_cols=24  Identities=8%  Similarity=0.023  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      --+++.|..+||||||+++++-..
T Consensus       282 ~i~~i~G~~GsGKSTLl~~l~g~~  305 (525)
T 1tf7_A          282 SIILATGATGTGKTLLVSRFVENA  305 (525)
T ss_dssp             CEEEEEECTTSSHHHHHHHHHHHH
T ss_pred             cEEEEEeCCCCCHHHHHHHHHHHH
Confidence            357899999999999999998653

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A

Probab=93.02  E-value=0.036  Score=37.54  Aligned_cols=19  Identities=11%  Similarity=0.048  Sum_probs=17.0

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.|.|+++|||+|+++.++
T Consensus         4 IVi~GPSG~GK~Tl~~~L~   22 (186)
T 1ex7_A            4 IVISGPSGTGKSTLLKKLF   22 (186)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            5789999999999998875

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*

Probab=92.97  E-value=0.037  Score=38.65  Aligned_cols=24  Identities=8%  Similarity=-0.002  Sum_probs=20.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      --+||.|..++||||++++++-..
T Consensus        38 ~~lll~G~~GtGKT~la~~i~~~~   61 (324)
T 1l8q_A           38 NPIFIYGSVGTGKTHLLQAAGNEA   61 (324)
T ss_dssp             SSEEEECSSSSSHHHHHHHHHHHH
T ss_pred             CeEEEECCCCCcHHHHHHHHHHHH
Confidence            357999999999999999987654

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=92.97  E-value=0.038  Score=42.84  Aligned_cols=31  Identities=16%  Similarity=0.137  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      ++.++|..+|||||+++.++-.-   +--..+|+
T Consensus       383 ~~~ivG~sGsGKSTll~~l~g~~~p~~G~i~~~g  416 (598)
T 3qf4_B          383 KVALVGPTGSGKTTIVNLLMRFYDVDRGQILVDG  416 (598)
T ss_dssp             EEEEECCTTSSTTHHHHHHTTSSCCSEEEEEETT
T ss_pred             EEEEECCCCCcHHHHHHHHhcCcCCCCeEEEECC
Confidence            67899999999999999887543   22345554

>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A*

Probab=92.96  E-value=0.034  Score=41.32  Aligned_cols=25  Identities=12%  Similarity=0.131  Sum_probs=22.3

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..+++.++|...+||||++.+++-
T Consensus         4 k~~~~I~iiG~~~~GKSTLi~~Ll~   28 (435)
T 1jny_A            4 KPHLNLIVIGHVDHGKSTLVGRLLM   28 (435)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CCEEEEEEEeCCCCCHHHHHHHHHH
Confidence            3568999999999999999999974

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*

Probab=92.95  E-value=0.05  Score=37.09  Aligned_cols=30  Identities=17%  Similarity=0.266  Sum_probs=25.2

Q ss_pred             ccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..-+||.|..++||||++++++-....|..
T Consensus        64 ~~~vLl~G~~GtGKT~la~~ia~~~~~~~~   93 (272)
T 1d2n_A           64 LVSVLLEGPPHSGKTALAAKIAEESNFPFI   93 (272)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHHHHTCSEE
T ss_pred             CeEEEEECCCCCcHHHHHHHHHHHhCCCEE
Confidence            446899999999999999999887777744

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6

Probab=92.91  E-value=0.037  Score=39.32  Aligned_cols=22  Identities=5%  Similarity=-0.117  Sum_probs=15.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .-|.+-|..+|||||+++.+.-
T Consensus         6 ~iIgItG~sGSGKSTva~~L~~   27 (290)
T 1a7j_A            6 PIISVTGSSGAGTSTVKHTFDQ   27 (290)
T ss_dssp             CEEEEESCC---CCTHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            4578889999999999988765

>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ...

Probab=92.89  E-value=0.039  Score=40.37  Aligned_cols=26  Identities=12%  Similarity=0.088  Sum_probs=23.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +..+++.++|...+||||++.+++-.
T Consensus         9 ~~~~~I~iiG~~~~GKSTLi~~L~~~   34 (405)
T 2c78_A            9 KPHVNVGTIGHVDHGKTTLTAALTYV   34 (405)
T ss_dssp             CCEEEEEEECSTTSSHHHHHHHHHHH
T ss_pred             CCeEEEEEEcCCCCCHHHHHHHHHhh
Confidence            45789999999999999999998763

>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A*

Probab=92.86  E-value=0.04  Score=40.39  Aligned_cols=25  Identities=8%  Similarity=0.099  Sum_probs=22.3

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+|+.++|...+||||++.+++-.
T Consensus         2 ~~~~I~iiG~~~~GKSTLi~~L~~~   26 (397)
T 1d2e_A            2 PHVNVGTIGHVDHGKTTLTAAITKI   26 (397)
T ss_dssp             CEEEEEEESSTTSSHHHHHHHHHHH
T ss_pred             CeEEEEEEeCCCCCHHHHHHHHhCh
Confidence            4689999999999999999999864

>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B*

Probab=92.85  E-value=0.038  Score=42.38  Aligned_cols=25  Identities=8%  Similarity=0.179  Sum_probs=21.9

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++.+|+.++|...+||||++.+++-
T Consensus       241 r~~~kV~ivG~pnvGKSSLln~L~~  265 (482)
T 1xzp_A          241 NRGLRMVIVGKPNVGKSTLLNRLLN  265 (482)
T ss_dssp             HHCEEEEEECCHHHHTCHHHHHHHH
T ss_pred             cCCCEEEEECcCCCcHHHHHHHHHC
Confidence            3458999999999999999998863

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=92.81  E-value=0.038  Score=42.87  Aligned_cols=21  Identities=19%  Similarity=0.056  Sum_probs=18.4

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +-|+|..+|||||+++.++-.
T Consensus        28 ~gLiGpNGaGKSTLlkiL~Gl   48 (538)
T 3ozx_A           28 LGVLGKNGVGKTTVLKILAGE   48 (538)
T ss_dssp             EEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEECCCCCcHHHHHHHHhcC
Confidence            468999999999999988754

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}

Probab=92.80  E-value=0.066  Score=37.50  Aligned_cols=28  Identities=11%  Similarity=0.157  Sum_probs=23.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++||||++++++.-...|..
T Consensus        51 ~vLL~Gp~GtGKT~la~ala~~~~~~~i   78 (301)
T 3cf0_A           51 GVLFYGPPGCGKTLLAKAIANECQANFI   78 (301)
T ss_dssp             EEEEECSSSSSHHHHHHHHHHHTTCEEE
T ss_pred             eEEEECCCCcCHHHHHHHHHHHhCCCEE
Confidence            4899999999999999999877665543

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*

Probab=92.78  E-value=0.039  Score=41.12  Aligned_cols=23  Identities=4%  Similarity=-0.071  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+++|+|.+.+||||++.+++-
T Consensus        23 ~~~V~lvG~~nvGKSTL~n~l~~   45 (456)
T 4dcu_A           23 KPVVAIVGRPNVGKSTIFNRIAG   45 (456)
T ss_dssp             CCEEEEECSSSSSHHHHHHHHEE
T ss_pred             CCEEEEECCCCCcHHHHHHHHhC
Confidence            56899999999999999998863

>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ...

Probab=92.78  E-value=0.046  Score=37.34  Aligned_cols=25  Identities=12%  Similarity=-0.023  Sum_probs=20.8

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +-..|.+-|..+|||||+++.+.-.
T Consensus        23 ~~~~I~ieG~~GsGKST~~~~L~~~   47 (263)
T 1p5z_B           23 RIKKISIEGNIAAGKSTFVNILKQL   47 (263)
T ss_dssp             CCEEEEEECSTTSSHHHHHTTTGGG
T ss_pred             CceEEEEECCCCCCHHHHHHHHHHh
Confidence            4457889999999999999887654

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}

Probab=92.78  E-value=0.038  Score=42.84  Aligned_cols=22  Identities=14%  Similarity=-0.010  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+-|+|..+|||||+++.++-.
T Consensus       296 i~~i~G~nGsGKSTLl~~l~Gl  317 (538)
T 3ozx_A          296 IIGILGPNGIGKTTFARILVGE  317 (538)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            3568999999999999998854

>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B

Probab=92.73  E-value=0.038  Score=43.19  Aligned_cols=22  Identities=18%  Similarity=0.169  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+-++|..+|||||+++++.-.
T Consensus        47 ~iaIvG~nGsGKSTLL~~I~Gl   68 (608)
T 3szr_A           47 AIAVIGDQSSGKSSVLEALSGV   68 (608)
T ss_dssp             CEECCCCTTSCHHHHHHHHHSC
T ss_pred             eEEEECCCCChHHHHHHHHhCC
Confidence            5899999999999999998765

>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A*

Probab=92.71  E-value=0.042  Score=38.96  Aligned_cols=24  Identities=13%  Similarity=-0.085  Sum_probs=20.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...++.++|.+.+|||||+.+++-
T Consensus         9 ~~g~v~ivG~~nvGKSTLin~l~g   32 (308)
T 3iev_A            9 KVGYVAIVGKPNVGKSTLLNNLLG   32 (308)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHT
T ss_pred             CCCEEEEECCCCCcHHHHHHHHhC
Confidence            346789999999999999998863

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*

Probab=92.70  E-value=0.041  Score=40.23  Aligned_cols=21  Identities=10%  Similarity=-0.070  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      .++.|..+|||||++.++|..
T Consensus        26 ~~i~G~NGaGKTTll~ai~~a   46 (365)
T 3qf7_A           26 TVVEGPNGAGKSSLFEAISFA   46 (365)
T ss_dssp             EEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            568999999999999999843

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A

Probab=92.68  E-value=0.039  Score=42.49  Aligned_cols=22  Identities=5%  Similarity=-0.120  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.++|..+|||||+++.++-.
T Consensus       369 ~~~ivG~sGsGKSTll~~l~g~  390 (578)
T 4a82_A          369 TVAFVGMSGGGKSTLINLIPRF  390 (578)
T ss_dssp             EEEEECSTTSSHHHHHTTTTTS
T ss_pred             EEEEECCCCChHHHHHHHHhcC
Confidence            5679999999999999988754

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}

Probab=92.58  E-value=0.04  Score=40.97  Aligned_cols=21  Identities=14%  Similarity=0.165  Sum_probs=18.3

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|...||||||+++++..
T Consensus        64 ~~I~GppGsGKSTLal~la~~   84 (356)
T 3hr8_A           64 VEIFGQESSGKTTLALHAIAE   84 (356)
T ss_dssp             EEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            577899999999999998765

>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A*

Probab=92.49  E-value=0.044  Score=38.49  Aligned_cols=21  Identities=14%  Similarity=0.101  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      .++.++|...+|||||+.+++
T Consensus       100 ~~v~~vG~~~vGKSslin~l~  120 (262)
T 3cnl_A          100 ARVLIVGVPNTGKSTIINKLK  120 (262)
T ss_dssp             CEEEEEESTTSSHHHHHHHHH
T ss_pred             hheEEeCCCCCCHHHHHHHHh
Confidence            599999999999999999986

>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A*

Probab=92.44  E-value=0.034  Score=40.76  Aligned_cols=24  Identities=13%  Similarity=0.203  Sum_probs=21.7

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+++.++|-..+||||++.+++
T Consensus         8 ~~~~~I~iiG~~~~GKSTLi~~L~   31 (410)
T 1kk1_A            8 QAEVNIGMVGHVDHGKTTLTKALT   31 (410)
T ss_dssp             SEEEEEEEECSTTSSHHHHHHHHH
T ss_pred             CCccEEEEECCCCCCHHHHHHHHh
Confidence            346899999999999999999997

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}

Probab=92.44  E-value=0.045  Score=42.23  Aligned_cols=22  Identities=9%  Similarity=-0.056  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+-|+|..+|||||+++.++-.
T Consensus       314 ~~~i~G~NGsGKSTLlk~l~Gl  335 (538)
T 1yqt_A          314 VIGIVGPNGIGKTTFVKMLAGV  335 (538)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            4679999999999999998854

>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2

Probab=92.42  E-value=0.048  Score=40.75  Aligned_cols=22  Identities=18%  Similarity=-0.029  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|+.++|-+.+||||++.+++-
T Consensus         3 ~kI~IVG~pnvGKSTL~n~Lt~   24 (363)
T 1jal_A            3 FKCGIVGLPNVGKSTLFNALTK   24 (363)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHC
Confidence            5889999999999999999875

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*

Probab=92.42  E-value=0.045  Score=43.08  Aligned_cols=22  Identities=9%  Similarity=-0.056  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+||||||++.+.-.
T Consensus       384 i~~i~G~NGsGKSTLlk~l~Gl  405 (607)
T 3bk7_A          384 VIGIVGPNGIGKTTFVKMLAGV  405 (607)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4679999999999999998754

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*

Probab=92.41  E-value=0.044  Score=37.54  Aligned_cols=23  Identities=9%  Similarity=0.096  Sum_probs=19.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+||.|..++||||++++++-..
T Consensus        69 ~vll~G~~GtGKT~la~~la~~l   91 (309)
T 3syl_A           69 HMSFTGNPGTGKTTVALKMAGLL   91 (309)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHHHHHHH
Confidence            48999999999999998766543

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}

Probab=92.35  E-value=0.052  Score=35.60  Aligned_cols=20  Identities=15%  Similarity=0.084  Sum_probs=17.6

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +++-|.++||||||+.+++.
T Consensus        33 ~~i~G~pG~GKT~l~l~~~~   52 (251)
T 2zts_A           33 VLLTGGTGTGKTTFAAQFIY   52 (251)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHH
Confidence            57889999999999998874

>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8

Probab=92.34  E-value=0.044  Score=40.16  Aligned_cols=21  Identities=10%  Similarity=-0.045  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      ++.|+|-..+|||||+.+++-
T Consensus       160 ~V~lvG~~nvGKSTLln~L~~  180 (342)
T 1lnz_A          160 DVGLVGFPSVGKSTLLSVVSS  180 (342)
T ss_dssp             CEEEESSTTSSHHHHHHHSEE
T ss_pred             eeeeeCCCCCCHHHHHHHHHc
Confidence            567999999999999998863

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C

Probab=92.34  E-value=0.061  Score=37.93  Aligned_cols=28  Identities=18%  Similarity=0.205  Sum_probs=24.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++|||+++++++--...|..
T Consensus        53 ~vLl~GppGtGKT~la~aia~~~~~~~~   80 (322)
T 3eie_A           53 GILLYGPPGTGKSYLAKAVATEANSTFF   80 (322)
T ss_dssp             EEEEECSSSSCHHHHHHHHHHHHTCEEE
T ss_pred             eEEEECCCCCcHHHHHHHHHHHHCCCEE
Confidence            4899999999999999999887766654

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}

Probab=92.32  E-value=0.049  Score=40.48  Aligned_cols=22  Identities=9%  Similarity=0.090  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|..+|||||++..++-.
T Consensus       159 vi~lvG~nGsGKTTll~~Lag~  180 (359)
T 2og2_A          159 VIMIVGVNGGGKTTSLGKLAHR  180 (359)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEEEcCCCChHHHHHHHHHhh
Confidence            4789999999999999988764

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A

Probab=92.31  E-value=0.048  Score=42.79  Aligned_cols=30  Identities=17%  Similarity=0.205  Sum_probs=22.5

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMIN   64 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~   64 (76)
                      -+.|+|..+|||||++..+.-.   ++.-++++
T Consensus       295 VI~LVGpNGSGKTTLl~~LAgll~~~~G~V~l~  327 (503)
T 2yhs_A          295 VILMVGVNGVGKTTTIGKLARQFEQQGKSVMLA  327 (503)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             EEEEECCCcccHHHHHHHHHHHhhhcCCeEEEe
Confidence            5789999999999999987753   33444554

>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus}

Probab=92.29  E-value=0.11  Score=38.15  Aligned_cols=25  Identities=4%  Similarity=-0.089  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +..++.++|...+||||++.++.-.
T Consensus       161 ~~~~i~~vG~~nvGKStliN~L~~~  185 (369)
T 3ec1_A          161 EGGDVYVVGCTNVGKSTFINRIIEE  185 (369)
T ss_dssp             TTSCEEEECCTTSSHHHHHHHHHHH
T ss_pred             ccCcEEEEcCCCCchHHHHHHHHhh
Confidence            4568999999999999999998743

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}

Probab=92.28  E-value=0.045  Score=41.42  Aligned_cols=26  Identities=12%  Similarity=-0.027  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +--++.|+|..+|||||+++.+.-..
T Consensus       156 ~Gq~~~IvG~sGsGKSTLl~~Iag~~  181 (438)
T 2dpy_A          156 RGQRMGLFAGSGVGKSVLLGMMARYT  181 (438)
T ss_dssp             TTCEEEEEECTTSSHHHHHHHHHHHS
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccc
Confidence            44578999999999999998877654

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20

Probab=92.28  E-value=0.2  Score=35.78  Aligned_cols=31  Identities=23%  Similarity=0.323  Sum_probs=25.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      ..-+||.|..++||||++++++-....|+..
T Consensus        72 ~~~ill~Gp~GtGKT~la~~la~~l~~~~~~  102 (376)
T 1um8_A           72 KSNILLIGPTGSGKTLMAQTLAKHLDIPIAI  102 (376)
T ss_dssp             CCCEEEECCTTSSHHHHHHHHHHHTTCCEEE
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHhCCCEEE
Confidence            4468999999999999999998877767643

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*

Probab=92.25  E-value=0.076  Score=35.97  Aligned_cols=30  Identities=13%  Similarity=0.220  Sum_probs=24.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..-+||.|..++||||++++++-....|+.
T Consensus        50 ~~~vll~G~~GtGKT~la~~la~~l~~~~~   79 (310)
T 1ofh_A           50 PKNILMIGPTGVGKTEIARRLAKLANAPFI   79 (310)
T ss_dssp             CCCEEEECCTTSSHHHHHHHHHHHHTCCEE
T ss_pred             CceEEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            346899999999999999999877666654

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}

Probab=92.24  E-value=0.022  Score=41.06  Aligned_cols=24  Identities=17%  Similarity=-0.056  Sum_probs=20.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      ...|+|..+|||||++.+++....
T Consensus        62 ~~~lvG~NGaGKStLl~aI~~l~~   85 (415)
T 4aby_A           62 FCAFTGETGAGKSIIVDALGLLLG   85 (415)
T ss_dssp             EEEEEESHHHHHHHHTHHHHHHTT
T ss_pred             cEEEECCCCCCHHHHHHHHHHHhC
Confidence            678999999999999999876553

>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii}

Probab=92.23  E-value=0.13  Score=39.83  Aligned_cols=23  Identities=4%  Similarity=-0.048  Sum_probs=20.8

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +..++.++|-+.+||||++.+++
T Consensus        12 ~~r~IaIiG~~~aGKTTL~~~Ll   34 (528)
T 3tr5_A           12 MRRTFAIISHPDAGKTTLTEKLL   34 (528)
T ss_dssp             TEEEEEEEECTTSSHHHHHHHHH
T ss_pred             cCCEEEEECCCCCcHHHHHHHHH
Confidence            45689999999999999999996

>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2

Probab=92.22  E-value=0.048  Score=40.66  Aligned_cols=22  Identities=9%  Similarity=-0.035  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|+.++|-+.+|||||+.+++-
T Consensus         1 ~kI~ivG~pnvGKSTL~n~L~~   22 (397)
T 1wxq_A            1 MEIGVVGKPNVGKSTFFSAATL   22 (397)
T ss_dssp             CEEEEEECTTSSHHHHHHHHHC
T ss_pred             CEEEEECCCCCCHHHHHHHHHC
Confidence            4789999999999999999863

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A

Probab=92.19  E-value=0.079  Score=37.78  Aligned_cols=30  Identities=20%  Similarity=0.280  Sum_probs=25.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      .-+||.|..++|||+++++++-....|+..
T Consensus        52 ~~vll~GppGtGKT~la~~ia~~~~~~~~~   81 (363)
T 3hws_A           52 SNILLIGPTGSGKTLLAETLARLLDVPFTM   81 (363)
T ss_dssp             CCEEEECCTTSSHHHHHHHHHHHTTCCEEE
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHcCCCEEE
Confidence            458999999999999999999887777653

>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2

Probab=92.14  E-value=0.053  Score=40.79  Aligned_cols=25  Identities=12%  Similarity=0.033  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....++.|+|...+||||++++++-
T Consensus        18 ~~g~~vgiVG~pnaGKSTL~n~Ltg   42 (392)
T 1ni3_A           18 GNNLKTGIVGMPNVGKSTFFRAITK   42 (392)
T ss_dssp             SSCCEEEEEECSSSSHHHHHHHHHH
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHHC
Confidence            3456899999999999999999975

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20

Probab=92.13  E-value=0.055  Score=37.75  Aligned_cols=23  Identities=22%  Similarity=0.121  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+++.|..++||||++++++-..
T Consensus        46 ~~li~G~~G~GKTtl~~~l~~~~   68 (389)
T 1fnn_A           46 RATLLGRPGTGKTVTLRKLWELY   68 (389)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHHHHHHH
Confidence            48999999999999999887544

>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}

Probab=92.13  E-value=0.056  Score=38.14  Aligned_cols=27  Identities=15%  Similarity=0.157  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .+.+|=++|..+|||||+.+.++--..
T Consensus         7 ~~~~~~~~G~pGsGKsT~a~~L~~~~g   33 (230)
T 3gmt_A            7 HHMRLILLGAPGAGKGTQANFIKEKFG   33 (230)
T ss_dssp             --CEEEEECCTTSCHHHHHHHHHHHHT
T ss_pred             cccceeeECCCCCCHHHHHHHHHHHhC
Confidence            467899999999999999988765443

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*

Probab=92.12  E-value=0.054  Score=39.53  Aligned_cols=23  Identities=13%  Similarity=0.072  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      --+.++|..+|||||++..+.-.
T Consensus       130 ~vi~lvG~nGaGKTTll~~Lag~  152 (328)
T 3e70_C          130 YVIMFVGFNGSGKTTTIAKLANW  152 (328)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            45789999999999999887654

>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8

Probab=92.10  E-value=0.13  Score=36.43  Aligned_cols=24  Identities=17%  Similarity=0.166  Sum_probs=21.2

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.+++.++|-..+||||++.++.
T Consensus       118 ~~~~~v~~vG~~nvGKSsliN~l~  141 (282)
T 1puj_A          118 PRAIRALIIGIPNVGKSTLINRLA  141 (282)
T ss_dssp             CCCEEEEEEESTTSSHHHHHHHHH
T ss_pred             CCCceEEEEecCCCchHHHHHHHh
Confidence            356899999999999999999874

>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8

Probab=92.09  E-value=0.059  Score=39.54  Aligned_cols=24  Identities=13%  Similarity=0.189  Sum_probs=21.8

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+++.++|-..+||||++.+++
T Consensus         6 ~~~~~I~iiG~~d~GKSTLi~~L~   29 (408)
T 1s0u_A            6 QAEVNIGMVGHVDHGKTSLTKALT   29 (408)
T ss_dssp             CCCEEEEEESCTTSSHHHHHHHHH
T ss_pred             CCceEEEEEcCCCCCHHHHHHHHh
Confidence            357899999999999999999987

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}

Probab=92.09  E-value=0.052  Score=42.02  Aligned_cols=32  Identities=13%  Similarity=0.007  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      ++-++|..+|||||+++.++-..   +--..+|+.
T Consensus       371 ~~~ivG~sGsGKSTll~~l~g~~~~~~G~i~i~g~  405 (587)
T 3qf4_A          371 LVAVLGETGSGKSTLMNLIPRLIDPERGRVEVDEL  405 (587)
T ss_dssp             EEEEECSSSSSHHHHHHTTTTSSCCSEEEEEESSS
T ss_pred             EEEEECCCCCCHHHHHHHHhCCccCCCcEEEECCE
Confidence            57799999999999999887543   223455543

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}

Probab=92.07  E-value=0.14  Score=36.33  Aligned_cols=28  Identities=21%  Similarity=0.272  Sum_probs=23.3

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .....-+|+.|..++|||+++++++--.
T Consensus        22 a~~~~~vLi~Ge~GtGKt~lAr~i~~~~   49 (304)
T 1ojl_A           22 APSDATVLIHGDSGTGKELVARALHACS   49 (304)
T ss_dssp             CSTTSCEEEESCTTSCHHHHHHHHHHHS
T ss_pred             hCCCCcEEEECCCCchHHHHHHHHHHhC
Confidence            3456678999999999999999988743

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=92.07  E-value=0.051  Score=37.55  Aligned_cols=25  Identities=4%  Similarity=-0.025  Sum_probs=20.6

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .--++|.|..++||||++++++-..
T Consensus        45 ~~~vli~G~~G~GKTtl~~~l~~~~   69 (386)
T 2qby_A           45 PNNIFIYGLTGTGKTAVVKFVLSKL   69 (386)
T ss_dssp             CCCEEEEECTTSSHHHHHHHHHHHH
T ss_pred             CCeEEEECCCCCCHHHHHHHHHHHH
Confidence            3467999999999999999877543

>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1

Probab=92.05  E-value=0.042  Score=41.49  Aligned_cols=22  Identities=14%  Similarity=0.025  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|...+|||||+++++-.
T Consensus       159 ~VgLVG~~gAGKSTLL~~Lsg~  180 (416)
T 1udx_A          159 DVGLVGYPNAGKSSLLAAMTRA  180 (416)
T ss_dssp             SEEEECCGGGCHHHHHHHHCSS
T ss_pred             EEEEECCCCCcHHHHHHHHHcC
Confidence            5679999999999999988654

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}

Probab=92.05  E-value=0.068  Score=41.80  Aligned_cols=27  Identities=11%  Similarity=0.095  Sum_probs=21.8

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+-..+.|+|..+|||||+++++.-..
T Consensus       367 ~~G~iI~LiG~sGSGKSTLar~La~~L  393 (552)
T 3cr8_A          367 RQGFTVFFTGLSGAGKSTLARALAARL  393 (552)
T ss_dssp             GSCEEEEEEESSCHHHHHHHHHHHHHH
T ss_pred             ccceEEEEECCCCChHHHHHHHHHHhh
Confidence            344568899999999999999887543

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*

Probab=92.04  E-value=0.054  Score=43.93  Aligned_cols=23  Identities=9%  Similarity=0.042  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.++|...|||||++++++.+.
T Consensus       578 i~~I~GpNGsGKSTlLr~iagl~  600 (765)
T 1ewq_A          578 LVLITGPNMAGKSTFLRQTALIA  600 (765)
T ss_dssp             EEEEESCSSSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCChHHHHHHHHhhh
Confidence            46899999999999999998654

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12

Probab=92.03  E-value=0.056  Score=39.77  Aligned_cols=22  Identities=14%  Similarity=-0.055  Sum_probs=19.3

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..++|..+|||||++.+++...
T Consensus        29 ~~i~G~nG~GKstll~ai~~~~   50 (430)
T 1w1w_A           29 TSIIGPNGSGKSNMMDAISFVL   50 (430)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHhhh
Confidence            5788999999999999998643

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*

Probab=92.01  E-value=0.051  Score=39.87  Aligned_cols=26  Identities=4%  Similarity=-0.012  Sum_probs=22.1

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +--++.|+|..++||||+++.++-..
T Consensus        70 ~Gq~~gIiG~nGaGKTTLl~~I~g~~   95 (347)
T 2obl_A           70 IGQRIGIFAGSGVGKSTLLGMICNGA   95 (347)
T ss_dssp             TTCEEEEEECTTSSHHHHHHHHHHHS
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCC
Confidence            44588999999999999998887664

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=92.01  E-value=0.054  Score=42.76  Aligned_cols=21  Identities=19%  Similarity=0.018  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+-|+|..+|||||+++.+.-
T Consensus       105 i~~LvGpNGaGKSTLLkiL~G  125 (608)
T 3j16_B          105 VLGLVGTNGIGKSTALKILAG  125 (608)
T ss_dssp             EEEEECCTTSSHHHHHHHHHT
T ss_pred             EEEEECCCCChHHHHHHHHhc
Confidence            467899999999999998764

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12

Probab=92.00  E-value=0.062  Score=38.15  Aligned_cols=23  Identities=13%  Similarity=-0.161  Sum_probs=19.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -.+++|..+|||||++.+++...
T Consensus        26 ~~~i~G~NGsGKS~ll~ai~~ll   48 (322)
T 1e69_A           26 VTAIVGPNGSGKSNIIDAIKWVF   48 (322)
T ss_dssp             EEEEECCTTTCSTHHHHHHHHTS
T ss_pred             cEEEECCCCCcHHHHHHHHHHHh
Confidence            45789999999999999998653

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8

Probab=91.95  E-value=0.022  Score=41.54  Aligned_cols=22  Identities=9%  Similarity=-0.043  Sum_probs=19.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      -.+.++|..++||||+++++.-
T Consensus       174 ~~~~lvG~sG~GKSTLln~L~g  195 (307)
T 1t9h_A          174 KTTVFAGQSGVGKSSLLNAISP  195 (307)
T ss_dssp             SEEEEEESHHHHHHHHHHHHCC
T ss_pred             CEEEEECCCCCCHHHHHHHhcc
Confidence            4678999999999999999863

>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8

Probab=91.92  E-value=0.049  Score=40.38  Aligned_cols=25  Identities=12%  Similarity=0.036  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+|+.++|...+||||++.+++-
T Consensus        22 ~~~~~i~iiG~~~~GKSTLi~~Ll~   46 (434)
T 1zun_B           22 KEMLRFLTCGNVDDGKSTLIGRLLH   46 (434)
T ss_dssp             CEEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CCceEEEEEECCCCCHHHHHHHHHh
Confidence            3468999999999999999999863

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*

Probab=91.87  E-value=0.058  Score=43.92  Aligned_cols=23  Identities=9%  Similarity=0.076  Sum_probs=20.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.|+|...|||||++++++.+.
T Consensus       609 i~~ItGpNGsGKSTlLr~iagl~  631 (800)
T 1wb9_A          609 MLIITGPNMGGKSTYMRQTALIA  631 (800)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCChHHHHHHHHHHH
Confidence            47899999999999999988764

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*

Probab=91.85  E-value=0.063  Score=36.69  Aligned_cols=23  Identities=22%  Similarity=0.192  Sum_probs=20.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+||.|..++||||+++++.-..
T Consensus        49 ~~ll~G~~GtGKt~la~~la~~~   71 (311)
T 4fcw_A           49 SFLFLGPTGVGKTELAKTLAATL   71 (311)
T ss_dssp             EEEEESCSSSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCcCHHHHHHHHHHHH
Confidence            58999999999999999887654

>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana}

Probab=91.81  E-value=0.057  Score=40.78  Aligned_cols=25  Identities=12%  Similarity=-0.060  Sum_probs=22.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....|++++|...+|||||+.++.-
T Consensus        32 ~~~~kI~IvG~~~vGKSTLin~L~~   56 (423)
T 3qq5_A           32 GFRRYIVVAGRRNVGKSSFMNALVG   56 (423)
T ss_dssp             CCCEEEEEECSCSTTTTTTTTSSCC
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHc
Confidence            3568999999999999999998864

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}

Probab=91.74  E-value=0.059  Score=41.75  Aligned_cols=24  Identities=17%  Similarity=0.140  Sum_probs=21.3

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+++++|...+|||||+.++.-
T Consensus        64 ~~~~V~vvG~~n~GKSTLIN~Llg   87 (550)
T 2qpt_A           64 GKPMVLVAGQYSTGKTSFIQYLLE   87 (550)
T ss_dssp             SCCEEEEEEBTTSCHHHHHHHHHT
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhC
Confidence            457899999999999999999873

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...

Probab=91.73  E-value=0.058  Score=39.48  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=18.8

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++.|.+.||||||+++++.-.
T Consensus        64 v~I~G~pGsGKTtLal~la~~~   85 (349)
T 2zr9_A           64 IEIYGPESSGKTTVALHAVANA   85 (349)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHH
Confidence            6888999999999999987543

>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens}

Probab=91.73  E-value=0.069  Score=40.41  Aligned_cols=25  Identities=12%  Similarity=0.025  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ....++.++|-..+||||++++++-
T Consensus        20 ~~~~kvgIVG~pnvGKSTL~n~Ltg   44 (396)
T 2ohf_A           20 GTSLKIGIVGLPNVGKSTFFNVLTN   44 (396)
T ss_dssp             SSCCCEEEECCSSSSHHHHHHHHHC
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHHC
Confidence            4568999999999999999999874

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}

Probab=91.73  E-value=0.068  Score=37.05  Aligned_cols=25  Identities=12%  Similarity=-0.008  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .--++|.|.+++||||++++++--.
T Consensus        44 ~~~vll~G~~G~GKT~l~~~~~~~~   68 (387)
T 2v1u_A           44 PSNALLYGLTGTGKTAVARLVLRRL   68 (387)
T ss_dssp             CCCEEECBCTTSSHHHHHHHHHHHH
T ss_pred             CCcEEEECCCCCCHHHHHHHHHHHH
Confidence            3468999999999999999887543

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=91.72  E-value=0.17  Score=35.68  Aligned_cols=21  Identities=24%  Similarity=0.260  Sum_probs=18.8

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +|+.|..++||||++++++-.
T Consensus        49 ~ll~Gp~G~GKTtla~~la~~   69 (340)
T 1sxj_C           49 LLFYGPPGTGKTSTIVALARE   69 (340)
T ss_dssp             EEEECSSSSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            799999999999999987654

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}

Probab=91.72  E-value=0.07  Score=39.50  Aligned_cols=24  Identities=17%  Similarity=0.095  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|+.++|-..+||||++.+++-
T Consensus       174 ~~~ki~lvG~~nvGKSSLin~l~~  197 (436)
T 2hjg_A          174 EVIQFCLIGRPNVGKSSLVNAMLG  197 (436)
T ss_dssp             TCEEEEEECSTTSSHHHHHHHHHT
T ss_pred             cCcEEEEEcCCCCCHHHHHHHHhC
Confidence            458999999999999999998863

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}

Probab=91.66  E-value=0.063  Score=42.40  Aligned_cols=21  Identities=19%  Similarity=0.230  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +-|+|..+||||||++.+.-.
T Consensus       381 v~iiG~NGsGKSTLlk~l~Gl  401 (608)
T 3j16_B          381 LVMMGENGTGKTTLIKLLAGA  401 (608)
T ss_dssp             EEEESCTTSSHHHHHHHHHTS
T ss_pred             EEEECCCCCcHHHHHHHHhcC
Confidence            579999999999999988754

>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str}

Probab=91.66  E-value=0.12  Score=37.89  Aligned_cols=25  Identities=4%  Similarity=-0.085  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ...++.++|...+|||||+.++.-.
T Consensus       159 ~~~~i~~vG~~nvGKStliN~L~~~  183 (368)
T 3h2y_A          159 GGKDVYVVGCTNVGKSTFINRMIKE  183 (368)
T ss_dssp             TTSCEEEEEBTTSSHHHHHHHHHHH
T ss_pred             ccceEEEecCCCCChhHHHHHHHhh
Confidence            4568999999999999999998653

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}

Probab=91.61  E-value=0.16  Score=35.25  Aligned_cols=34  Identities=21%  Similarity=0.304  Sum_probs=24.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceeeeCceeEE
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEI   70 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~   70 (76)
                      =+|+.|.+++||||+..++--  .---++.++.|.|
T Consensus        18 gvli~G~SGaGKStlal~L~~--rG~~lvaDD~v~i   51 (181)
T 3tqf_A           18 GVLITGEANIGKSELSLALID--RGHQLVCDDVIDL   51 (181)
T ss_dssp             EEEEEESSSSSHHHHHHHHHH--TTCEEEESSEEEE
T ss_pred             EEEEEcCCCCCHHHHHHHHHH--cCCeEecCCEEEE
Confidence            479999999999999987743  2234566666655

>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus}

Probab=91.51  E-value=0.072  Score=34.87  Aligned_cols=23  Identities=13%  Similarity=0.134  Sum_probs=19.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+.|.|..+|||||+.+.+.-.
T Consensus         4 ~~i~i~G~~gsGkst~~~~l~~~   26 (219)
T 2h92_A            4 INIALDGPAAAGKSTIAKRVASE   26 (219)
T ss_dssp             CCEEEECCTTSSHHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHHh
Confidence            45889999999999999876543

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10

Probab=91.49  E-value=0.073  Score=35.77  Aligned_cols=21  Identities=10%  Similarity=-0.032  Sum_probs=17.5

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+.+.|..+|||||++..+.-
T Consensus         6 ~i~i~G~sGsGKTTl~~~L~~   26 (169)
T 1xjc_A            6 VWQVVGYKHSGKTTLMEKWVA   26 (169)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            367889999999999987754

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1

Probab=91.46  E-value=0.066  Score=35.99  Aligned_cols=22  Identities=18%  Similarity=0.102  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .|.+-|..+|||||+++.++--
T Consensus         4 ~i~~~G~~g~GKtt~~~~l~~~   25 (241)
T 2ocp_A            4 RLSIEGNIAVGKSTFVKLLTKT   25 (241)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHH
T ss_pred             EEEEEcCCCCCHHHHHHHHHHH
Confidence            4678899999999999887643

>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis}

Probab=91.41  E-value=0.068  Score=39.54  Aligned_cols=22  Identities=5%  Similarity=-0.082  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++.++|.+.+||||++.+++-
T Consensus         4 ~~V~ivG~~nvGKStL~n~l~~   25 (436)
T 2hjg_A            4 PVVAIVGRPNVGKSTIFNRIAG   25 (436)
T ss_dssp             CEEEEECSTTSSHHHHHHHHEE
T ss_pred             CEEEEECCCCCCHHHHHHHHhC
Confidence            5899999999999999998863

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*

Probab=91.40  E-value=0.079  Score=37.72  Aligned_cols=26  Identities=19%  Similarity=0.214  Sum_probs=21.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      -+++.|...||||||+.+++.-..+|
T Consensus       109 i~~i~G~~GsGKT~la~~la~~~~~~  134 (324)
T 2z43_A          109 MTEFFGEFGSGKTQLCHQLSVNVQLP  134 (324)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHTTSC
T ss_pred             EEEEECCCCCCHhHHHHHHHHHHhcc
Confidence            46888999999999999998764433

>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus}

Probab=91.36  E-value=0.11  Score=40.24  Aligned_cols=27  Identities=19%  Similarity=0.226  Sum_probs=23.5

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||.|..++||||++++++-....|..
T Consensus        67 vLL~GppGtGKTtLaraIa~~~~~~~i   93 (499)
T 2dhr_A           67 VLLVGPPGVGKTHLARAVAGEARVPFI   93 (499)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHTTCCEE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            799999999999999999977666653

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A

Probab=91.36  E-value=0.086  Score=38.05  Aligned_cols=25  Identities=24%  Similarity=0.312  Sum_probs=20.7

Q ss_pred             ceeeccCCCccchhhhhhhhhhccc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      =+++.|...||||||+.+++.-...
T Consensus       124 i~~I~G~~GsGKTtla~~la~~~~~  148 (343)
T 1v5w_A          124 ITEAFGEFRTGKTQLSHTLCVTAQL  148 (343)
T ss_dssp             EEEEECCTTCTHHHHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHhc
Confidence            3688899999999999999876433

>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae}

Probab=91.32  E-value=0.18  Score=39.63  Aligned_cols=24  Identities=13%  Similarity=0.112  Sum_probs=21.6

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +..+|+.++|...+||||++.++.
T Consensus       165 k~~lkV~ivG~~n~GKSTLin~Ll  188 (611)
T 3izq_1          165 LPHLSFVVLGHVDAGKSTLMGRLL  188 (611)
T ss_dssp             CCCCEEEEECCSSSCHHHHHHHHH
T ss_pred             CCceEEEEEECCCCCHHHHHHHHH
Confidence            457899999999999999999875

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10

Probab=91.30  E-value=0.17  Score=36.40  Aligned_cols=25  Identities=12%  Similarity=-0.000  Sum_probs=21.0

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+-..+.++|.+++||||++..+..
T Consensus        54 ~~~~~i~i~G~~g~GKSTl~~~l~~   78 (341)
T 2p67_A           54 GNTLRLGVTGTPGAGKSTFLEAFGM   78 (341)
T ss_dssp             SCSEEEEEEECTTSCHHHHHHHHHH
T ss_pred             CCCEEEEEEcCCCCCHHHHHHHHHH
Confidence            3456788999999999999999863

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*

Probab=91.24  E-value=0.071  Score=38.11  Aligned_cols=22  Identities=14%  Similarity=0.176  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++++|.++|||||++..+...
T Consensus       107 vi~lvG~~GsGKTTl~~~LA~~  128 (296)
T 2px0_A          107 YIVLFGSTGAGKTTTLAKLAAI  128 (296)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            5788999999999999887643

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}

Probab=91.23  E-value=0.078  Score=37.78  Aligned_cols=25  Identities=16%  Similarity=0.077  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .--++|.|..++|||+++.+++--.
T Consensus       152 ~~~lll~G~~GtGKT~La~aia~~~  176 (308)
T 2qgz_A          152 QKGLYLYGDMGIGKSYLLAAMAHEL  176 (308)
T ss_dssp             CCEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CceEEEECCCCCCHHHHHHHHHHHH
Confidence            3568999999999999999887543

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A

Probab=91.20  E-value=0.073  Score=44.66  Aligned_cols=20  Identities=10%  Similarity=-0.006  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.|+|..+|||||+++.++
T Consensus       463 ~v~LiGpNGsGKSTLLk~La  482 (986)
T 2iw3_A          463 RYGICGPNGCGKSTLMRAIA  482 (986)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            46899999999999999987

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A

Probab=91.18  E-value=0.087  Score=36.99  Aligned_cols=27  Identities=7%  Similarity=-0.063  Sum_probs=22.3

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||-|..++|||+++++++--...|+.
T Consensus        39 lLl~GppGtGKT~la~aiA~~l~~~~i   65 (293)
T 3t15_A           39 LGIWGGKGQGKSFQCELVFRKMGINPI   65 (293)
T ss_dssp             EEEEECTTSCHHHHHHHHHHHHTCCCE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            455599999999999999987766654

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*

Probab=91.15  E-value=0.073  Score=37.44  Aligned_cols=22  Identities=14%  Similarity=0.084  Sum_probs=19.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =+++.|...||||||+.+++.-
T Consensus       100 i~~i~G~~gsGKT~la~~la~~  121 (322)
T 2i1q_A          100 VTEFAGVFGSGKTQIMHQSCVN  121 (322)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            3688899999999999999864

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}

Probab=91.15  E-value=0.073  Score=41.57  Aligned_cols=19  Identities=11%  Similarity=-0.109  Sum_probs=16.4

Q ss_pred             ceeeccCCCccchhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~   53 (76)
                      .+.++|..+|||||+++.+
T Consensus       350 ~vaIiGpnGsGKSTLl~~i  368 (670)
T 3ux8_A          350 FVAVTGVSGSGKSTLVNEV  368 (670)
T ss_dssp             EEEEECSTTSSHHHHHTTT
T ss_pred             EEEEEeeCCCCHHHHHHHH
Confidence            4679999999999999764

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}

Probab=91.07  E-value=0.13  Score=37.12  Aligned_cols=30  Identities=17%  Similarity=0.185  Sum_probs=26.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      .-+||.|..++|||+++++++--...|++.
T Consensus       149 ~~vLL~GppGtGKT~la~aia~~~~~~~~~  178 (389)
T 3vfd_A          149 RGLLLFGPPGNGKTMLAKAVAAESNATFFN  178 (389)
T ss_dssp             SEEEEESSTTSCHHHHHHHHHHHTTCEEEE
T ss_pred             ceEEEECCCCCCHHHHHHHHHHhhcCcEEE
Confidence            468999999999999999999887777654

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B

Probab=91.05  E-value=0.076  Score=38.04  Aligned_cols=22  Identities=18%  Similarity=0.063  Sum_probs=18.9

Q ss_pred             eeccCCCccchhhhhhhhhhcc
Q psy6625          37 LLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~~~   58 (76)
                      ++.|..+|||||++.|+|....
T Consensus        27 ~i~G~NGsGKS~lleAi~~~l~   48 (339)
T 3qkt_A           27 LIIGQNGSGKSSLLDAILVGLY   48 (339)
T ss_dssp             EEECCTTSSHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHHhc
Confidence            6889999999999999876443

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A

Probab=91.02  E-value=0.098  Score=40.19  Aligned_cols=27  Identities=11%  Similarity=0.074  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      -+||.|..++||||+++++.-....|.
T Consensus       110 ~vll~Gp~GtGKTtlar~ia~~l~~~~  136 (543)
T 3m6a_A          110 ILCLAGPPGVGKTSLAKSIAKSLGRKF  136 (543)
T ss_dssp             EEEEESSSSSSHHHHHHHHHHHHTCEE
T ss_pred             EEEEECCCCCCHHHHHHHHHHhcCCCe
Confidence            479999999999999999987776554

>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A*

Probab=90.92  E-value=0.14  Score=40.34  Aligned_cols=24  Identities=25%  Similarity=0.081  Sum_probs=21.3

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+..++.++|..++||||++.+++
T Consensus         7 ~~~~~i~IiG~~gaGKTTLl~~L~   30 (665)
T 2dy1_A            7 AMIRTVALVGHAGSGKTTLTEALL   30 (665)
T ss_dssp             CCEEEEEEEESTTSSHHHHHHHHH
T ss_pred             CCCcEEEEECCCCChHHHHHHHHH
Confidence            345689999999999999999998

>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus}

Probab=90.80  E-value=0.17  Score=39.32  Aligned_cols=38  Identities=16%  Similarity=0.149  Sum_probs=25.8

Q ss_pred             HHHHHHHHhHH-hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          18 QIEKNLKEDGI-QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        18 ~IDk~L~kekk-~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++.+.+++..+ .......|++.|..+|||||+.+.+.-
T Consensus       356 eV~~~lr~~~~~~~~~~~~I~l~G~~GsGKSTia~~La~  394 (546)
T 2gks_A          356 EVAEILAETYVPKHKQGFCVWLTGLPCAGKSTIAEILAT  394 (546)
T ss_dssp             HHHHHHHHHSCCGGGCCEEEEEECSTTSSHHHHHHHHHH
T ss_pred             hHHHHHHHhhccccccceEEEccCCCCCCHHHHHHHHHH
Confidence            34444554432 223445688899999999999998764

>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*

Probab=90.75  E-value=0.085  Score=41.94  Aligned_cols=23  Identities=26%  Similarity=0.088  Sum_probs=19.4

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .--+|+.|+.+||||++++.+..
T Consensus       214 ~pHlLIaG~TGSGKS~~L~tlI~  236 (574)
T 2iut_A          214 MPHLLVAGTTGSGKSVGVNAMLL  236 (574)
T ss_dssp             SCCEEEECCTTSSHHHHHHHHHH
T ss_pred             CCeeEEECCCCCCHHHHHHHHHH
Confidence            35689999999999999988654

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20

Probab=90.63  E-value=0.098  Score=36.15  Aligned_cols=22  Identities=23%  Similarity=0.233  Sum_probs=19.6

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +||.|..++||||++++++-..
T Consensus        61 ~ll~G~~G~GKT~la~~la~~l   82 (353)
T 1sxj_D           61 MLFYGPPGTGKTSTILALTKEL   82 (353)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            8999999999999999887653

>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W*

Probab=90.60  E-value=0.11  Score=40.13  Aligned_cols=25  Identities=8%  Similarity=-0.002  Sum_probs=22.5

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+..++.++|..++||||++.+++-
T Consensus        11 ~~~~~I~IiG~~~aGKTTL~~~Ll~   35 (529)
T 2h5e_A           11 AKRRTFAIISHPDAGKTTITEKVLL   35 (529)
T ss_dssp             HTEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             cCCCEEEEECCCCChHHHHHHHHHh
Confidence            4568999999999999999999974

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*

Probab=90.56  E-value=0.088  Score=43.95  Aligned_cols=23  Identities=9%  Similarity=-0.006  Sum_probs=19.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -++++|...|||||+++++..+.
T Consensus       791 i~~ItGpNgsGKSTlLr~iGl~~  813 (1022)
T 2o8b_B          791 CVLVTGPNMGGKSTLMRQAGLLA  813 (1022)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCChHHHHHHHHHHH
Confidence            47899999999999999986654

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10

Probab=90.55  E-value=0.097  Score=37.81  Aligned_cols=22  Identities=9%  Similarity=0.125  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+++.|.++|||||++..+.-.
T Consensus       106 vi~ivG~~GsGKTTl~~~LA~~  127 (306)
T 1vma_A          106 VIMVVGVNGTGKTTSCGKLAKM  127 (306)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEEEcCCCChHHHHHHHHHHH
Confidence            4789999999999999887754

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}

Probab=90.51  E-value=0.098  Score=38.88  Aligned_cols=22  Identities=14%  Similarity=0.241  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.+.|...||||||+..+.--
T Consensus         9 lI~I~GptgSGKTtla~~La~~   30 (340)
T 3d3q_A            9 LIVIVGPTASGKTELSIEVAKK   30 (340)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHH
T ss_pred             eEEEECCCcCcHHHHHHHHHHH
Confidence            3688999999999999877654

>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B*

Probab=90.49  E-value=0.11  Score=38.60  Aligned_cols=18  Identities=17%  Similarity=0.113  Sum_probs=16.6

Q ss_pred             ceeeccCCCccchhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLA   52 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~   52 (76)
                      |++|+|-+.+|||+++..
T Consensus         1 KIvllGdsgvGKTSLl~~   18 (331)
T 3r7w_B            1 MVLLMGVRRCGKSSICKV   18 (331)
T ss_dssp             CEEEECSTTSSTTHHHHH
T ss_pred             CEEEECCCCCCHHHHHHH
Confidence            789999999999999964

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G

Probab=90.41  E-value=0.091  Score=36.39  Aligned_cols=24  Identities=17%  Similarity=0.213  Sum_probs=21.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -+||.|..++||||++++++-...
T Consensus        47 ~vLl~G~~GtGKT~la~~la~~~~   70 (350)
T 1g8p_A           47 GVLVFGDRGTGKSTAVRALAALLP   70 (350)
T ss_dssp             CEEEECCGGGCTTHHHHHHHHHSC
T ss_pred             eEEEECCCCccHHHHHHHHHHhCc
Confidence            489999999999999999887554

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*

Probab=90.36  E-value=0.099  Score=43.40  Aligned_cols=21  Identities=5%  Similarity=-0.065  Sum_probs=18.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -++|+|...|||||++++...
T Consensus       664 i~~ItGpNGsGKSTlLr~ial  684 (934)
T 3thx_A          664 FHIITGPNMGGKSTYIRQTGV  684 (934)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            378899999999999998843

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}

Probab=90.34  E-value=0.28  Score=34.26  Aligned_cols=22  Identities=18%  Similarity=0.081  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+||.|.+++||||++++..--
T Consensus        47 ~vll~G~~G~GKT~la~~l~~~   68 (384)
T 2qby_B           47 SNLFLGLTGTGKTFVSKYIFNE   68 (384)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHH
T ss_pred             cEEEECCCCCCHHHHHHHHHHH
Confidence            5799999999999999887653

>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E*

Probab=90.28  E-value=0.13  Score=39.50  Aligned_cols=27  Identities=19%  Similarity=0.319  Sum_probs=23.8

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||.|..++||||++++++--...|..
T Consensus        52 vLL~GppGtGKT~Laraia~~~~~~f~   78 (476)
T 2ce7_A           52 ILLVGPPGTGKTLLARAVAGEANVPFF   78 (476)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHHTCCEE
T ss_pred             EEEECCCCCCHHHHHHHHHHHcCCCee
Confidence            899999999999999999887766654

>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A*

Probab=90.27  E-value=0.12  Score=40.36  Aligned_cols=26  Identities=23%  Similarity=0.175  Sum_probs=21.3

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-..|++-|-.+|||||+.+++.-..
T Consensus       395 ~~~~I~l~GlsGSGKSTiA~~La~~L  420 (573)
T 1m8p_A          395 QGFTIFLTGYMNSGKDAIARALQVTL  420 (573)
T ss_dssp             CCEEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             cceEEEeecCCCCCHHHHHHHHHHHh
Confidence            34568899999999999999886543

>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A*

Probab=90.27  E-value=0.1  Score=40.14  Aligned_cols=21  Identities=14%  Similarity=0.102  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -|+|.|-.+|||||+.+.+.-
T Consensus        37 lIvlvGlpGSGKSTia~~La~   57 (520)
T 2axn_A           37 VIVMVGLPARGKTYISKKLTR   57 (520)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            478999999999999998753

>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A*

Probab=90.26  E-value=0.2  Score=38.95  Aligned_cols=40  Identities=23%  Similarity=0.228  Sum_probs=27.7

Q ss_pred             HHHHHHHHhHH-hhhCccceeeccCCCccchhhhhhhhhhc
Q psy6625          18 QIEKNLKEDGI-QAAKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        18 ~IDk~L~kekk-~~~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++.+.+++..+ ...+...|.|-|-.+|||||+.+++--.-
T Consensus       379 eV~~vLr~~~~~~~~~~~~I~l~GlsGsGKSTIa~~La~~L  419 (511)
T 1g8f_A          379 EVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTF  419 (511)
T ss_dssp             HHHHHHHHHSCCGGGCCEEEEECTTCCSCHHHHHHHHHHHH
T ss_pred             hhHHHHHHhcccccccceEEEecccCCCCHHHHHHHHHHHH
Confidence            34444555432 34456789999999999999998875543

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*

Probab=90.26  E-value=0.11  Score=38.85  Aligned_cols=23  Identities=9%  Similarity=-0.006  Sum_probs=20.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+||.|..++||||++++++-..
T Consensus       132 ~lll~Gp~G~GKTtLa~aia~~l  154 (440)
T 2z4s_A          132 PLFIYGGVGLGKTHLLQSIGNYV  154 (440)
T ss_dssp             CEEEECSSSSSHHHHHHHHHHHH
T ss_pred             eEEEECCCCCCHHHHHHHHHHHH
Confidence            57999999999999999987544

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}

Probab=90.21  E-value=0.11  Score=38.68  Aligned_cols=21  Identities=5%  Similarity=-0.043  Sum_probs=18.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|+.|.++|||||++.++.-
T Consensus        47 ~~li~G~aGTGKT~ll~~~~~   67 (459)
T 3upu_A           47 HVTINGPAGTGATTLTKFIIE   67 (459)
T ss_dssp             EEEEECCTTSCHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHH
Confidence            679999999999999987653

>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2

Probab=90.19  E-value=0.22  Score=36.61  Aligned_cols=36  Identities=19%  Similarity=0.306  Sum_probs=26.2

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceeeeCceeEEe
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIG   71 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~~   71 (76)
                      .=+|+.|.+++||||++.++.--  ---.+.+..|.|.
T Consensus       145 ~~vl~~G~sG~GKSt~a~~l~~~--g~~lv~dD~~~i~  180 (314)
T 1ko7_A          145 VGVLITGDSGIGKSETALELIKR--GHRLVADDNVEIR  180 (314)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHT--TCEEEESSEEEEE
T ss_pred             EEEEEEeCCCCCHHHHHHHHHhc--CCceecCCeEEEE
Confidence            45899999999999999887542  2345566666653

>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A*

Probab=90.17  E-value=0.11  Score=39.15  Aligned_cols=28  Identities=18%  Similarity=0.278  Sum_probs=23.6

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ..++|.|..+|||||+.++++-....|.
T Consensus        25 ~~i~l~G~~G~GKTTl~~~la~~l~~~f   52 (359)
T 2ga8_A           25 VCVILVGSPGSGKSTIAEELCQIINEKY   52 (359)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHHHHHHH
T ss_pred             eEEEEECCCCCcHHHHHHHHHHHhCCCe
Confidence            4689999999999999999887666554

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A

Probab=89.91  E-value=0.12  Score=38.57  Aligned_cols=22  Identities=5%  Similarity=0.067  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+++.|.+++|||||+++++.-
T Consensus       205 liiI~G~pG~GKTtl~l~ia~~  226 (454)
T 2r6a_A          205 LIIVAARPSVGKTAFALNIAQN  226 (454)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4678899999999999998763

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}

Probab=89.91  E-value=0.16  Score=36.17  Aligned_cols=27  Identities=19%  Similarity=0.218  Sum_probs=22.4

Q ss_pred             ceeeccCCCccchhhhhhhhhhc-ccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT-SKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~-~~~~   61 (76)
                      -+||.|..++|||++++++.--. ..|.
T Consensus        47 ~iLL~GppGtGKT~la~ala~~~~~~~~   74 (322)
T 1xwi_A           47 GILLFGPPGTGKSYLAKAVATEANNSTF   74 (322)
T ss_dssp             EEEEESSSSSCHHHHHHHHHHHTTSCEE
T ss_pred             eEEEECCCCccHHHHHHHHHHHcCCCcE
Confidence            48999999999999999998765 3443

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*

Probab=89.83  E-value=0.087  Score=43.70  Aligned_cols=22  Identities=5%  Similarity=0.075  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+.|+|...|||||++++++.+
T Consensus       675 i~~ItGPNGaGKSTlLr~i~~i  696 (918)
T 3thx_B          675 VMIITGPNMGGKSSYIKQVALI  696 (918)
T ss_dssp             EEEEESCCCHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCchHHHHHHHHHH
Confidence            3689999999999999998754

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}

Probab=89.82  E-value=0.17  Score=36.29  Aligned_cols=30  Identities=10%  Similarity=0.192  Sum_probs=24.7

Q ss_pred             ccceeeccCCCccchhhhhhhhhhccccee
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      ..-+||.|..++||||++++++--...|..
T Consensus       117 ~~~vLl~GppGtGKT~la~aia~~~~~~~~  146 (357)
T 3d8b_A          117 PKGILLFGPPGTGKTLIGKCIASQSGATFF  146 (357)
T ss_dssp             CSEEEEESSTTSSHHHHHHHHHHHTTCEEE
T ss_pred             CceEEEECCCCCCHHHHHHHHHHHcCCeEE
Confidence            345899999999999999999877666653

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*

Probab=89.73  E-value=0.12  Score=36.68  Aligned_cols=23  Identities=17%  Similarity=0.066  Sum_probs=19.2

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+.+.|.++|||||++..++..-
T Consensus       100 ~i~i~g~~G~GKTT~~~~la~~~  122 (295)
T 1ls1_A          100 LWFLVGLQGSGKTTTAAKLALYY  122 (295)
T ss_dssp             EEEEECCTTTTHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH
Confidence            46677999999999999888653

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*

Probab=89.72  E-value=0.17  Score=36.52  Aligned_cols=28  Identities=18%  Similarity=0.205  Sum_probs=23.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+||.|..++||||++++++--...|..
T Consensus        86 ~iLL~GppGtGKT~la~ala~~~~~~~~  113 (355)
T 2qp9_X           86 GILLYGPPGTGKSYLAKAVATEANSTFF  113 (355)
T ss_dssp             CEEEECSTTSCHHHHHHHHHHHHTCEEE
T ss_pred             eEEEECCCCCcHHHHHHHHHHHhCCCEE
Confidence            4899999999999999999887766654

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A

Probab=89.68  E-value=0.13  Score=37.94  Aligned_cols=21  Identities=14%  Similarity=0.173  Sum_probs=18.3

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|.+.||||||+.+++.-
T Consensus        66 i~I~G~pGsGKTtLal~la~~   86 (356)
T 1u94_A           66 VEIYGPESSGKTTLTLQVIAA   86 (356)
T ss_dssp             EEEECSTTSSHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            688899999999999988754

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A

Probab=89.59  E-value=0.094  Score=44.01  Aligned_cols=22  Identities=9%  Similarity=0.083  Sum_probs=19.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+.|+|..+|||||+++.++-.
T Consensus       701 ivaIiGpNGSGKSTLLklLaGl  722 (986)
T 2iw3_A          701 RIAVIGPNGAGKSTLINVLTGE  722 (986)
T ss_dssp             EEEECSCCCHHHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5789999999999999998864

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}

Probab=89.59  E-value=0.23  Score=34.59  Aligned_cols=28  Identities=18%  Similarity=0.062  Sum_probs=23.8

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      --+||.|..++||||++++++-....|.
T Consensus        47 ~~vll~G~pGtGKT~la~~la~~~~~~~   74 (331)
T 2r44_A           47 GHILLEGVPGLAKTLSVNTLAKTMDLDF   74 (331)
T ss_dssp             CCEEEESCCCHHHHHHHHHHHHHTTCCE
T ss_pred             CeEEEECCCCCcHHHHHHHHHHHhCCCe
Confidence            3689999999999999999987666554

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*

Probab=89.57  E-value=0.12  Score=36.17  Aligned_cols=24  Identities=8%  Similarity=0.206  Sum_probs=20.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      -+||.|..++||||++++++--..
T Consensus        72 ~vLl~GppGtGKT~la~~la~~l~   95 (368)
T 3uk6_A           72 AVLIAGQPGTGKTAIAMGMAQALG   95 (368)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHC
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhc
Confidence            589999999999999999876554

>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A

Probab=89.57  E-value=0.12  Score=38.92  Aligned_cols=24  Identities=17%  Similarity=0.210  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+++.++|-..+||||++.+++-
T Consensus         6 ~~~~i~iiG~~~~GKSTLi~~Ll~   29 (458)
T 1f60_A            6 SHINVVVIGHVDSGKSTTTGHLIY   29 (458)
T ss_dssp             EEEEEEEEECTTSCHHHHHHHHHH
T ss_pred             ceeEEEEEcCCCCCHHHHHHHHHH
Confidence            468999999999999999999864

>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A*

Probab=89.45  E-value=0.1  Score=39.59  Aligned_cols=26  Identities=23%  Similarity=0.243  Sum_probs=22.6

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +.+++.++|...+||||++.+++-..
T Consensus        18 ~~~~I~iiG~~d~GKSTLi~~L~~~~   43 (482)
T 1wb1_A           18 KNINLGIFGHIDHGKTTLSKVLTEIA   43 (482)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHTTC
T ss_pred             CCCEEEEECCCCChHHHHHHHHHCCC
Confidence            46899999999999999999987543

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A

Probab=89.40  E-value=0.14  Score=37.14  Aligned_cols=22  Identities=9%  Similarity=0.123  Sum_probs=18.2

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+++.|.++|||||++..+...
T Consensus       107 vI~ivG~~G~GKTT~~~~LA~~  128 (320)
T 1zu4_A          107 IFMLVGVNGTGKTTSLAKMANY  128 (320)
T ss_dssp             EEEEESSTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            3778899999999999877643

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A

Probab=89.37  E-value=0.14  Score=37.82  Aligned_cols=22  Identities=18%  Similarity=0.330  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .++|.|...|||||+.+.+.--
T Consensus         7 ~i~i~GptGsGKTtla~~La~~   28 (323)
T 3crm_A            7 AIFLMGPTAAGKTDLAMALADA   28 (323)
T ss_dssp             EEEEECCTTSCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999877643

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}

Probab=89.36  E-value=0.14  Score=37.93  Aligned_cols=21  Identities=14%  Similarity=-0.134  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -..++|..+|||||++.+++.
T Consensus        28 ~~~i~G~nG~GKttll~ai~~   48 (359)
T 2o5v_A           28 VTGIYGENGAGKTNLLEAAYL   48 (359)
T ss_dssp             EEEEECCTTSSHHHHHHHHHH
T ss_pred             eEEEECCCCCChhHHHHHHHH
Confidence            357899999999999999986

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}

Probab=89.34  E-value=0.14  Score=36.42  Aligned_cols=22  Identities=9%  Similarity=-0.005  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =+++-|.+.+|||||+.+++.-
T Consensus        70 l~li~G~pG~GKTtl~l~ia~~   91 (315)
T 3bh0_A           70 FVLIAARPSMGKTAFALKQAKN   91 (315)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHHH
Confidence            3678889999999999998754

>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2

Probab=89.16  E-value=0.25  Score=36.33  Aligned_cols=37  Identities=19%  Similarity=0.293  Sum_probs=26.3

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccceeeeCceeEEe
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIG   71 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~~   71 (76)
                      ..=+|+.|.+++||||+..++ +- .---.++++.|.|-
T Consensus       147 g~gvli~G~sG~GKStlal~l-~~-~G~~lv~DD~v~i~  183 (312)
T 1knx_A          147 GVGVLLTGRSGIGKSECALDL-IN-KNHLFVGDDAIEIY  183 (312)
T ss_dssp             TEEEEEEESSSSSHHHHHHHH-HT-TTCEEEEEEEEEEE
T ss_pred             CEEEEEEcCCCCCHHHHHHHH-HH-cCCEEEeCCEEEEE
Confidence            334799999999999999885 32 33345666666653

>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus}

Probab=89.09  E-value=0.15  Score=38.17  Aligned_cols=23  Identities=4%  Similarity=0.183  Sum_probs=20.9

Q ss_pred             hCccceeeccCCCccchhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~   53 (76)
                      +..+++.++|...+||||++.++
T Consensus        15 k~~~~i~iiG~~d~GKSTL~~~L   37 (439)
T 3j2k_7           15 KEHVNVVFIGHVDAGKSTIGGQI   37 (439)
T ss_pred             CceeEEEEEeCCCCCHHHHHHHH
Confidence            45789999999999999999887

>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A*

Probab=89.08  E-value=0.16  Score=37.73  Aligned_cols=24  Identities=17%  Similarity=0.110  Sum_probs=21.6

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ....|+.++|.+.+||||++.+++
T Consensus       193 ~~~~ki~ivG~~~vGKSslin~l~  216 (456)
T 4dcu_A          193 EEVIQFCLIGRPNVGKSSLVNAML  216 (456)
T ss_dssp             TTCEEEEEECSTTSSHHHHHHHHH
T ss_pred             cccceeEEecCCCCCHHHHHHHHh
Confidence            356899999999999999999987

>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1

Probab=89.06  E-value=0.15  Score=37.74  Aligned_cols=20  Identities=15%  Similarity=0.107  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ++.++|-+.+||||++..++
T Consensus         3 ~v~ivG~pnvGKStL~nrl~   22 (439)
T 1mky_A            3 TVLIVGRPNVGKSTLFNKLV   22 (439)
T ss_dssp             EEEEECCTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            78999999999999999987

>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus}

Probab=89.00  E-value=0.14  Score=40.01  Aligned_cols=24  Identities=8%  Similarity=0.011  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..+++++|...+||||++.+++-
T Consensus         3 r~pkV~IvG~~~vGKTSLl~~L~~   26 (537)
T 3izy_P            3 RSPVVTIMGHVDHGKTTLLDKLRK   26 (537)
T ss_dssp             CCCBCEEEESTTTTHHHHHHHHHH
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhC
Confidence            567899999999999999999873

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20

Probab=88.91  E-value=0.13  Score=36.44  Aligned_cols=22  Identities=9%  Similarity=0.064  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+|+-|.+++|||||..+++-.
T Consensus        60 ~ili~GPPGtGKTt~a~ala~~   81 (212)
T 1tue_A           60 CLVFCGPANTGKSYFGMSFIHF   81 (212)
T ss_dssp             EEEEESCGGGCHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            3899999999999999888754

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	76
d1svsa1	195	Transducin (alpha subunit) {Rat (Rattus norvegicus	97.96
d2bcjq2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	97.91
d1zcba2	200	Transducin (alpha subunit) {Mouse (Mus musculus) [	97.87
d1azta2	221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	97.76
d1zj6a1	177	ADP-ribosylation factor {Human (Homo sapiens), ARL	97.63
d1f6ba_	186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	97.63
d1ksha_	165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	97.59
d1ye8a1	178	Hypothetical kinase-like protein Aq_1292 {Aquifex	97.5
d1upta_	169	ADP-ribosylation factor {Human (Homo sapiens), ARL	97.47
d1fzqa_	176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	97.45
d1zd9a1	164	ADP-ribosylation factor {Human (Homo sapiens), ARL	97.45
d1z06a1	165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	97.38
d1kaoa_	167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	97.38
d2qtvb1	166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	97.37
d2erxa1	171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	97.36
d1e0sa_	173	ADP-ribosylation factor {Human (Homo sapiens), ARF	97.36
d2atva1	168	Ras-like estrogen-regulated growth inhibitor, RERG	97.34
d1r8sa_	160	ADP-ribosylation factor {Human (Homo sapiens), ARF	97.29
d1ctqa_	166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	97.28
d2erya1	171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	97.28
d1moza_	182	ADP-ribosylation factor {Baker's yeast (Saccharomy	97.27
d1z0ja1	167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	97.25
d1mh1a_	183	Rac {Human (Homo sapiens) [TaxId: 9606]}	97.2
d1ak2a1	190	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.18
d1c1ya_	167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	97.16
d1rkba_	173	Adenylate kinase {Human (Homo sapiens), isoenzyme	97.16
d1vg8a_	184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	97.14
d2bdta1	176	Hypothetical protein BH3686 {Bacillus halodurans [	97.13
d1u8za_	168	Ras-related protein RalA {Cotton-top tamarin (Sagu	97.1
d1z2aa1	164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	97.08
d2fn4a1	173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	97.06
d2f7sa1	186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	97.06
d1zina1	182	Adenylate kinase {Bacillus stearothermophilus [Tax	97.05
d1lw7a2	192	Transcriptional regulator NadR, ribosylnicotinamid	97.04
d1wmsa_	174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	97.02
d1y63a_	174	Probable kinase LmjF30.1890 {Leishmania major [Tax	97.02
d1x3sa1	177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	97.02
d2ew1a1	171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	97.01
d1qhxa_	178	Chloramphenicol phosphotransferase {Streptomyces v	97.01
d2bmea1	174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	97.0
d3raba_	169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	97.0
d2fu5c1	173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	96.98
d1xtqa1	167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	96.97
d1x1ra1	169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	96.95
d2ngra_	191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	96.95
d2gj8a1	161	Probable tRNA modification GTPase TrmE (MnmE), G d	96.94
d1g16a_	166	Rab-related protein Sec4 {Baker's yeast (Saccharom	96.94
d1ky3a_	175	Rab-related protein ypt7p {Baker's yeast (Saccharo	96.92
d1ly1a_	152	Polynucleotide kinase, kinase domain {Bacteriophag	96.9
d1z0fa1	166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	96.9
d1yzqa1	164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	96.87
d2gjsa1	168	Rad {Human (Homo sapiens) [TaxId: 9606]}	96.86
d2g3ya1	172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	96.86
d1r2qa_	170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	96.85
d1i2ma_	170	Ran {Human (Homo sapiens) [TaxId: 9606]}	96.84
d1s3ga1	182	Adenylate kinase {Bacillus globisporus [TaxId: 145	96.83
d1m7ba_	179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	96.83
d1kaga_	169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	96.82
d1ek0a_	170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	96.81
d2ak3a1	189	Adenylate kinase {Cow (Bos taurus), mitochondrial	96.81
d1teva_	194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	96.81
d1z08a1	167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	96.8
d1mkya2	186	Probable GTPase Der, N-terminal and middle domains	96.77
d2g6ba1	170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	96.76
d1h65a_	257	Chloroplast protein translocon GTPase Toc34 {Garde	96.76
d1e4va1	179	Adenylate kinase {Escherichia coli [TaxId: 562]}	96.75
d1akya1	180	Adenylate kinase {Baker's yeast (Saccharomyces cer	96.75
d2cdna1	181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	96.73
d1kmqa_	177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	96.72
d2atxa1	185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	96.72
d2bmja1	175	Centaurin gamma 1, G domain {Human (Homo sapiens)	96.7
d2i3ba1	189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	96.69
d1m8pa3	183	ATP sulfurylase C-terminal domain {Fungus (Penicil	96.65
d1knqa_	171	Gluconate kinase {Escherichia coli [TaxId: 562]}	96.61
d2a5ja1	173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	96.6
d1bifa1	213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	96.59
d2bcgy1	194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	96.55
d2f9la1	175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	96.51
d1yj5a2	172	5' polynucleotide kinase-3' phosphatase, C-termina	96.49
d1zaka1	189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	96.44
d1xzpa2	160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	96.43
d1qf9a_	194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	96.41
d3adka_	194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	96.4
d1svia_	195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	96.31
d1ukza_	196	Uridylate kinase {Baker's yeast (Saccharomyces cer	96.31
d1zp6a1	176	Hypothetical protein Atu3015 {Agrobacterium tumefa	96.23
d1qhla_	222	Cell division protein MukB {Escherichia coli [TaxI	96.21
d1x6va3	195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	96.2
d1wf3a1	178	GTPase Era, N-terminal domain {Thermus thermophilu	96.12
d2cxxa1	184	GTP-binding protein engB {Pyrococcus horikoshii [T	96.11
d1puia_	188	Probable GTPase EngB {Escherichia coli [TaxId: 562	96.09
d1yrba1	244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	96.08
d1gvnb_	273	Plasmid maintenance system epsilon/zeta, toxin zet	96.05
d1np6a_	170	Molybdopterin-guanine dinucleotide biosynthesis pr	96.02
d1mkya1	171	Probable GTPase Der, N-terminal and middle domains	96.02
d2fh5b1	207	Signal recognition particle receptor beta-subunit	95.97
d1nrjb_	209	Signal recognition particle receptor beta-subunit	95.89
d2iyva1	165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	95.89
d1e6ca_	170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	95.82
d1sgwa_	200	Putative ABC transporter PF0895 {Pyrococcus furios	95.75
d1nksa_	194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	95.71
d1khta_	190	Adenylate kinase {Archaeon Methanococcus voltae [T	95.7
d1rz3a_	198	Hypothetical protein rbstp0775 {Bacillus stearothe	95.64
d1g2912	240	Maltose transport protein MalK, N-terminal domain	95.56
d1n0wa_	242	DNA repair protein Rad51, catalytic domain {Human	95.47
g1xew.1	329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	95.47
g1ii8.1	369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	95.46
d2pmka1	241	Haemolysin B ATP-binding protein {Escherichia coli	95.45
d1udxa2	180	Obg GTP-binding protein middle domain {Thermus the	95.44
d3b60a1	253	Multidrug resistance ABC transporter MsbA, C-termi	95.38
d1in4a2	238	Holliday junction helicase RuvB {Thermotoga mariti	95.37
d1viaa_	161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	95.34
d1mv5a_	242	Multidrug resistance ABC transporter LmrA, C-termi	95.26
d1v43a3	239	Hypothetical protein PH0022, N-terminal domain {Py	95.22
d1d2na_	246	Hexamerization domain of N-ethylmalemide-sensitive	95.19
d1l8qa2	213	Chromosomal replication initiation factor DnaA {Aq	95.19
d1jj7a_	251	Peptide transporter Tap1, C-terminal ABC domain {H	95.12
d1egaa1	179	GTPase Era, N-terminal domain {Escherichia coli [T	95.02
d1uj2a_	213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	95.02
d1sxje2	252	Replication factor C5 {Baker's yeast (Saccharomyce	95.01
d2hyda1	255	Putative multidrug export ATP-binding/permease pro	94.97
d2i1qa2	258	DNA repair protein Rad51, catalytic domain {Archae	94.95
d1znwa1	182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	94.93
d1r7ra3	265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	94.91
d1r0wa_	281	Cystic fibrosis transmembrane conductance regulato	94.91
d1gkya_	186	Guanylate kinase {Baker's yeast (Saccharomyces cer	94.82
d1l2ta_	230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	94.8
d1sxjd2	237	Replication factor C2 {Baker's yeast (Saccharomyce	94.73
d1g6oa_	323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	94.71
d1e69a_	308	Smc head domain {Thermotoga maritima [TaxId: 2336]	94.71
d1ixsb2	239	Holliday junction helicase RuvB {Thermus thermophi	94.66
d2awna2	232	Maltose transport protein MalK, N-terminal domain	94.59
d1sxja2	253	Replication factor C1 {Baker's yeast (Saccharomyce	94.58
d2onka1	240	Molybdate/tungstate import ATP-binding protein Wtp	94.57
g1f2t.1	292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	94.54
d1pzna2	254	DNA repair protein Rad51, catalytic domain {Archae	94.53
d1tq4a_	400	Interferon-inducible GTPase {Mouse (Mus musculus)	94.53
d1e32a2	258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	94.45
d2a5yb3	277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	94.4
d1iqpa2	231	Replication factor C {Archaeon Pyrococcus furiosus	94.34
d1xjca_	165	Molybdopterin-guanine dinucleotide biosynthesis pr	94.33
d1sxjc2	227	Replication factor C3 {Baker's yeast (Saccharomyce	94.33
d1nlfa_	274	Hexameric replicative helicase repA {Escherichia c	94.31
d1l7vc_	231	ABC transporter involved in vitamin B12 uptake, Bt	94.24
d2fnaa2	283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	94.21
d1uf9a_	191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	94.19
d1oxxk2	242	Glucose transport protein GlcV, N-terminal domain	94.19
d1szpa2	251	DNA repair protein Rad51, catalytic domain {Baker'	94.18
d1wb1a4	179	Elongation factor SelB, N-terminal domain {Methano	94.16
d3d31a2	229	Sulfate/molybdate ABC transporter, ATP-binding pro	94.07
d1pjra1	318	DEXX box DNA helicase {Bacillus stearothermophilus	94.0
d1lvga_	190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	93.99
d3dhwc1	240	Methionine import ATP-binding protein MetN {Escher	93.91
d1b0ua_	258	ATP-binding subunit of the histidine permease {Sal	93.85
d1uaaa1	306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	93.8
d1kgda_	178	Guanylate kinase-like domain of Cask {Human (Homo	93.74
d1v5wa_	258	Meiotic recombination protein DMC1/LIM15 homolog {	93.67
d1lnza2	185	Obg GTP-binding protein middle domain {Bacillus su	93.63
d2vp4a1	197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	93.63
d1ixza_	247	AAA domain of cell division protein FtsH {Thermus	93.56
d1q3ta_	223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	93.55
d1ckea_	225	CMP kinase {Escherichia coli [TaxId: 562]}	93.51
d1ji0a_	240	Branched chain aminoacid ABC transporter {Thermoto	93.44
d1knxa2	177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	93.34
d2akab1	299	Dynamin G domain {Rat (Rattus norvegicus) [TaxId:	93.29
d1lv7a_	256	AAA domain of cell division protein FtsH {Escheric	93.28
d1w1wa_	427	Smc head domain {Baker's yeast (Saccharomyces cere	93.25
d1vhta_	208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	93.17
d1fnna2	276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	93.11
d1g6ha_	254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	92.99
d1u0ja_	267	Rep 40 protein helicase domain {Adeno-associated v	92.95
d1jjva_	205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	92.88
d1ewqa2	224	DNA repair protein MutS, the C-terminal domain {Th	92.87
d2p67a1	327	LAO/AO transport system kinase ArgK {Escherichia c	92.85
d1jwyb_	306	Dynamin G domain {Dictyostelium discoideum [TaxId:	92.67
d1ko7a2	169	HPr kinase HprK C-terminal domain {Staphylococcus	92.66
d1sxjb2	224	Replication factor C4 {Baker's yeast (Saccharomyce	92.66
d1m7ga_	208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	92.6
d1tf7a1	242	Circadian clock protein KaiC {Synechococcus sp. st	92.59
d1odfa_	286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	92.54
d1wb9a2	234	DNA repair protein MutS, the C-terminal domain {Es	92.51
d1vpla_	238	Putative ABC transporter TM0544 {Thermotoga mariti	92.32
d1s96a_	205	Guanylate kinase {Escherichia coli [TaxId: 562]}	92.26
d1tf7a2	242	Circadian clock protein KaiC {Synechococcus sp. st	92.24
d2c78a3	204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	92.09
d2qm8a1	323	Metallochaperone MeaB {Methylobacterium extorquens	91.74
d1kkma_	176	HPr kinase HprK C-terminal domain {Lactobacillus c	91.7
d1ny5a2	247	Transcriptional activator sigm54 (NtrC1), C-termin	91.6
d1deka_	241	Deoxynucleoside monophosphate kinase {Bacteriophag	91.48
d1ofha_	309	HslU {Haemophilus influenzae [TaxId: 727]}	91.33
d1cr2a_	277	Gene 4 protein (g4p, DNA primase), helicase domain	91.22
d1e9ra_	433	Bacterial conjugative coupling protein TrwB {Esche	91.13
d1sq5a_	308	Pantothenate kinase PanK {Escherichia coli [TaxId:	90.86
d1p9ra_	401	Extracellular secretion NTPase EpsE {Vibrio choler	90.8
d1g8pa_	333	ATPase subunit of magnesium chelatase, BchI {Rhodo	90.6
d1w5sa2	287	CDC6-like protein APE0152, N-terminal domain {Aero	90.41
g1qhh.1	623	DEXX box DNA helicase {Bacillus stearothermophilus	90.14
d1kk1a3	195	Initiation factor eIF2 gamma subunit, N-terminal (	89.95
d1gsia_	208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	89.92
d2qn6a3	205	Initiation factor eIF2 gamma subunit, N-terminal (	89.65
d1puja_	273	Probable GTPase YlqF {Bacillus subtilis [TaxId: 14	89.55
d1npya1	167	Shikimate 5-dehydrogenase-like protein HI0607 {Hae	89.16
d1a7ja_	288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	88.79
d1p5zb_	241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	88.63
d1u0la2	225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	88.56
d1ni3a1	296	YchF GTP-binding protein N-terminal domain {Fissio	88.49
d1u94a1	263	RecA protein, ATPase-domain {Escherichia coli [Tax	88.25
d2ocpa1	241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	88.04
d1wxqa1	319	GTP-binding protein PH0525 {Pyrococcus horikoshii	87.91
d1htwa_	158	Hypothetical protein HI0065 {Haemophilus influenza	87.9
d1byia_	224	Dethiobiotin synthetase {Escherichia coli [TaxId:	87.55
d1g7sa4	227	Initiation factor IF2/eIF5b, N-terminal (G) domain	87.2
d1jnya3	224	Elongation factor eEF-1alpha, N-terminal (G) domai	87.2
d1a5ta2	207	delta prime subunit of DNA polymerase III, N-domai	87.14
d4tmka_	210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	87.04
d1svma_	362	Papillomavirus large T antigen helicase domain {Si	86.94
d1c9ka_	180	Adenosylcobinamide kinase/adenosylcobinamide phosp	86.68
d1nija1	222	Hypothetical protein YjiA, N-terminal domain {Esch	86.26
d1d2ea3	196	Elongation factor Tu (EF-Tu), N-terminal (G) domai	85.76
d1zunb3	222	Sulfate adenylate transferase subunit cysN/C, EF-T	85.72
d1jala1	278	YchF GTP-binding protein N-terminal domain {Haemop	85.59
d1g41a_	443	HslU {Haemophilus influenzae [TaxId: 727]}	84.69
d1njfa_	239	delta prime subunit of DNA polymerase III, N-domai	84.35
d1ls1a2	207	GTPase domain of the signal sequence recognition p	84.14
d1t9ha2	231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	83.94
d1nn5a_	209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	81.76
d1f60a3	239	Elongation factor eEF-1alpha, N-terminal (G) domai	80.51

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.96  E-value=1.8e-06  Score=53.86  Aligned_cols=26  Identities=27%  Similarity=0.280  Sum_probs=23.2

Q ss_pred             CccceeeccCCCccchhhhhhhhhhc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +++||+|||.+++|||+|++++..-.
T Consensus         1 ~e~KivllG~~~vGKTsl~~r~~~~~   26 (195)
T d1svsa1           1 REVKLLLLGAGESGKSTIVKQMKIIH   26 (195)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CceEEEEECCCCCCHHHHHHHHhhCC
Confidence            58999999999999999999987543

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.91  E-value=1.5e-06  Score=54.48  Aligned_cols=27  Identities=26%  Similarity=0.252  Sum_probs=24.3

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      +++||+|||.+++|||+++++++.-.-
T Consensus         1 ke~Kiv~lG~~~vGKTsll~r~~~~~~   27 (200)
T d2bcjq2           1 RELKLLLLGTGESGKSTFIKQMRIIHG   27 (200)
T ss_dssp             CEEEEEEEESTTSSHHHHHHHHHHHTS
T ss_pred             CeeEEEEECCCCCCHHHHHHHHhCCCC
Confidence            579999999999999999999987654

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.87  E-value=2.2e-06  Score=54.12  Aligned_cols=27  Identities=22%  Similarity=0.156  Sum_probs=23.8

Q ss_pred             CccceeeccCCCccchhhhhhhhhhcc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      |.+||+|||.++||||||++.+|....
T Consensus         1 r~iKivllG~~~vGKTsll~r~~f~~~   27 (200)
T d1zcba2           1 RLVKILLLGAGESGKSTFLKQMRIIHG   27 (200)
T ss_dssp             CCEEEEEECSTTSSHHHHHHHHHHHHS
T ss_pred             CeEEEEEECCCCCCHHHHHHHHhcCCC
Confidence            568999999999999999999986543

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Transducin (alpha subunit)
species: Cow (Bos taurus) [TaxId: 9913]

Probab=97.76  E-value=3e-06  Score=56.21  Aligned_cols=31  Identities=19%  Similarity=0.026  Sum_probs=27.4

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhhcccc
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ++...||||||.+++||||+++++++....|
T Consensus         3 ~k~~~KilllG~~~vGKTsll~~~~~~~~~p   33 (221)
T d1azta2           3 YRATHRLLLLGAGESGKSTIVKQMRILHVVL   33 (221)
T ss_dssp             HHHSEEEEEECSTTSSHHHHHHHHHHHHCCC
T ss_pred             chhcCEEEEECCCCCCHHHHHHHHhcCCcCC
Confidence            4567899999999999999999999876666

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL5A [TaxId: 9606]

Probab=97.63  E-value=7.9e-06  Score=50.55  Aligned_cols=25  Identities=8%  Similarity=0.142  Sum_probs=22.6

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+++||+++|.++||||||+.++..
T Consensus        13 ~k~~kI~vvG~~~~GKSsLi~rl~~   37 (177)
T d1zj6a1          13 HQEHKVIIVGLDNAGKTTILYQFSM   37 (177)
T ss_dssp             TSCEEEEEEESTTSSHHHHHHHHHT
T ss_pred             CCeEEEEEECCCCCCHHHHHHHHhc
Confidence            5689999999999999999998764

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=97.63  E-value=6.5e-06  Score=50.44  Aligned_cols=26  Identities=23%  Similarity=0.074  Sum_probs=23.1

Q ss_pred             hhCccceeeccCCCccchhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+++.||+|+|.+++||||++.+++-
T Consensus        10 ~~k~~kI~lvG~~~vGKTsLl~~l~~   35 (186)
T d1f6ba_          10 YKKTGKLVFLGLDNAGKTTLLHMLKD   35 (186)
T ss_dssp             TTCCEEEEEEEETTSSHHHHHHHHSC
T ss_pred             cCCCCEEEEECCCCCCHHHHHHHHhC
Confidence            35789999999999999999998864

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL2 [TaxId: 10090]

Probab=97.59  E-value=1e-05  Score=49.98  Aligned_cols=24  Identities=17%  Similarity=0.250  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|...+|||||+.+++-
T Consensus         1 k~~ki~ivG~~~~GKTsLi~~l~~   24 (165)
T d1ksha_           1 RELRLLMLGLDNAGKTTILKKFNG   24 (165)
T ss_dssp             CCEEEEEECSTTSSHHHHHHHHTT
T ss_pred             CcEEEEEECCCCCCHHHHHHHHcC
Confidence            578999999999999999999864

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hypothetical kinase-like protein Aq 1292
species: Aquifex aeolicus [TaxId: 63363]

Probab=97.50  E-value=1.5e-05  Score=49.21  Aligned_cols=25  Identities=12%  Similarity=0.146  Sum_probs=21.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhcc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .||++.|..+|||||+++.++-...
T Consensus         1 ~ki~I~G~~G~GKSTLl~~i~~~l~   25 (178)
T d1ye8a1           1 MKIIITGEPGVGKTTLVKKIVERLG   25 (178)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHHHHG
T ss_pred             CEEEEECCCCcHHHHHHHHHHhcCC
Confidence            4899999999999999999876543

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL1 [TaxId: 9606]

Probab=97.47  E-value=1.9e-05  Score=47.62  Aligned_cols=24  Identities=17%  Similarity=0.270  Sum_probs=21.7

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+++|++++|.+++|||||+.+++
T Consensus         3 ~ke~kI~ivG~~~vGKSSLi~~~~   26 (169)
T d1upta_           3 TREMRILILGLDGAGKTTILYRLQ   26 (169)
T ss_dssp             SSCEEEEEECSTTSSHHHHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHHHHh
Confidence            467999999999999999999875

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL3 [TaxId: 10090]

Probab=97.45  E-value=1.4e-05  Score=49.78  Aligned_cols=31  Identities=16%  Similarity=0.201  Sum_probs=25.4

Q ss_pred             HhHHhhhCccceeeccCCCccchhhhhhhhh
Q psy6625          25 EDGIQAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        25 kekk~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +-+....+++|++++|.+.+|||||+.+++.
T Consensus         8 k~~~~~~~~~kI~vvG~~~vGKSsLi~~l~~   38 (176)
T d1fzqa_           8 KLKSAPDQEVRILLLGLDNAGKTTLLKQLAS   38 (176)
T ss_dssp             HCSSCCSSCEEEEEEESTTSSHHHHHHHHCC
T ss_pred             HhhCCCCCEEEEEEECCCCCCHHHHHHHHhc
Confidence            3344456789999999999999999998854

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARL8A [TaxId: 9606]

Probab=97.45  E-value=1.6e-05  Score=49.49  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=21.2

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++||+++|..++|||||+.+++.
T Consensus         2 e~ki~i~G~~~~GKTsLl~~l~~   24 (164)
T d1zd9a1           2 EMELTLVGLQYSGKTTFVNVIAS   24 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHH
T ss_pred             eEEEEEECCCCCCHHHHHHHHHc
Confidence            68999999999999999998864

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-33b
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.38  E-value=2.7e-05  Score=48.05  Aligned_cols=24  Identities=13%  Similarity=0.426  Sum_probs=21.6

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      |.+|++|+|.+++|||||+.+++.
T Consensus         1 r~~Kv~liG~~~vGKTsLl~~~~~   24 (165)
T d1z06a1           1 RIFKIIVIGDSNVGKTCLTYRFCA   24 (165)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             CEEEEEEECCCCcCHHHHHHHHHh
Confidence            458999999999999999998875

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap2a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.38  E-value=2.7e-05  Score=48.39  Aligned_cols=24  Identities=17%  Similarity=0.277  Sum_probs=22.0

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++|+|..++|||||+.+++.
T Consensus         2 k~~Ki~lvG~~~vGKTsLi~r~~~   25 (167)
T d1kaoa_           2 REYKVVVLGSGGVGKSALTVQFVT   25 (167)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECCCCcCHHHHHHHHHh
Confidence            679999999999999999998874

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: SAR1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.37  E-value=2.7e-05  Score=46.28  Aligned_cols=20  Identities=30%  Similarity=0.197  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ||+|+|.+++|||||+..++
T Consensus         2 KI~liG~~nvGKSSLln~l~   21 (166)
T d2qtvb1           2 KLLFLGLDNAGKTTLLHMLK   21 (166)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            89999999999999999865

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: di-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.36  E-value=3e-05  Score=48.22  Aligned_cols=24  Identities=13%  Similarity=0.141  Sum_probs=22.0

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|.+.+||||++.+++.
T Consensus         1 n~~Ki~viG~~~vGKTsLi~r~~~   24 (171)
T d2erxa1           1 NDYRVAVFGAGGVGKSSLVLRFVK   24 (171)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHT
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHh
Confidence            478999999999999999998875

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]

Probab=97.36  E-value=2.4e-05  Score=49.02  Aligned_cols=27  Identities=19%  Similarity=0.245  Sum_probs=23.7

Q ss_pred             hhCccceeeccCCCccchhhhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..+++||+++|.+++|||||+++++--
T Consensus         9 ~~k~~kIvlvG~~~vGKTSli~rl~~~   35 (173)
T d1e0sa_           9 GNKEMRILMLGLDAAGKTTILYKLKLG   35 (173)
T ss_dssp             TTCCEEEEEEEETTSSHHHHHHHTTCC
T ss_pred             CCCeEEEEEECCCCCCHHHHHHHHhcC
Confidence            356899999999999999999998743

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-like estrogen-regulated growth inhibitor, RERG
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.34  E-value=3.1e-05  Score=48.48  Aligned_cols=23  Identities=17%  Similarity=0.244  Sum_probs=21.7

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++|+|.+++|||+|+.++|.
T Consensus         2 eiKi~lvG~~~vGKTsli~r~~~   24 (168)
T d2atva1           2 EVKLAIFGRAGVGKSALVVRFLT   24 (168)
T ss_dssp             CEEEEEECCTTSSHHHHHHHHHH
T ss_pred             cEEEEEECCCCCCHHHHHHHHHh
Confidence            68999999999999999999985

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF1 [TaxId: 9606]

Probab=97.29  E-value=3.9e-05  Score=46.00  Aligned_cols=21  Identities=14%  Similarity=0.221  Sum_probs=19.7

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|...+|||||+.+++
T Consensus         1 ikivlvG~~~vGKSsLi~~l~   21 (160)
T d1r8sa_           1 MRILMVGLDAAGKTTILYKLK   21 (160)
T ss_dssp             CEEEEECSTTSSHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            589999999999999999987

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: cH-p21 Ras protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.28  E-value=2.9e-05  Score=48.29  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|..++|||||+.+++.
T Consensus         2 ~e~Ki~viG~~~vGKTsli~~l~~   25 (166)
T d1ctqa_           2 TEYKLVVVGAGGVGKSALTIQLIQ   25 (166)
T ss_dssp             EEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             CeeEEEEECCCCCCHHHHHHHHHh
Confidence            368999999999999999999875

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.28  E-value=3.4e-05  Score=48.16  Aligned_cols=25  Identities=8%  Similarity=0.159  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+.+|++|+|..++|||||+.+++.
T Consensus         3 ~~~~Ki~lvG~~~vGKTsLi~r~~~   27 (171)
T d2erya1           3 QEKYRLVVVGGGGVGKSALTIQFIQ   27 (171)
T ss_dssp             CCEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             CcceEEEEECCCCCCHHHHHHHHHh
Confidence            3568999999999999999998875

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]

Probab=97.27  E-value=3.1e-05  Score=48.73  Aligned_cols=25  Identities=20%  Similarity=0.272  Sum_probs=22.5

Q ss_pred             hhCccceeeccCCCccchhhhhhhh
Q psy6625          30 AAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        30 ~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ..+++|++++|...+|||||+.+++
T Consensus        14 ~~k~~KI~lvG~~~vGKTsLi~~l~   38 (182)
T d1moza_          14 SNKELRILILGLDGAGKTTILYRLQ   38 (182)
T ss_dssp             CSSCEEEEEEEETTSSHHHHHHHTC
T ss_pred             CCceEEEEEECCCCCCHHHHHHHHh
Confidence            3468999999999999999999875

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-22a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.25  E-value=3.6e-05  Score=47.89  Aligned_cols=24  Identities=17%  Similarity=0.238  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++|+|...+|||||+..++.
T Consensus         3 k~~Ki~lvG~~~vGKTsli~rl~~   26 (167)
T d1z0ja1           3 RELKVCLLGDTGVGKSSIMWRFVE   26 (167)
T ss_dssp             EEEEEEEECCTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECCCCcCHHHHHHHHHh
Confidence            579999999999999999998863

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rac
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.20  E-value=4.4e-05  Score=48.24  Aligned_cols=24  Identities=17%  Similarity=0.239  Sum_probs=21.8

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|..++|||+|+.+++.
T Consensus         4 ~~iKivviG~~~vGKTsli~~~~~   27 (183)
T d1mh1a_           4 QAIKCVVVGDGAVGKTCLLISYTT   27 (183)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             eeEEEEEECCCCCCHHHHHHHHHh
Confidence            578999999999999999998874

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]

Probab=97.18  E-value=6.6e-05  Score=47.54  Aligned_cols=24  Identities=21%  Similarity=0.249  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.++|+|+|.++|||||..+.++-
T Consensus         2 ~~~riil~G~pGSGKsT~a~~La~   25 (190)
T d1ak2a1           2 KGVRAVLLGPPGAGKGTQAPKLAK   25 (190)
T ss_dssp             CCCEEEEECCTTSSHHHHHHHHHH
T ss_pred             CccEEEEECCCCCCHHHHHHHHHH
Confidence            357999999999999999998874

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rap1A
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.16  E-value=6.6e-05  Score=46.64  Aligned_cols=24  Identities=17%  Similarity=0.272  Sum_probs=21.9

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +++|++++|..++|||+|+.+++.
T Consensus         2 r~~KivvvG~~~vGKTsli~r~~~   25 (167)
T d1c1ya_           2 REYKLVVLGSGGVGKSALTVQFVQ   25 (167)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECCCCCCHHHHHHHHHc
Confidence            578999999999999999998864

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]

Probab=97.16  E-value=6.5e-05  Score=45.52  Aligned_cols=29  Identities=14%  Similarity=0.040  Sum_probs=23.9

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcccce
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      ..||+|.|.++|||||+.+.+.--...|.
T Consensus         4 ~~~I~i~G~pGsGKTTia~~La~~l~~~~   32 (173)
T d1rkba_           4 LPNILLTGTPGVGKTTLGKELASKSGLKY   32 (173)
T ss_dssp             CCCEEEECSTTSSHHHHHHHHHHHHCCEE
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHCCcE
Confidence            35899999999999999999876655554

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab7
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.14  E-value=6.7e-05  Score=47.27  Aligned_cols=22  Identities=14%  Similarity=0.191  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++|+|..++|||||+.+++.
T Consensus         3 ~Kv~vvG~~~vGKSSLi~~l~~   24 (184)
T d1vg8a_           3 LKVIILGDSGVGKTSLMNQYVN   24 (184)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            6899999999999999998874

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein BH3686
species: Bacillus halodurans [TaxId: 86665]

Probab=97.13  E-value=6.3e-05  Score=45.18  Aligned_cols=30  Identities=10%  Similarity=0.112  Sum_probs=24.0

Q ss_pred             eeeccCCCccchhhhhhhhhhcccceeeeC
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMMINN   65 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~~~~   65 (76)
                      |+|-|..+|||||+++++.--...+..+++
T Consensus         5 I~i~G~~GsGKTTva~~L~~~~~~~~~~~~   34 (176)
T d2bdta1           5 YIITGPAGVGKSTTCKRLAAQLDNSAYIEG   34 (176)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHSSSEEEEEH
T ss_pred             EEEECCCCCCHHHHHHHHHHHcCCCEEEeh
Confidence            688899999999999999877666655443

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein RalA
species: Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]

Probab=97.10  E-value=7.7e-05  Score=46.71  Aligned_cols=23  Identities=13%  Similarity=0.083  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++|+|..++|||||+.+++.
T Consensus         4 ~~KivlvG~~~vGKTsli~~~~~   26 (168)
T d1u8za_           4 LHKVIMVGSGGVGKSALTLQFMY   26 (168)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHH
T ss_pred             eeEEEEECCCCcCHHHHHHHHHh
Confidence            46999999999999999999874

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=97.08  E-value=8.5e-05  Score=46.00  Aligned_cols=22  Identities=18%  Similarity=0.309  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++|+|..++|||||+++++-
T Consensus         3 iKv~liG~~~vGKSsLi~rl~~   24 (164)
T d1z2aa1           3 IKMVVVGNGAVGKSSMIQRYCK   24 (164)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            7999999999999999998874

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: r-Ras
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.06  E-value=8.4e-05  Score=46.61  Aligned_cols=25  Identities=12%  Similarity=0.157  Sum_probs=22.2

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+++|++++|..++|||+|+.+++.
T Consensus         4 ~~~~Kv~lvG~~~vGKTsLi~r~~~   28 (173)
T d2fn4a1           4 SETHKLVVVGGGGVGKSALTIQFIQ   28 (173)
T ss_dssp             SCEEEEEEEECTTSSHHHHHHHHHH
T ss_pred             CCeEEEEEECCCCcCHHHHHHHHHh
Confidence            4679999999999999999998763

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab27b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.06  E-value=0.00018  Score=45.14  Aligned_cols=23  Identities=26%  Similarity=0.140  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++++|..++|||||+.+++-
T Consensus         5 ~~Ki~ivG~~~vGKTsLi~~l~~   27 (186)
T d2f7sa1           5 LIKLLALGDSGVGKTTFLYRYTD   27 (186)
T ss_dssp             EEEEEEESCTTSSHHHHHHHHHC
T ss_pred             EEEEEEECCCCcCHHHHHHHHhc
Confidence            48999999999999999998863

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=97.05  E-value=9.6e-05  Score=45.85  Aligned_cols=23  Identities=13%  Similarity=0.184  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|+|+|+++|||||..+.++--
T Consensus         1 m~I~i~G~pGSGKsT~a~~La~~   23 (182)
T d1zina1           1 MNLVLMGLPGAGKGTQAEKIVAA   23 (182)
T ss_dssp             CEEEEECSTTSSHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH
Confidence            37899999999999999887654

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Transcriptional regulator NadR, ribosylnicotinamide kinase domain
species: Haemophilus influenzae [TaxId: 727]

Probab=97.04  E-value=0.00011  Score=44.25  Aligned_cols=28  Identities=18%  Similarity=0.094  Sum_probs=23.7

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      -+|++.|+.+|||||+++++.-...-|.
T Consensus         8 K~I~i~G~~GsGKTTla~~La~~~~~~~   35 (192)
T d1lw7a2           8 KTVAILGGESSGKSVLVNKLAAVFNTTS   35 (192)
T ss_dssp             EEEEEECCTTSHHHHHHHHHHHHTTCEE
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHhCCCe
Confidence            3689999999999999999987765554

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab9a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.02  E-value=0.0001  Score=46.06  Aligned_cols=23  Identities=22%  Similarity=0.098  Sum_probs=20.4

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++++|..++|||||+.+++.
T Consensus         6 ~~KI~vvG~~~vGKSSli~~~~~   28 (174)
T d1wmsa_           6 LFKVILLGDGGVGKSSLMNRYVT   28 (174)
T ss_dssp             EEEEEEECCTTSSHHHHHHHHHH
T ss_pred             eEEEEEECCCCCCHHHHHHHHHh
Confidence            46999999999999999988753

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Probable kinase LmjF30.1890
species: Leishmania major [TaxId: 5664]

Probab=97.02  E-value=0.00011  Score=44.70  Aligned_cols=25  Identities=16%  Similarity=0.207  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +.++|+|.|..+|||||+++.+.--
T Consensus         4 k~~~I~i~G~~GsGKTT~~~~La~~   28 (174)
T d1y63a_           4 KGINILITGTPGTGKTSMAEMIAAE   28 (174)
T ss_dssp             SSCEEEEECSTTSSHHHHHHHHHHH
T ss_pred             CCCEEEEEeCCCCCHHHHHHHHHHH
Confidence            4678999999999999999988643

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab18
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.02  E-value=0.00022  Score=44.63  Aligned_cols=24  Identities=21%  Similarity=0.288  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -++|++++|..++|||||++++..
T Consensus         6 ~~iKi~vvG~~~vGKTsli~~l~~   29 (177)
T d1x3sa1           6 TTLKILIIGESGVGKSSLLLRFTD   29 (177)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             ceeEEEEECCCCcCHHHHHHHHHh
Confidence            368999999999999999998753

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab30
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.01  E-value=0.00017  Score=44.85  Aligned_cols=23  Identities=13%  Similarity=0.109  Sum_probs=21.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++|+|.+.+|||||+.+++.
T Consensus         5 ~~Ki~lvG~~~vGKTsLi~~l~~   27 (171)
T d2ew1a1           5 LFKIVLIGNAGVGKTCLVRRFTQ   27 (171)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHHh
Confidence            47999999999999999999874

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Chloramphenicol phosphotransferase
domain: Chloramphenicol phosphotransferase
species: Streptomyces venezuelae [TaxId: 54571]

Probab=97.01  E-value=0.00011  Score=44.42  Aligned_cols=27  Identities=15%  Similarity=0.239  Sum_probs=21.9

Q ss_pred             ceeec-cCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLL-GEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLL-GaGESGKST~~~~~~~~~~~~~   61 (76)
                      |+++| |..+|||||+.++++-....|.
T Consensus         4 kiI~l~G~~GsGKsTva~~L~~~l~~~~   31 (178)
T d1qhxa_           4 RMIILNGGSSAGKSGIVRCLQSVLPEPW   31 (178)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHHHSSSCE
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHcCCCe
Confidence            55556 9999999999999988766554

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab4a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.00  E-value=0.00024  Score=44.11  Aligned_cols=22  Identities=14%  Similarity=0.172  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +||+|+|..++|||||+.+++.
T Consensus         6 ~KI~lvG~~~vGKTsll~~~~~   27 (174)
T d2bmea1           6 FKFLVIGNAGTGKSCLLHQFIE   27 (174)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            7999999999999999998863

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab3a
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=97.00  E-value=0.00021  Score=44.42  Aligned_cols=23  Identities=13%  Similarity=0.171  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..|++++|..++|||||+.+++.
T Consensus         5 ~~Ki~vvG~~~vGKTsLi~~l~~   27 (169)
T d3raba_           5 MFKILIIGNSSVGKTSFLFRYAD   27 (169)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHHc
Confidence            47999999999999999998874

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.98  E-value=5.4e-05  Score=47.42  Aligned_cols=25  Identities=20%  Similarity=0.196  Sum_probs=12.1

Q ss_pred             hCccceeeccCCCccchhhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..-+|++++|..++||||++.+++.
T Consensus         4 ~~~~Ki~vvG~~~vGKTsLi~~l~~   28 (173)
T d2fu5c1           4 DYLFKLLLIGDSGVGKTCVLFRFSE   28 (173)
T ss_dssp             SEEEEEEEECCCCC-----------
T ss_pred             cEEEEEEEECCCCcCHHHHHHHHHh
Confidence            3457999999999999999998874

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein RheB
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.97  E-value=9e-05  Score=45.88  Aligned_cols=24  Identities=17%  Similarity=0.202  Sum_probs=21.7

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++++|..++|||||+.+++.
T Consensus         3 k~~Kv~liG~~~vGKTsLl~~~~~   26 (167)
T d1xtqa1           3 KSRKIAILGYRSVGKSSLTIQFVE   26 (167)
T ss_dssp             EEEEEEEEESTTSSHHHHHHHHHH
T ss_pred             cceEEEEECCCCcCHHHHHHHHHh
Confidence            467999999999999999999874

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ras-related protein M-Ras (XRas)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.95  E-value=0.00012  Score=45.74  Aligned_cols=23  Identities=13%  Similarity=0.213  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++|+|..++|||||++..+.
T Consensus         4 t~Ki~lvG~~~vGKTsll~~~~~   26 (169)
T d1x1ra1           4 TYKLVVVGDGGVGKSALTIQFFQ   26 (169)
T ss_dssp             EEEEEEECCTTSSHHHHHHHHHH
T ss_pred             cEEEEEECCCCcCHHHHHHHHHh
Confidence            58999999999999999998874

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: CDC42
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.95  E-value=9.6e-05  Score=47.01  Aligned_cols=23  Identities=17%  Similarity=0.232  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++|+|..++|||+|+.+++-
T Consensus         3 ~iKvvllG~~~vGKTSli~r~~~   25 (191)
T d2ngra_           3 TIKCVVVGDGAVGKTCLLISYTT   25 (191)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             ceEEEEECCCCcCHHHHHHHHHh
Confidence            68999999999999999998763

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable tRNA modification GTPase TrmE (MnmE), G domain
species: Escherichia coli [TaxId: 562]

Probab=96.94  E-value=0.00012  Score=44.53  Aligned_cols=21  Identities=19%  Similarity=0.189  Sum_probs=19.6

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|...+||||++.+++
T Consensus         2 ~kI~lvG~~nvGKSsLin~l~   22 (161)
T d2gj8a1           2 MKVVIAGRPNAGKSSLLNALA   22 (161)
T ss_dssp             EEEEEEESTTSSHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            689999999999999999886

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.94  E-value=0.00012  Score=45.22  Aligned_cols=23  Identities=17%  Similarity=0.232  Sum_probs=21.0

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++++|...+|||||+.++|.
T Consensus         2 ~~Ki~vvG~~~vGKTSli~~l~~   24 (166)
T d1g16a_           2 IMKILLIGDSGVGKSCLLVRFVE   24 (166)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHHh
Confidence            37999999999999999999885

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein ypt7p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.92  E-value=0.00015  Score=44.92  Aligned_cols=23  Identities=13%  Similarity=0.138  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++++|.+.+|||||+.+++.
T Consensus         2 ~~Ki~~vG~~~vGKSsLi~~~~~   24 (175)
T d1ky3a_           2 ILKVIILGDSGVGKTSLMHRYVN   24 (175)
T ss_dssp             EEEEEEECCTTSSHHHHHHHHHH
T ss_pred             eEEEEEECCCCcCHHHHHHHHHc
Confidence            47999999999999999998874

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Polynucleotide kinase, kinase domain
species: Bacteriophage T4 [TaxId: 10665]

Probab=96.90  E-value=0.00015  Score=43.59  Aligned_cols=20  Identities=15%  Similarity=0.031  Sum_probs=17.2

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |++-|.++|||||+++.++-
T Consensus         5 Iii~G~pGsGKTTla~~L~~   24 (152)
T d1ly1a_           5 ILTIGCPGSGKSTWAREFIA   24 (152)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            57789999999999998754

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab14
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.90  E-value=0.00015  Score=44.87  Aligned_cols=22  Identities=9%  Similarity=0.167  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++|+|.+++|||+|+.+++.
T Consensus         5 ~KivlvG~~~vGKTsli~~~~~   26 (166)
T d1z0fa1           5 FKYIIIGDMGVGKSCLLHQFTE   26 (166)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            6999999999999999998863

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab6
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.87  E-value=0.00015  Score=44.54  Aligned_cols=21  Identities=24%  Similarity=0.257  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|..++|||+|+.++.
T Consensus         1 fKv~vvG~~~vGKTsLi~r~~   21 (164)
T d1yzqa1           1 FKLVFLGEQSVGKTSLITRFM   21 (164)
T ss_dssp             CEEEEEESTTSSHHHHHHHHH
T ss_pred             CEEEEECCCCcCHHHHHHHHH
Confidence            589999999999999999876

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rad
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.86  E-value=0.00017  Score=44.99  Aligned_cols=23  Identities=22%  Similarity=0.131  Sum_probs=20.6

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      +|++++|..++|||||+++++-.
T Consensus         2 fKi~lvG~~~vGKTsLi~~~~~~   24 (168)
T d2gjsa1           2 YKVLLLGAPGVGKSALARIFGGV   24 (168)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHTC
T ss_pred             eEEEEECCCCcCHHHHHHHHhCC
Confidence            68999999999999999988753

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein GEM
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.86  E-value=0.00018  Score=45.10  Aligned_cols=24  Identities=13%  Similarity=0.126  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+|++|+|...+|||+++..++-
T Consensus         2 ~~~Kv~lvG~~~vGKTsLi~~~~~   25 (172)
T d2g3ya1           2 TYYRVVLIGEQGVGKSTLANIFAG   25 (172)
T ss_dssp             CEEEEEEECCTTSSHHHHHHHHHC
T ss_pred             CEEEEEEECCCCcCHHHHHHHHHh
Confidence            468999999999999999998864

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab5a
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.85  E-value=0.00017  Score=44.78  Aligned_cols=22  Identities=32%  Similarity=0.388  Sum_probs=20.3

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      ++|++++|..++|||||+.+++
T Consensus         6 ~~Ki~vvG~~~vGKTsLi~~l~   27 (170)
T d1r2qa_           6 QFKLVLLGESAVGKSSLVLRFV   27 (170)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHH
Confidence            4799999999999999999876

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ran
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.84  E-value=0.00014  Score=45.50  Aligned_cols=23  Identities=22%  Similarity=0.164  Sum_probs=20.3

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|...+|||+|+.+++-
T Consensus         3 ~~Ki~vvG~~~vGKTsli~~~~~   25 (170)
T d1i2ma_           3 QFKLVLVGDGGTGKTTFVKRHLT   25 (170)
T ss_dssp             EEEEEEEECTTSSHHHHHHTTC-
T ss_pred             eEEEEEECCCCcCHHHHHHHHHh
Confidence            47999999999999999998864

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Bacillus globisporus [TaxId: 1459]

Probab=96.83  E-value=0.00019  Score=45.14  Aligned_cols=24  Identities=8%  Similarity=0.098  Sum_probs=20.3

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .||++.|+++|||||..+.++---
T Consensus         1 M~I~i~G~pGSGKsT~a~~La~~~   24 (182)
T d1s3ga1           1 MNIVLMGLPGAGKGTQADRIVEKY   24 (182)
T ss_dssp             CEEEEECSTTSSHHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHH
Confidence            478999999999999998876543

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoE (RND3)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.83  E-value=0.00017  Score=45.74  Aligned_cols=23  Identities=9%  Similarity=0.198  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|..++|||+|+++++.
T Consensus         2 ~~KivliG~~~vGKTsli~r~~~   24 (179)
T d1m7ba_           2 KCKIVVVGDSQCGKTALLHVFAK   24 (179)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             ceEEEEECCCCcCHHHHHHHHHh
Confidence            36999999999999999998875

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Escherichia coli [TaxId: 562]

Probab=96.82  E-value=0.00026  Score=41.62  Aligned_cols=27  Identities=11%  Similarity=0.161  Sum_probs=23.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .|.|.|..+|||||+.+.+.--.+-|.
T Consensus         4 ~I~l~G~~GsGKSTvak~La~~L~~~~   30 (169)
T d1kaga_           4 NIFLVGPMGAGKSTIGRQLAQQLNMEF   30 (169)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHTTCEE
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhCCCe
Confidence            578999999999999999887666664

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Ypt51
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.81  E-value=0.00019  Score=44.43  Aligned_cols=23  Identities=35%  Similarity=0.421  Sum_probs=21.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++|++++|..++|||+|+.+++.
T Consensus         3 ~iKi~vvG~~~vGKTsLi~~~~~   25 (170)
T d1ek0a_           3 SIKLVLLGEAAVGKSSIVLRFVS   25 (170)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHHh
Confidence            58999999999999999998874

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]

Probab=96.81  E-value=0.00019  Score=46.37  Aligned_cols=27  Identities=15%  Similarity=0.080  Sum_probs=23.4

Q ss_pred             hCccceeeccCCCccchhhhhhhhhhc
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+-++|+|+|.++|||||+.+.++--.
T Consensus         4 ~r~mrIiliG~PGSGKtT~a~~La~~~   30 (189)
T d2ak3a1           4 ARLLRAAIMGAPGSGKGTVSSRITKHF   30 (189)
T ss_dssp             SCCCEEEEECCTTSSHHHHHHHHHHHB
T ss_pred             CcceeEEEECCCCCCHHHHHHHHHHHH
Confidence            467899999999999999999887543

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.81  E-value=0.00019  Score=45.17  Aligned_cols=23  Identities=9%  Similarity=0.127  Sum_probs=19.8

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      ..|+++|+++|||||.++.++--
T Consensus         2 ~iI~i~GppGSGKsT~a~~La~~   24 (194)
T d1teva_           2 LVVFVLGGPGAGKGTQCARIVEK   24 (194)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHH
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            36899999999999999988653

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab21
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.80  E-value=0.0002  Score=44.36  Aligned_cols=22  Identities=32%  Similarity=0.486  Sum_probs=20.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++|+|..++|||||+..++.
T Consensus         4 fKivlvG~~~vGKTsLi~r~~~   25 (167)
T d1z08a1           4 FKVVLLGEGCVGKTSLVLRYCE   25 (167)
T ss_dssp             EEEEEECCTTSCHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            6999999999999999998763

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=96.77  E-value=0.00015  Score=45.25  Aligned_cols=26  Identities=15%  Similarity=0.130  Sum_probs=22.8

Q ss_pred             hhhCccceeeccCCCccchhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+.+|+.++|-..+|||||+.+++
T Consensus         4 ~~~~~~kV~iiG~~~~GKSTLin~l~   29 (186)
T d1mkya2           4 EITDAIKVAIVGRPNVGKSTLFNAIL   29 (186)
T ss_dssp             CCCSCEEEEEECSTTSSHHHHHHHHH
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHH
Confidence            34467899999999999999999987

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab26
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.76  E-value=0.00023  Score=44.20  Aligned_cols=24  Identities=13%  Similarity=0.156  Sum_probs=21.2

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ..+|++++|.+++|||+|+.+++.
T Consensus         5 ~~fKi~vvG~~~vGKTsli~~~~~   28 (170)
T d2g6ba1           5 VAFKVMLVGDSGVGKTCLLVRFKD   28 (170)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHHHH
T ss_pred             eEEEEEEECCCCcCHHHHHHHHHh
Confidence            357999999999999999998765

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Chloroplast protein translocon GTPase Toc34
species: Garden pea (Pisum sativum) [TaxId: 3888]

Probab=96.76  E-value=0.00048  Score=46.58  Aligned_cols=32  Identities=9%  Similarity=0.105  Sum_probs=25.2

Q ss_pred             HHHhHHhhhCccceeeccCCCccchhhhhhhh
Q psy6625          23 LKEDGIQAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        23 L~kekk~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +..-++.....++|+|+|..++||||+..++.
T Consensus        22 ~~~l~~~~~~~l~I~LvG~tg~GKSSliN~il   53 (257)
T d1h65a_          22 LGNLKQEDVNSLTILVMGKGGVGKSSTVNSII   53 (257)
T ss_dssp             HHHHHHTTCCEEEEEEEESTTSSHHHHHHHHH
T ss_pred             HHHHhhcCCCCcEEEEECCCCCcHHHHHHHHh
Confidence            33334444678999999999999999998875

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Escherichia coli [TaxId: 562]

Probab=96.75  E-value=0.00021  Score=44.69  Aligned_cols=24  Identities=13%  Similarity=0.264  Sum_probs=20.4

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .||+++|..+|||||..+.++--.
T Consensus         1 m~I~i~G~pGSGKsT~~~~La~~~   24 (179)
T d1e4va1           1 MRIILLGAPVAGKGTQAQFIMEKY   24 (179)
T ss_dssp             CEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHh
Confidence            478999999999999998886443

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.75  E-value=0.00026  Score=44.62  Aligned_cols=25  Identities=16%  Similarity=0.179  Sum_probs=21.5

Q ss_pred             ccceeeccCCCccchhhhhhhhhhc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      .+||++.|..+|||||+.+.++--.
T Consensus         2 ~mrIvl~G~pGSGKtT~a~~La~~~   26 (180)
T d1akya1           2 SIRMVLIGPPGAGKGTQAPNLQERF   26 (180)
T ss_dssp             CCEEEEECCTTSSHHHHHHHHHHHH
T ss_pred             ceEEEEECCCCCCHHHHHHHHHHHh
Confidence            4789999999999999999886543

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=96.73  E-value=0.00025  Score=44.43  Aligned_cols=23  Identities=22%  Similarity=0.336  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|+++|..+|||||..+.++--
T Consensus         1 m~I~i~G~pGsGKsT~a~~La~~   23 (181)
T d2cdna1           1 MRVLLLGPPGAGKGTQAVKLAEK   23 (181)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH
Confidence            47899999999999999987643

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoA
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.72  E-value=0.00022  Score=44.50  Aligned_cols=22  Identities=14%  Similarity=0.178  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      .|++++|..++|||+|+.+++.
T Consensus         3 ~KivvvG~~~vGKTsLi~~~~~   24 (177)
T d1kmqa_           3 KKLVIVGDGACGKTCLLIVNSK   24 (177)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            6999999999999999988764

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: RhoQ
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.72  E-value=0.00022  Score=45.12  Aligned_cols=23  Identities=9%  Similarity=0.157  Sum_probs=20.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .+|++++|..++|||+++.+++.
T Consensus         9 ~~Ki~lvG~~~vGKTsLi~r~~~   31 (185)
T d2atxa1           9 MLKCVVVGDGAVGKTCLLMSYAN   31 (185)
T ss_dssp             EEEEEEEECTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCCCHHHHHHHHhh
Confidence            57999999999999999998873

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Centaurin gamma 1, G domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.70  E-value=0.00025  Score=45.12  Aligned_cols=24  Identities=21%  Similarity=0.210  Sum_probs=21.5

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .++|++++|...+|||||+.+.+.
T Consensus         4 p~~ki~vlG~~~vGKTsLi~~~~~   27 (175)
T d2bmja1           4 PELRLGVLGDARSGKSSLIHRFLT   27 (175)
T ss_dssp             CEEEEEEECCTTTTHHHHHHHHHH
T ss_pred             CcEEEEEECCCCCCHHHHHHHHHh
Confidence            368999999999999999998764

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Cancer-related NTPase, C1orf57
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.69  E-value=0.00028  Score=42.35  Aligned_cols=21  Identities=10%  Similarity=-0.045  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      ++|.|.++|||||+++++.-.
T Consensus         4 v~ItG~~GtGKTtl~~~i~~~   24 (189)
T d2i3ba1           4 VFLTGPPGVGKTTLIHKASEV   24 (189)
T ss_dssp             EEEESCCSSCHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHH
Confidence            689999999999999988744

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ATP sulfurylase C-terminal domain
domain: ATP sulfurylase C-terminal domain
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=96.65  E-value=0.0003  Score=42.28  Aligned_cols=21  Identities=24%  Similarity=0.172  Sum_probs=18.0

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      .=|+|.|..+|||||+.+++-
T Consensus         7 ~~I~l~G~~GsGKTTia~~La   27 (183)
T d1m8pa3           7 FTIFLTGYMNSGKDAIARALQ   27 (183)
T ss_dssp             EEEEEECSTTSSHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            347899999999999998775

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Gluconate kinase
domain: Gluconate kinase
species: Escherichia coli [TaxId: 562]

Probab=96.61  E-value=0.00033  Score=42.50  Aligned_cols=23  Identities=13%  Similarity=0.099  Sum_probs=18.6

Q ss_pred             eeeccCCCccchhhhhhhhhhcc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~   58 (76)
                      ++|.|..+|||||+++.+.--..
T Consensus         9 ivl~G~~GsGKsT~a~~La~~l~   31 (171)
T d1knqa_           9 YVLMGVSGSGKSAVASEVAHQLH   31 (171)
T ss_dssp             EEEECSTTSCHHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHhC
Confidence            45689999999999999865443

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab2b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.60  E-value=0.00034  Score=43.57  Aligned_cols=21  Identities=14%  Similarity=0.243  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|++++|..++|||||+.++.
T Consensus         4 ~KivvvG~~~vGKTsli~r~~   24 (173)
T d2a5ja1           4 FKYIIIGDTGVGKSCLLLQFT   24 (173)
T ss_dssp             EEEEEESSTTSSHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHh
Confidence            699999999999999999875

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=96.59  E-value=0.00035  Score=43.60  Aligned_cols=20  Identities=15%  Similarity=0.135  Sum_probs=18.1

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      ++|.|-++|||||+.++++-
T Consensus         5 i~l~GlpgsGKSTla~~L~~   24 (213)
T d1bifa1           5 IVMVGLPARGKTYISKKLTR   24 (213)
T ss_dssp             EEEECCTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            57889999999999999884

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Ytp1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.55  E-value=0.00034  Score=44.54  Aligned_cols=23  Identities=26%  Similarity=0.234  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+|++++|...+|||||+.+++.
T Consensus         6 ~~KivvvG~~~vGKTsli~~l~~   28 (194)
T d2bcgy1           6 LFKLLLIGNSGVGKSCLLLRFSD   28 (194)
T ss_dssp             EEEEEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEEEECCCCcCHHHHHHHHhh
Confidence            47999999999999999998873

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab11b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.51  E-value=0.00042  Score=43.19  Aligned_cols=22  Identities=14%  Similarity=0.128  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      +|++++|..++|||||+.++..
T Consensus         5 ~Ki~vvG~~~vGKTsLi~~~~~   26 (175)
T d2f9la1           5 FKVVLIGDSGVGKSNLLSRFTR   26 (175)
T ss_dssp             EEEEEESSTTSSHHHHHHHHHH
T ss_pred             EEEEEECCCCcCHHHHHHHHHh
Confidence            6999999999999999998754

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=96.49  E-value=0.00042  Score=44.29  Aligned_cols=22  Identities=5%  Similarity=-0.158  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =|+|.|..+||||||++.+.--
T Consensus        16 liil~G~pGsGKST~a~~l~~~   37 (172)
T d1yj5a2          16 VVVAVGFPGAGKSTFIQEHLVS   37 (172)
T ss_dssp             EEEEECCTTSSHHHHHHHHTGG
T ss_pred             EEEEECCCCCCHHHHHHHHHHh
Confidence            4688899999999999988643

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Maize (Zea mays) [TaxId: 4577]

Probab=96.44  E-value=0.00045  Score=43.55  Aligned_cols=24  Identities=17%  Similarity=0.153  Sum_probs=20.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -.+|+|.|..+|||||+.+.++--
T Consensus         3 Pm~I~i~GppGsGKsT~a~~La~~   26 (189)
T d1zaka1           3 PLKVMISGAPASGKGTQCELIKTK   26 (189)
T ss_dssp             SCCEEEEESTTSSHHHHHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHHHHHH
Confidence            468999999999999999988643

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: TrmE GTPase domain
species: Thermotoga maritima [TaxId: 2336]

Probab=96.43  E-value=0.0002  Score=43.46  Aligned_cols=21  Identities=10%  Similarity=0.165  Sum_probs=19.5

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      +|+.|+|-..+|||||+.+++
T Consensus         1 ikI~liG~~n~GKSSLin~l~   21 (160)
T d1xzpa2           1 LRMVIVGKPNVGKSTLLNRLL   21 (160)
T ss_dssp             EEEEEECCHHHHTCHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            589999999999999999976

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: UMP/CMP kinase
species: Dictyostelium discoideum [TaxId: 44689]

Probab=96.41  E-value=0.00047  Score=43.43  Aligned_cols=22  Identities=14%  Similarity=0.108  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+++.|.++|||||+.+.++--
T Consensus         8 iI~i~G~pGSGKsT~a~~La~~   29 (194)
T d1qf9a_           8 VVFVLGGPGSGKGTQCANIVRD   29 (194)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            4789999999999999988754

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=96.40  E-value=0.00047  Score=43.74  Aligned_cols=23  Identities=9%  Similarity=0.069  Sum_probs=19.6

Q ss_pred             eeeccCCCccchhhhhhhhhhcc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~   58 (76)
                      |+|+|.++|||||..+.++--..
T Consensus        11 I~l~G~pGSGKsT~a~~La~~~g   33 (194)
T d3adka_          11 IFVVGGPGSGKGTQCEKIVQKYG   33 (194)
T ss_dssp             EEEEECTTSSHHHHHHHHHHHTC
T ss_pred             EEEECCCCCCHHHHHHHHHHHhC
Confidence            78999999999999998875443

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Bacillus subtilis [TaxId: 1423]

Probab=96.31  E-value=0.00055  Score=43.12  Aligned_cols=20  Identities=15%  Similarity=0.028  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ++.|+|...||||||+.+++
T Consensus        25 ~I~lvG~~n~GKSTLin~L~   44 (195)
T d1svia_          25 EIALAGRSNVGKSSFINSLI   44 (195)
T ss_dssp             EEEEEEBTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHhc
Confidence            79999999999999999996

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Uridylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=96.31  E-value=0.00064  Score=42.93  Aligned_cols=23  Identities=13%  Similarity=0.072  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -|+++|.++|||||.++.++--.
T Consensus        10 iI~i~GppGSGKsT~a~~La~~~   32 (196)
T d1ukza_          10 VIFVLGGPGAGKGTQCEKLVKDY   32 (196)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHS
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            47889999999999999987544

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Atu3015-like
domain: Hypothetical protein Atu3015
species: Agrobacterium tumefaciens [TaxId: 358]

Probab=96.23  E-value=0.0011  Score=40.07  Aligned_cols=27  Identities=30%  Similarity=0.245  Sum_probs=21.1

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      |+|-|..+|||||+++.+.--...|..
T Consensus         7 I~l~G~~GsGKSTia~~La~~lg~~~~   33 (176)
T d1zp6a1           7 LLLSGHPGSGKSTIAEALANLPGVPKV   33 (176)
T ss_dssp             EEEEECTTSCHHHHHHHHHTCSSSCEE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCEE
Confidence            456799999999999998766555543

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cell division protein MukB
species: Escherichia coli [TaxId: 562]

Probab=96.21  E-value=0.0003  Score=42.16  Aligned_cols=20  Identities=20%  Similarity=0.109  Sum_probs=18.0

Q ss_pred             eeccCCCccchhhhhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~   56 (76)
                      +|.|..+|||||++.|++.+
T Consensus        28 vi~G~NGsGKStil~Ai~~~   47 (222)
T d1qhla_          28 TLSGGNGAGKSTTMAAFVTA   47 (222)
T ss_dssp             HHHSCCSHHHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            67799999999999999865

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.20  E-value=0.00045  Score=42.60  Aligned_cols=23  Identities=22%  Similarity=0.125  Sum_probs=19.5

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      -+-|+|-|..+|||||+.+.+.-
T Consensus        19 g~vI~L~G~pGSGKTTiAk~La~   41 (195)
T d1x6va3          19 GCTVWLTGLSGAGKTTVSMALEE   41 (195)
T ss_dssp             CEEEEEESSCHHHHHHHHHHHHH
T ss_pred             CeEEEEECCCCCCHHHHHHHHHH
Confidence            45678889999999999998853

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=96.12  E-value=0.001  Score=41.33  Aligned_cols=20  Identities=10%  Similarity=-0.034  Sum_probs=18.9

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ++.|+|...+|||||+.+++
T Consensus         7 ~I~lvG~~~~GKSSLin~l~   26 (178)
T d1wf3a1           7 FVAIVGKPNVGKSTLLNNLL   26 (178)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            68999999999999999987

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein engB
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=96.11  E-value=0.0016  Score=39.98  Aligned_cols=20  Identities=10%  Similarity=0.115  Sum_probs=18.1

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .++|+|...+|||||+.+++
T Consensus         2 ~I~lvG~~nvGKSsLin~l~   21 (184)
T d2cxxa1           2 TIIFAGRSNVGKSTLIYRLT   21 (184)
T ss_dssp             EEEEEEBTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            37899999999999999986

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngB
species: Escherichia coli [TaxId: 562]

Probab=96.09  E-value=0.00088  Score=40.64  Aligned_cols=24  Identities=13%  Similarity=0.130  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +..|+.|+|-..+||||+++++.-
T Consensus        15 ~~~~I~lvG~~NvGKSSL~n~L~~   38 (188)
T d1puia_          15 TGIEVAFAGRSNAGKSSALNTLTN   38 (188)
T ss_dssp             CSEEEEEEECTTSSHHHHHTTTCC
T ss_pred             cCCEEEEECCCCCCHHHHHHHHhC
Confidence            468999999999999999998853

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: ATP(GTP)-binding protein PAB0955
species: Pyrococcus abyssi [TaxId: 29292]

Probab=96.08  E-value=0.00095  Score=42.44  Aligned_cols=30  Identities=13%  Similarity=0.088  Sum_probs=21.4

Q ss_pred             eeeccCCCccchhhhhhhh---hhcccceeeeC
Q psy6625          36 LLLLGEYFSSQMVPSLALC---TTTSKPMMINN   65 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~---~~~~~~~~~~~   65 (76)
                      ++++|..+||||||+.++=   ..-.++..||+
T Consensus         3 i~v~G~~GsGKTTLl~~ll~~~~~~~~~~ivn~   35 (244)
T d1yrba1           3 VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNL   35 (244)
T ss_dssp             EEEECSTTSSHHHHHHHHHHHHTTTSCEEEEEC
T ss_pred             EEEEcCCCCcHHHHHHHHHHHHhhCCeEEEEec
Confidence            5789999999999998873   22234555553

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
domain: Plasmid maintenance system epsilon/zeta, toxin zeta subunit
species: Streptococcus pyogenes [TaxId: 1314]

Probab=96.05  E-value=0.0018  Score=41.60  Aligned_cols=27  Identities=22%  Similarity=0.156  Sum_probs=23.5

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||.|..++||||++++++-....|..
T Consensus        35 ilL~GpPGtGKT~la~~la~~~~~~~~   61 (273)
T d1gvnb_          35 FLLGGQPGSGKTSLRSAIFEETQGNVI   61 (273)
T ss_dssp             EEEECCTTSCTHHHHHHHHHHTTTCCE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhhcceE
Confidence            889999999999999999988765544

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Escherichia coli [TaxId: 562]

Probab=96.02  E-value=0.0011  Score=39.85  Aligned_cols=20  Identities=10%  Similarity=-0.137  Sum_probs=17.4

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +.+.|..+||||||+.++.-
T Consensus         5 i~itG~~GSGKTTL~~~L~~   24 (170)
T d1np6a_           5 LAFAAWSGTGKTTLLKKLIP   24 (170)
T ss_dssp             EEEECCTTSCHHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHHH
Confidence            46789999999999999864

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase Der, N-terminal and middle domains
species: Thermotoga maritima [TaxId: 2336]

Probab=96.02  E-value=0.0011  Score=40.83  Aligned_cols=20  Identities=15%  Similarity=0.107  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.++|-..+|||||+.+++
T Consensus         2 ~V~liG~~n~GKSsLi~~L~   21 (171)
T d1mkya1           2 TVLIVGRPNVGKSTLFNKLV   21 (171)
T ss_dssp             EEEEECCTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            47899999999999999986

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=95.97  E-value=0.0012  Score=41.87  Aligned_cols=21  Identities=24%  Similarity=0.230  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      +++++|...|||||++.++..
T Consensus         2 ~V~ivG~~~~GKTsLl~~l~~   22 (207)
T d2fh5b1           2 AVLFVGLCDSGKTLLFVRLLT   22 (207)
T ss_dssp             EEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHc
Confidence            579999999999999999874

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Signal recognition particle receptor beta-subunit
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.89  E-value=0.0014  Score=40.86  Aligned_cols=21  Identities=14%  Similarity=0.083  Sum_probs=19.4

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      -.++|+|.+.+|||||+.+++
T Consensus         4 p~V~lvG~~n~GKTSLln~l~   24 (209)
T d1nrjb_           4 PSIIIAGPQNSGKTSLLTLLT   24 (209)
T ss_dssp             CEEEEECSTTSSHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            468999999999999999997

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=95.89  E-value=0.0014  Score=40.61  Aligned_cols=27  Identities=19%  Similarity=0.084  Sum_probs=21.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      +|.|.|..+|||||+.+.+=--..-|.
T Consensus         3 ~IvliG~~G~GKSTig~~La~~l~~~f   29 (165)
T d2iyva1           3 KAVLVGLPGSGKSTIGRRLAKALGVGL   29 (165)
T ss_dssp             SEEEECSTTSSHHHHHHHHHHHHTCCE
T ss_pred             cEEEECCCCCCHHHHHHHHHHHhCCCe
Confidence            678899999999999988765555553

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Erwinia chrysanthemi [TaxId: 556]

Probab=95.82  E-value=0.0019  Score=40.11  Aligned_cols=26  Identities=8%  Similarity=0.096  Sum_probs=21.9

Q ss_pred             eeeccCCCccchhhhhhhhhhcccce
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      |.|.|..+|||||+.+.+.--..-|.
T Consensus         5 Iil~G~~GsGKSTia~~LA~~Lg~~~   30 (170)
T d1e6ca_           5 IFMVGARGCGMTTVGRELARALGYEF   30 (170)
T ss_dssp             EEEESCTTSSHHHHHHHHHHHHTCEE
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCCCE
Confidence            57889999999999999877666663

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter PF0895
species: Pyrococcus furiosus [TaxId: 2261]

Probab=95.75  E-value=0.0016  Score=42.94  Aligned_cols=22  Identities=9%  Similarity=-0.091  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+-|+|..+|||||+++.+|-.
T Consensus        29 i~~l~G~NGsGKSTLl~~i~gl   50 (200)
T d1sgwa_          29 VVNFHGPNGIGKTTLLKTISTY   50 (200)
T ss_dssp             CEEEECCTTSSHHHHHHHHTTS
T ss_pred             EEEEECCCCChHHHHHHHHhcc
Confidence            4579999999999999999853

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Sulfolobus acidocaldarius [TaxId: 2285]

Probab=95.71  E-value=0.0017  Score=39.29  Aligned_cols=21  Identities=10%  Similarity=-0.146  Sum_probs=17.2

Q ss_pred             cee-eccCCCccchhhhhhhhh
Q psy6625          35 KLL-LLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLL-LLGaGESGKST~~~~~~~   55 (76)
                      |+. +-|..+|||||.++.+.-
T Consensus         2 kiivi~G~~GsGKTT~~~~La~   23 (194)
T d1nksa_           2 KIGIVTGIPGVGKSTVLAKVKE   23 (194)
T ss_dssp             EEEEEEECTTSCHHHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHHHH
Confidence            555 459999999999988864

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Adenylate kinase
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=95.70  E-value=0.0018  Score=38.91  Aligned_cols=18  Identities=11%  Similarity=-0.033  Sum_probs=15.4

Q ss_pred             eeeccCCCccchhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~   53 (76)
                      |++-|..+|||||+++.+
T Consensus         4 I~i~G~~GsGKsT~~~~L   21 (190)
T d1khta_           4 VVVTGVPGVGSTTSSQLA   21 (190)
T ss_dssp             EEEECCTTSCHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            466699999999999876

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein rbstp0775
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=95.64  E-value=0.0017  Score=39.69  Aligned_cols=19  Identities=21%  Similarity=0.008  Sum_probs=15.8

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |-+=|..+||||||++++-
T Consensus        25 IgI~G~~GSGKSTla~~L~   43 (198)
T d1rz3a_          25 LGIDGLSRSGKTTLANQLS   43 (198)
T ss_dssp             EEEEECTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            3466899999999999874

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]

Probab=95.56  E-value=0.0032  Score=43.19  Aligned_cols=32  Identities=13%  Similarity=0.156  Sum_probs=23.1

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNN   66 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~   66 (76)
                      .+-|+|..+|||||+++.+.-.-   +--+.+|+.
T Consensus        31 ~~~liG~sGaGKSTll~~i~gl~~p~sG~I~~~g~   65 (240)
T d1g2912          31 FMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDK   65 (240)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSSCCSEEEEEETTE
T ss_pred             EEEEECCCCChHHHHHHHHhcCCCCCCCEEEECCE
Confidence            46789999999999999886543   223555553

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.47  E-value=0.0025  Score=38.15  Aligned_cols=22  Identities=18%  Similarity=0.256  Sum_probs=18.6

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      .++-|.++||||||+++++.-.
T Consensus        26 ~~i~G~~GsGKT~l~l~la~~~   47 (242)
T d1n0wa_          26 TEMFGEFRTGKTQICHTLAVTC   47 (242)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHT
T ss_pred             EEEEeCCCCCHHHHHHHHHHHH
Confidence            4788999999999999887643

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]

Probab=95.45  E-value=0.0024  Score=43.58  Aligned_cols=33  Identities=9%  Similarity=0.071  Sum_probs=24.1

Q ss_pred             cceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      -++-++|..+|||||+++.+.-.   ++--+.||+.
T Consensus        30 e~vaIvG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~   65 (241)
T d2pmka1          30 EVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGH   65 (241)
T ss_dssp             CEEEEECSTTSSHHHHHHHHTTSSCCSEEEEEETTE
T ss_pred             CEEEEECCCCCCHHHHHHHHHhcCCCCCCEEEECCE
Confidence            46889999999999999987653   2333455543

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Thermus thermophilus [TaxId: 274]

Probab=95.44  E-value=0.0019  Score=40.06  Aligned_cols=20  Identities=15%  Similarity=0.021  Sum_probs=18.2

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.|+|...+||||++.+++
T Consensus         3 ~VaivG~~nvGKSTLin~L~   22 (180)
T d1udxa2           3 DVGLVGYPNAGKSSLLAAMT   22 (180)
T ss_dssp             SEEEECCGGGCHHHHHHHHC
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            36899999999999999986

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter MsbA, C-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

Probab=95.38  E-value=0.0023  Score=43.78  Aligned_cols=23  Identities=13%  Similarity=0.033  Sum_probs=20.0

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++-++|..+|||||+++.++=.
T Consensus        42 e~iaivG~sGsGKSTLl~ll~gl   64 (253)
T d3b60a1          42 KTVALVGRSGSGKSTIASLITRF   64 (253)
T ss_dssp             CEEEEEECTTSSHHHHHHHHTTT
T ss_pred             CEEEEECCCCChHHHHHHHHhcc
Confidence            36899999999999999998753

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermotoga maritima [TaxId: 2336]

Probab=95.37  E-value=0.012  Score=37.58  Aligned_cols=33  Identities=9%  Similarity=0.077  Sum_probs=27.4

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~   66 (76)
                      --+|+-|.+++||||++++++--...|.++-|.
T Consensus        36 ~~~L~~GPpGtGKT~lA~~la~~~~~~~~~~~~   68 (238)
T d1in4a2          36 DHVLLAGPPGLGKTTLAHIIASELQTNIHVTSG   68 (238)
T ss_dssp             CCEEEESSTTSSHHHHHHHHHHHHTCCEEEEET
T ss_pred             CeEEEECCCCCcHHHHHHHHHhccCCCcccccC
Confidence            358999999999999999999887777665444

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Shikimate kinase (AroK)
domain: Shikimate kinase (AroK)
species: Campylobacter jejuni [TaxId: 197]

Probab=95.34  E-value=0.0028  Score=39.31  Aligned_cols=27  Identities=15%  Similarity=0.134  Sum_probs=21.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPM   61 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~   61 (76)
                      .|.|.|.++|||||+.+.+---..-|.
T Consensus         2 ~I~liG~~GsGKsTi~k~La~~l~~~~   28 (161)
T d1viaa_           2 NIVFIGFMGSGKSTLARALAKDLDLVF   28 (161)
T ss_dssp             CEEEECCTTSCHHHHHHHHHHHHTCEE
T ss_pred             cEEEECCCCCCHHHHHHHHHHHhCCCE
Confidence            378899999999999998866555554

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Multidrug resistance ABC transporter LmrA, C-terminal domain
species: Lactococcus lactis [TaxId: 1358]

Probab=95.26  E-value=0.003  Score=42.97  Aligned_cols=33  Identities=12%  Similarity=-0.003  Sum_probs=24.6

Q ss_pred             cceeeccCCCccchhhhhhhhhh---cccceeeeCc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT---TSKPMMINNN   66 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~   66 (76)
                      -++-++|..+|||||+++.++-.   ++--+.||+.
T Consensus        29 e~vaivG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~   64 (242)
T d1mv5a_          29 SIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQ   64 (242)
T ss_dssp             EEEEEECCTTSSHHHHHHHHTTSSCCSBSCEEETTE
T ss_pred             CEEEEECCCCCCHHHHHHHHHHhhCCCCCEEEECCE
Confidence            36789999999999999998754   3344555543

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=95.22  E-value=0.0044  Score=42.53  Aligned_cols=41  Identities=17%  Similarity=0.206  Sum_probs=27.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCceeE--------Eeeeee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNTVE--------IGVLVQ   75 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~~~--------~~~~~~   75 (76)
                      -+-|+|..+|||||+++.+.-..   |--..+|+..+.        ||++.|
T Consensus        34 ~~~liGpsGaGKSTLl~~i~Gl~~p~sG~I~i~g~~i~~~~~~~r~ig~v~Q   85 (239)
T d1v43a3          34 FLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQ   85 (239)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTSSCCSEEEEEETTEECTTSCGGGGTEEEEEC
T ss_pred             EEEEECCCCChHHHHHHHHHcCCCCCCCEEEEcceecccCCcccceEEEEee
Confidence            46799999999999999877543   223455544332        666655

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein
species: Chinese hamster (Cricetulus griseus) [TaxId: 10029]

Probab=95.19  E-value=0.0042  Score=41.70  Aligned_cols=29  Identities=17%  Similarity=0.321  Sum_probs=26.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhccccee
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      .-+||.|..++|||+++++++-.+..|+.
T Consensus        41 ~~vLL~GppGtGKT~la~alA~~~~~~~~   69 (246)
T d1d2na_          41 VSVLLEGPPHSGKTALAAKIAEESNFPFI   69 (246)
T ss_dssp             EEEEEECSTTSSHHHHHHHHHHHHTCSEE
T ss_pred             eEEEEECcCCCCHHHHHHHHhhccccccc
Confidence            34899999999999999999999888864

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Chromosomal replication initiation factor DnaA
species: Aquifex aeolicus [TaxId: 63363]

Probab=95.19  E-value=0.0095  Score=39.09  Aligned_cols=24  Identities=13%  Similarity=0.091  Sum_probs=20.8

Q ss_pred             eeeccCCCccchhhhhhhhhhccc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      ++|-|..+|||||+++|.|--..+
T Consensus        39 l~l~G~~G~GKTHLl~A~~~~~~~   62 (213)
T d1l8qa2          39 IFIYGSVGTGKTHLLQAAGNEAKK   62 (213)
T ss_dssp             EEEECSSSSSHHHHHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHHhcc
Confidence            788899999999999999976543

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Peptide transporter Tap1, C-terminal ABC domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.12  E-value=0.0035  Score=42.82  Aligned_cols=23  Identities=17%  Similarity=-0.015  Sum_probs=19.9

Q ss_pred             cceeeccCCCccchhhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~   56 (76)
                      -++-++|..+|||||+++.+.-.
T Consensus        41 e~vaivG~sGsGKSTLl~li~gl   63 (251)
T d1jj7a_          41 EVTALVGPNGSGKSTVAALLQNL   63 (251)
T ss_dssp             CEEEEECSTTSSHHHHHHHHTTS
T ss_pred             CEEEEECCCCCcHHHHHHHHhcc
Confidence            36789999999999999988754

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTPase Era, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=95.02  E-value=0.0041  Score=37.84  Aligned_cols=20  Identities=10%  Similarity=-0.032  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+.++|-..+|||||+.+++
T Consensus         7 ~I~iiG~~nvGKSSLin~L~   26 (179)
T d1egaa1           7 FIAIVGRPNVGKSTLLNKLL   26 (179)
T ss_dssp             EEEEECSSSSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            47899999999999999996

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=95.02  E-value=0.0039  Score=39.59  Aligned_cols=20  Identities=10%  Similarity=0.017  Sum_probs=16.0

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |-+-|...||||||++.+--
T Consensus         5 IgI~G~~gSGKSTla~~L~~   24 (213)
T d1uj2a_           5 IGVSGGTASGKSSVCAKIVQ   24 (213)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHH
Confidence            34669999999999987643

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=95.01  E-value=0.006  Score=39.03  Aligned_cols=23  Identities=26%  Similarity=0.209  Sum_probs=19.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      --.+||-|..++||||++++++-
T Consensus        33 ~~~lll~Gp~G~GKTt~~~~la~   55 (252)
T d1sxje2          33 LPHLLLYGPNGTGKKTRCMALLE   55 (252)
T ss_dssp             CCCEEEECSTTSSHHHHHHTHHH
T ss_pred             CCeEEEECCCCCCHHHHHHHHHH
Confidence            34589999999999999999864

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]

Probab=94.97  E-value=0.0039  Score=42.88  Aligned_cols=21  Identities=5%  Similarity=-0.130  Sum_probs=18.6

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      -++.++|..+|||||+++.+.
T Consensus        45 e~vaivG~sGsGKSTLl~ll~   65 (255)
T d2hyda1          45 ETVAFVGMSGGGKSTLINLIP   65 (255)
T ss_dssp             CEEEEECSTTSSHHHHHTTTT
T ss_pred             CEEEEECCCCCcHHHHHHHHH
Confidence            478999999999999998765

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Methanococcus voltae [TaxId: 2188]

Probab=94.95  E-value=0.004  Score=38.69  Aligned_cols=21  Identities=14%  Similarity=0.115  Sum_probs=18.4

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      .+|.|.++||||||+++++.-
T Consensus        37 ~~i~G~~G~GKT~~~l~~a~~   57 (258)
T d2i1qa2          37 TEFAGVFGSGKTQIMHQSCVN   57 (258)
T ss_dssp             EEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHHH
Confidence            588899999999999998753

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=94.93  E-value=0.0045  Score=38.69  Aligned_cols=19  Identities=16%  Similarity=0.076  Sum_probs=16.3

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      +.|.|+++|||||+.+.++
T Consensus         5 ivl~GpsG~GK~tl~~~L~   23 (182)
T d1znwa1           5 VVLSGPSAVGKSTVVRCLR   23 (182)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4677999999999998774

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.91  E-value=0.0059  Score=41.20  Aligned_cols=29  Identities=10%  Similarity=0.131  Sum_probs=25.8

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      -+||-|+.++|||++++++|--...|+..
T Consensus        43 giLL~Gp~GtGKT~l~~ala~~~~~~~~~   71 (265)
T d1r7ra3          43 GVLFYGPPGCGKTLLAKAIANECQANFIS   71 (265)
T ss_dssp             EEEEBCCTTSSHHHHHHHHHHHTTCEEEE
T ss_pred             eEEEECCCCCcchhHHHHHHHHhCCcEEE
Confidence            38999999999999999999998888654

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.91  E-value=0.0039  Score=43.20  Aligned_cols=22  Identities=14%  Similarity=-0.001  Sum_probs=19.2

Q ss_pred             cceeeccCCCccchhhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~   55 (76)
                      -++-++|..+|||||+++.++-
T Consensus        63 e~vaivG~nGsGKSTLl~~i~G   84 (281)
T d1r0wa_          63 EMLAITGSTGSGKTSLLMLILG   84 (281)
T ss_dssp             CEEEEEESTTSSHHHHHHHHHT
T ss_pred             CEEEEECCCCChHHHHHHHHhC
Confidence            3578999999999999998864

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.82  E-value=0.0049  Score=39.01  Aligned_cols=19  Identities=11%  Similarity=0.048  Sum_probs=17.0

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.|.|+++|||+|+.+.++
T Consensus         4 Ivl~GpsG~GK~tl~~~L~   22 (186)
T d1gkya_           4 IVISGPSGTGKSTLLKKLF   22 (186)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            6899999999999998774

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ0796
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=94.80  E-value=0.0048  Score=41.98  Aligned_cols=31  Identities=13%  Similarity=0.050  Sum_probs=22.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~   65 (76)
                      -+-|+|..+|||||+++.++-.-   +--+.+++
T Consensus        33 ~~~iiG~sGsGKSTLl~~i~gl~~p~sG~I~~~g   66 (230)
T d1l2ta_          33 FVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDN   66 (230)
T ss_dssp             EEEEECSTTSSHHHHHHHHTTSSCCSEEEEEETT
T ss_pred             EEEEECCCCCCcchhhHhccCCCCCCcceeEECC
Confidence            46789999999999999776542   33345554

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C2
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.73  E-value=0.0054  Score=38.92  Aligned_cols=21  Identities=24%  Similarity=0.276  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+||-|..++||||+++++|-
T Consensus        35 ~lll~Gp~G~GKTtl~~~i~~   55 (237)
T d1sxjd2          35 HMLFYGPPGTGKTSTILALTK   55 (237)
T ss_dssp             CEEEECSTTSSHHHHHHHHHH
T ss_pred             eEEEECCCCCChHHHHHHHHH
Confidence            389999999999999999985

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric traffic ATPase, HP0525
species: Helicobacter pylori [TaxId: 210]

Probab=94.71  E-value=0.0082  Score=42.14  Aligned_cols=24  Identities=8%  Similarity=-0.013  Sum_probs=20.5

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      ..+|+-|+.+||||||+.+++-.-
T Consensus       167 ~nili~G~tgSGKTT~l~al~~~i  190 (323)
T d1g6oa_         167 KNVIVCGGTGSGKTTYIKSIMEFI  190 (323)
T ss_dssp             CCEEEEESTTSSHHHHHHHHGGGS
T ss_pred             CCEEEEeeccccchHHHHHHhhhc
Confidence            358999999999999999987543

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Thermotoga maritima [TaxId: 2336]

Probab=94.71  E-value=0.0055  Score=40.33  Aligned_cols=20  Identities=15%  Similarity=-0.099  Sum_probs=17.7

Q ss_pred             eeccCCCccchhhhhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~   56 (76)
                      .|.|..+|||||++.|++..
T Consensus        28 vlvG~NgsGKS~iL~Ai~~~   47 (308)
T d1e69a_          28 AIVGPNGSGKSNIIDAIKWV   47 (308)
T ss_dssp             EEECCTTTCSTHHHHHHHHT
T ss_pred             EEECCCCCcHHHHHHHHHHH
Confidence            67799999999999998664

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Holliday junction helicase RuvB
species: Thermus thermophilus [TaxId: 274]

Probab=94.66  E-value=0.015  Score=37.31  Aligned_cols=34  Identities=12%  Similarity=0.114  Sum_probs=28.0

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceeeeCce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNT   67 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~   67 (76)
                      --+||-|..++||||++++++--...|..+.|.+
T Consensus        36 ~~~Ll~GPpG~GKTtla~~la~~~~~~~~~~~~~   69 (239)
T d1ixsb2          36 EHLLLFGPPGLGKTTLAHVIAHELGVNLRVTSGP   69 (239)
T ss_dssp             CCEEEECCTTSCHHHHHHHHHHHHTCCEEEEETT
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHhCCCeEeccCC
Confidence            3579999999999999999998777776665543

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=94.59  E-value=0.0058  Score=41.67  Aligned_cols=33  Identities=12%  Similarity=0.108  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhh---cccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT---TSKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~---~~~~~~~~~~~   67 (76)
                      -+-|+|..+|||||+++.+.-.   +|--+.+|+..
T Consensus        28 i~~liGpsGsGKSTLl~~i~Gl~~p~sG~I~i~g~~   63 (232)
T d2awna2          28 FVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKR   63 (232)
T ss_dssp             EEEEECCTTSSHHHHHHHHHTSSCCSEEEEEESSSC
T ss_pred             EEEEECCCCChHHHHHHHHhcCCCCCCCEEEECCEE
Confidence            3578999999999999977543   23335555543

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.58  E-value=0.0095  Score=38.15  Aligned_cols=31  Identities=10%  Similarity=0.071  Sum_probs=25.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~~~   65 (76)
                      -+||-|..++||||+++++|--...++..-|
T Consensus        54 ~lll~GPpG~GKTt~a~~la~~~~~~~~~~~   84 (253)
T d1sxja2          54 AAMLYGPPGIGKTTAAHLVAQELGYDILEQN   84 (253)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHTTCEEEEEC
T ss_pred             eEEEECCCCCCHHHHHHHHHHHHHhhhhccc
Confidence            4899999999999999999987766665443

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Molybdate/tungstate import ATP-binding protein WtpC (ModC)
species: Archaeoglobus fulgidus [TaxId: 2234]

Probab=94.57  E-value=0.0058  Score=41.99  Aligned_cols=22  Identities=18%  Similarity=0.063  Sum_probs=18.7

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-|+|..+|||||+++.++-..
T Consensus        27 ~~liGpnGaGKSTll~~i~Gl~   48 (240)
T d2onka1          27 CVLLGPTGAGKSVFLELIAGIV   48 (240)
T ss_dssp             EEEECCTTSSHHHHHHHHHTSS
T ss_pred             EEEECCCCChHHHHHHHHHcCC
Confidence            4688999999999999887653

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=94.53  E-value=0.0057  Score=38.74  Aligned_cols=21  Identities=19%  Similarity=0.211  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      .++.|.++||||||..+...-
T Consensus        39 ~li~G~pGsGKT~~~lq~~~~   59 (254)
T d1pzna2          39 TEVFGEFGSGKTQLAHTLAVM   59 (254)
T ss_dssp             EEEEESTTSSHHHHHHHHHHH
T ss_pred             EEEEcCCCCCHHHHHHHHHHH
Confidence            588999999999999988653

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-inducible GTPase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.53  E-value=0.015  Score=41.53  Aligned_cols=24  Identities=17%  Similarity=0.025  Sum_probs=22.1

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...++|.++|-..+|||||+.+++
T Consensus        54 ~~~l~Iai~G~~n~GKSSLiNaL~   77 (400)
T d1tq4a_          54 SSVLNVAVTGETGSGKSSFINTLR   77 (400)
T ss_dssp             HCCEEEEEEECTTSSHHHHHHHHH
T ss_pred             cCCcEEEEECCCCCCHHHHHHHHh
Confidence            457899999999999999999997

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=94.45  E-value=0.011  Score=39.58  Aligned_cols=31  Identities=19%  Similarity=0.208  Sum_probs=27.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceeeeC
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMINN   65 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~~~   65 (76)
                      -+||-|..++|||+++++++--+..|...-+
T Consensus        40 giLL~GppGtGKT~l~~ala~~~~~~~~~i~   70 (258)
T d1e32a2          40 GILLYGPPGTGKTLIARAVANETGAFFFLIN   70 (258)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHHTTCEEEEEC
T ss_pred             eeEEecCCCCCchHHHHHHHHHhCCeEEEEE
Confidence            4899999999999999999999998877643

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=94.40  E-value=0.019  Score=38.62  Aligned_cols=20  Identities=25%  Similarity=0.069  Sum_probs=17.1

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      =+.+-|.|+.||||++++.+
T Consensus        46 ~v~I~GmgGiGKTtLA~~v~   65 (277)
T d2a5yb3          46 FLFLHGRAGSGKSVIASQAL   65 (277)
T ss_dssp             EEEEECSTTSSHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            35689999999999998864

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=94.34  E-value=0.0073  Score=38.61  Aligned_cols=20  Identities=30%  Similarity=0.331  Sum_probs=18.0

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -+||.|..+|||||+++++.
T Consensus        47 ~lll~Gp~G~GKTtla~~ia   66 (231)
T d1iqpa2          47 HLLFAGPPGVGKTTAALALA   66 (231)
T ss_dssp             EEEEESCTTSSHHHHHHHHH
T ss_pred             eEEEECCCCCcHHHHHHHHH
Confidence            48999999999999998775

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Molybdopterin-guanine dinucleotide biosynthesis protein MobB
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=94.33  E-value=0.0077  Score=36.89  Aligned_cols=21  Identities=10%  Similarity=0.061  Sum_probs=16.9

Q ss_pred             cee-eccCCCccchhhhhhhhh
Q psy6625          35 KLL-LLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLL-LLGaGESGKST~~~~~~~   55 (76)
                      |++ +-|..+||||||+..+.-
T Consensus         2 kii~I~G~~gSGKTTli~~l~~   23 (165)
T d1xjca_           2 NVWQVVGYKHSGKTTLMEKWVA   23 (165)
T ss_dssp             CEEEEECCTTSSHHHHHHHHHH
T ss_pred             cEEEEEeCCCCCHHHHHHHHHH
Confidence            444 789999999999987653

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C3
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.33  E-value=0.02  Score=36.25  Aligned_cols=21  Identities=24%  Similarity=0.271  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .+||-|..++||||+++++|-
T Consensus        37 ~lLl~Gp~G~GKttl~~~la~   57 (227)
T d1sxjc2          37 HLLFYGPPGTGKTSTIVALAR   57 (227)
T ss_dssp             CEEEECSSSSSHHHHHHHHHH
T ss_pred             eEEEECCCCCChhHHHHHHHH
Confidence            589999999999999999874

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Hexameric replicative helicase repA
species: Escherichia coli [TaxId: 562]

Probab=94.31  E-value=0.007  Score=39.38  Aligned_cols=20  Identities=15%  Similarity=0.032  Sum_probs=17.4

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      .+|-|.+++|||||+.+++.
T Consensus        32 ~~i~G~~G~GKS~l~l~la~   51 (274)
T d1nlfa_          32 GALVSPGGAGKSMLALQLAA   51 (274)
T ss_dssp             EEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHH
Confidence            46789999999999998875

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ABC transporter involved in vitamin B12 uptake, BtuD
species: Escherichia coli [TaxId: 562]

Probab=94.24  E-value=0.0076  Score=40.39  Aligned_cols=23  Identities=17%  Similarity=0.072  Sum_probs=19.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+-|+|..+|||||+++.++-.+
T Consensus        27 i~~iiG~nGaGKSTLl~~l~Gl~   49 (231)
T d1l7vc_          27 ILHLVGPNGAGKSTLLARMAGMT   49 (231)
T ss_dssp             EEECBCCTTSSHHHHHHHHHTSC
T ss_pred             EEEEECCCCCcHHHHHHHHhCCC
Confidence            35789999999999999887654

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Archaeal ATPase SSO1545
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=94.21  E-value=0.013  Score=36.87  Aligned_cols=23  Identities=13%  Similarity=-0.106  Sum_probs=18.6

Q ss_pred             ceeeccCCCccchhhhhhhhhhc
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~   57 (76)
                      -+++.|.+++|||++++..+--.
T Consensus        31 ~i~i~G~~G~GKTsLl~~~~~~~   53 (283)
T d2fnaa2          31 ITLVLGLRRTGKSSIIKIGINEL   53 (283)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEEEcCCCCcHHHHHHHHHHHC
Confidence            35788999999999999876433

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Thermus thermophilus [TaxId: 274]

Probab=94.19  E-value=0.0073  Score=37.65  Aligned_cols=18  Identities=17%  Similarity=0.097  Sum_probs=15.2

Q ss_pred             eeeccCCCccchhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~   53 (76)
                      |-+.|..+|||||++..+
T Consensus         6 IgitG~~gSGKstva~~l   23 (191)
T d1uf9a_           6 IGITGNIGSGKSTVAALL   23 (191)
T ss_dssp             EEEEECTTSCHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            457799999999999765

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Glucose transport protein GlcV, N-terminal domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=94.19  E-value=0.0046  Score=42.53  Aligned_cols=22  Identities=9%  Similarity=0.021  Sum_probs=18.8

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      .+-|+|..+|||||+++.+.-.
T Consensus        33 ~~~iiG~sGsGKSTll~~i~gl   54 (242)
T d1oxxk2          33 RFGILGPSGAGKTTFMRIIAGL   54 (242)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTS
T ss_pred             EEEEECCCCCcHHHHHHHHHcC
Confidence            4689999999999999987653

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: DNA repair protein Rad51, catalytic domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=94.18  E-value=0.0077  Score=37.50  Aligned_cols=21  Identities=24%  Similarity=0.287  Sum_probs=17.9

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      .++-|.++||||||..+...-
T Consensus        37 ~li~G~pGsGKT~l~lq~~~~   57 (251)
T d1szpa2          37 TELFGEFRTGKSQLCHTLAVT   57 (251)
T ss_dssp             EEEEESTTSSHHHHHHHHTTT
T ss_pred             EEEEcCCCCCHHHHHHHHHHH
Confidence            588899999999999987644

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor SelB, N-terminal domain
species: Methanococcus maripaludis [TaxId: 39152]

Probab=94.16  E-value=0.0064  Score=38.01  Aligned_cols=24  Identities=25%  Similarity=0.263  Sum_probs=21.4

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+++-++|-..+||||++.+++-
T Consensus         4 k~inIaiiG~~naGKSTL~n~L~~   27 (179)
T d1wb1a4           4 KNINLGIFGHIDHGKTTLSKVLTE   27 (179)
T ss_dssp             EEEEEEEEECTTSSHHHHHHHHHT
T ss_pred             CCEEEEEEeCCCCcHHHHHHHHHH
Confidence            467889999999999999999983

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Sulfate/molybdate ABC transporter, ATP-binding protein
species: Methanosarcina acetivorans [TaxId: 2214]

Probab=94.07  E-value=0.0062  Score=41.49  Aligned_cols=22  Identities=9%  Similarity=0.057  Sum_probs=19.0

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-|+|..+|||||+++.+.-..
T Consensus        29 ~~liGpsGaGKSTll~~l~Gl~   50 (229)
T d3d31a2          29 FVILGPTGAGKTLFLELIAGFH   50 (229)
T ss_dssp             EEEECCCTHHHHHHHHHHHTSS
T ss_pred             EEEECCCCCcHHHHHHHHhcCc
Confidence            5789999999999999887553

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Bacillus stearothermophilus, PcrA [TaxId: 1422]

Probab=94.00  E-value=0.0081  Score=39.76  Aligned_cols=18  Identities=17%  Similarity=0.017  Sum_probs=15.9

Q ss_pred             ceeeccCCCccchhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLA   52 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~   52 (76)
                      -+|+.|+++|||||++..
T Consensus        26 ~~lV~g~aGSGKTt~l~~   43 (318)
T d1pjra1          26 PLLIMAGAGSGKTRVLTH   43 (318)
T ss_dssp             CEEEEECTTSCHHHHHHH
T ss_pred             CEEEEecCCccHHHHHHH
Confidence            489999999999999865

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=93.99  E-value=0.0096  Score=37.86  Aligned_cols=19  Identities=16%  Similarity=0.044  Sum_probs=16.8

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.|.|+++|||+|+.+.++
T Consensus         3 Ivl~GPsGsGK~tl~~~L~   21 (190)
T d1lvga_           3 VVLSGPSGAGKSTLLKKLF   21 (190)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            5799999999999988764

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Methionine import ATP-binding protein MetN
species: Escherichia coli [TaxId: 562]

Probab=93.91  E-value=0.0087  Score=40.93  Aligned_cols=33  Identities=3%  Similarity=0.012  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      -+-++|..+|||||+++.+.-..   +--+.+++..
T Consensus        33 ~~~iiG~sGsGKSTLl~~i~Gl~~p~sG~I~~~g~~   68 (240)
T d3dhwc1          33 IYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQE   68 (240)
T ss_dssp             EEEEEESTTSSHHHHHHHHTTSSCCSEEEEEETTEE
T ss_pred             EEEEECCCCCCHHHHHHHHcCCccccCCceEEcCeE
Confidence            35789999999999999876543   2334555543

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: ATP-binding subunit of the histidine permease
species: Salmonella typhimurium [TaxId: 90371]

Probab=93.85  E-value=0.01  Score=40.70  Aligned_cols=33  Identities=9%  Similarity=0.100  Sum_probs=23.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhc---ccceeeeCce
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTT---SKPMMINNNT   67 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~---~~~~~~~~~~   67 (76)
                      -+-|+|..+|||||+++++.-..   +--+.+++..
T Consensus        30 i~~iiG~sGsGKSTLl~~i~Gl~~p~~G~I~~~G~~   65 (258)
T d1b0ua_          30 VISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQN   65 (258)
T ss_dssp             EEEEECCTTSSHHHHHHHHTTSSCCSEEEEEETTEE
T ss_pred             EEEEECCCCCcHHHHHHHHHcCccCCCCCEEECCEE
Confidence            46789999999999999886542   2224555443

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEXX box DNA helicase
species: Escherichia coli, RepD [TaxId: 562]

Probab=93.80  E-value=0.011  Score=38.49  Aligned_cols=18  Identities=17%  Similarity=-0.066  Sum_probs=15.4

Q ss_pred             ceeeccCCCccchhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLA   52 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~   52 (76)
                      -+|+.|.++|||||++..
T Consensus        16 ~~lI~g~aGTGKTt~l~~   33 (306)
T d1uaaa1          16 PCLVLAGAGSGKTRVITN   33 (306)
T ss_dssp             EEEECCCTTSCHHHHHHH
T ss_pred             CEEEEeeCCccHHHHHHH
Confidence            479999999999998753

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Cask
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.74  E-value=0.011  Score=37.55  Aligned_cols=19  Identities=26%  Similarity=0.146  Sum_probs=16.8

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.|.|.++|||+|+.+.++
T Consensus         6 ivl~Gpsg~GK~tl~~~L~   24 (178)
T d1kgda_           6 LVLLGAHGVGRRHIKNTLI   24 (178)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            5788999999999998776

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Meiotic recombination protein DMC1/LIM15 homolog
species: Human (Homo sapiens) [TaxId: 9606]

Probab=93.67  E-value=0.012  Score=36.96  Aligned_cols=22  Identities=27%  Similarity=0.374  Sum_probs=19.0

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =+++.|.++||||+|.++.+.-
T Consensus        39 ~~~i~G~~GsGKT~lalq~~~~   60 (258)
T d1v5wa_          39 ITEAFGEFRTGKTQLSHTLCVT   60 (258)
T ss_dssp             EEEEECCTTCTHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHH
Confidence            3588899999999999998754

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Obg GTP-binding protein middle domain
species: Bacillus subtilis [TaxId: 1423]

Probab=93.63  E-value=0.012  Score=36.27  Aligned_cols=20  Identities=10%  Similarity=-0.072  Sum_probs=17.8

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+-|+|-..+|||||+.++.
T Consensus         3 ~VaiiG~~nvGKSSLin~L~   22 (185)
T d1lnza2           3 DVGLVGFPSVGKSTLLSVVS   22 (185)
T ss_dssp             CEEEESSTTSSHHHHHHHSE
T ss_pred             eEEEECCCCCCHHHHHHHHh
Confidence            46899999999999999874

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyribonucleoside kinase
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=93.63  E-value=0.014  Score=36.18  Aligned_cols=24  Identities=13%  Similarity=0.043  Sum_probs=20.0

Q ss_pred             CccceeeccCCCccchhhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      +.+-|.+=|.-+|||||+++.+.-
T Consensus         8 kp~~I~ieG~~GsGKTTl~~~L~~   31 (197)
T d2vp4a1           8 QPFTVLIEGNIGSGKTTYLNHFEK   31 (197)
T ss_dssp             CCEEEEEECSTTSCHHHHHHTTGG
T ss_pred             CceEEEEECCCCCCHHHHHHHHHH
Confidence            445578889999999999999873

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]

Probab=93.56  E-value=0.017  Score=38.74  Aligned_cols=27  Identities=19%  Similarity=0.226  Sum_probs=23.5

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||.|..++|||+++++++--...|..
T Consensus        45 iLl~GppGtGKT~la~aia~~~~~~~~   71 (247)
T d1ixza_          45 VLLVGPPGVGKTHLARAVAGEARVPFI   71 (247)
T ss_dssp             EEEECCTTSSHHHHHHHHHHHTTCCEE
T ss_pred             EEEecCCCCChhHHHHHHHHHcCCCEE
Confidence            899999999999999999977666653

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Streptococcus pneumoniae [TaxId: 1313]

Probab=93.55  E-value=0.014  Score=36.58  Aligned_cols=26  Identities=12%  Similarity=0.101  Sum_probs=20.1

Q ss_pred             ccceeeccCCCccchhhhhhhhhhcc
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTTTS   58 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~~~   58 (76)
                      .++|.+-|.++|||||..+.+.---.
T Consensus         3 ~i~IaIdGp~GsGKgT~ak~La~~lg   28 (223)
T d1q3ta_           3 TIQIAIDGPASSGKSTVAKIIAKDFG   28 (223)
T ss_dssp             CCEEEEECSSCSSHHHHHHHHHHHHC
T ss_pred             ceEEEEECCCCCCHHHHHHHHHHHhC
Confidence            35667779999999999988765433

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: CMP kinase
species: Escherichia coli [TaxId: 562]

Probab=93.51  E-value=0.013  Score=36.33  Aligned_cols=19  Identities=11%  Similarity=0.006  Sum_probs=16.0

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.+.|.++|||||..+.+.
T Consensus         6 I~I~GppGSGKgT~ak~La   24 (225)
T d1ckea_           6 ITIDGPSGAGKGTLCKAMA   24 (225)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4566999999999998765

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Branched chain aminoacid ABC transporter
species: Thermotoga maritima, TM1139 [TaxId: 2336]

Probab=93.44  E-value=0.013  Score=39.55  Aligned_cols=22  Identities=14%  Similarity=0.137  Sum_probs=19.1

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-|+|..+|||||+++.++-..
T Consensus        35 ~~liGpnGaGKSTl~~~i~Gl~   56 (240)
T d1ji0a_          35 VTLIGANGAGKTTTLSAIAGLV   56 (240)
T ss_dssp             EEEECSTTSSHHHHHHHHTTSS
T ss_pred             EEEECCCCCcHHHHHHHHhCCC
Confidence            5789999999999999887654

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Mycoplasma pneumoniae [TaxId: 2104]

Probab=93.34  E-value=0.026  Score=37.04  Aligned_cols=34  Identities=21%  Similarity=0.321  Sum_probs=25.0

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceeeeCceeEE
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEI   70 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~   70 (76)
                      =+|+.|.++|||||+...+-  ....-++.++.|.+
T Consensus        17 gvli~G~sG~GKS~lal~l~--~~G~~lvaDD~v~~   50 (177)
T d1knxa2          17 GVLLTGRSGIGKSECALDLI--NKNHLFVGDDAIEI   50 (177)
T ss_dssp             EEEEEESSSSSHHHHHHHHH--TTTCEEEEEEEEEE
T ss_pred             EEEEEcCCCCCHHHHHHHHH--HcCCceecCCeEEE
Confidence            36999999999999998763  34455666666554

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=93.29  E-value=0.013  Score=39.02  Aligned_cols=23  Identities=4%  Similarity=-0.057  Sum_probs=19.9

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      .-+|.++|.--||||||+.++.=
T Consensus        26 ~P~ivvvG~~SsGKSsliNaLlg   48 (299)
T d2akab1          26 LPQIAVVGGQSAGKSSVLENFVG   48 (299)
T ss_dssp             CCEEEEEEBTTSCHHHHHHHHHT
T ss_pred             CCeEEEEcCCCCCHHHHHHHHhC
Confidence            34689999999999999999963

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=93.28  E-value=0.02  Score=38.66  Aligned_cols=27  Identities=15%  Similarity=0.295  Sum_probs=24.3

Q ss_pred             eeeccCCCccchhhhhhhhhhccccee
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      +||-|..++|||+++++++--...|..
T Consensus        48 iLL~GppGtGKT~la~~iA~~~~~~~~   74 (256)
T d1lv7a_          48 VLMVGPPGTGKTLLAKAIAGEAKVPFF   74 (256)
T ss_dssp             EEEECCTTSCHHHHHHHHHHHHTCCEE
T ss_pred             EEeeCCCCCCccHHHHHHHHHcCCCEE
Confidence            899999999999999999988777764

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=93.25  E-value=0.014  Score=39.26  Aligned_cols=20  Identities=15%  Similarity=-0.017  Sum_probs=18.0

Q ss_pred             eeccCCCccchhhhhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~   56 (76)
                      ++.|.-+|||||++.|+|.+
T Consensus        29 ~i~G~NGsGKS~ileAi~~~   48 (427)
T d1w1wa_          29 SIIGPNGSGKSNMMDAISFV   48 (427)
T ss_dssp             EEECSTTSSHHHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHH
Confidence            67899999999999999864

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Escherichia coli [TaxId: 562]

Probab=93.17  E-value=0.015  Score=37.25  Aligned_cols=17  Identities=24%  Similarity=0.096  Sum_probs=14.8

Q ss_pred             eeccCCCccchhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        37 LLLGaGESGKST~~~~~   53 (76)
                      -|-|..+||||||++.+
T Consensus         7 gitG~igSGKStv~~~l   23 (208)
T d1vhta_           7 ALTGGIGSGKSTVANAF   23 (208)
T ss_dssp             EEECCTTSCHHHHHHHH
T ss_pred             EEECCCcCCHHHHHHHH
Confidence            47899999999999865

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6, N-domain
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]

Probab=93.11  E-value=0.017  Score=36.38  Aligned_cols=22  Identities=23%  Similarity=0.155  Sum_probs=19.1

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      -+||.|..++||||+++++.--
T Consensus        45 ~lll~GppGtGKT~l~~~l~~~   66 (276)
T d1fnna2          45 RATLLGRPGTGKTVTLRKLWEL   66 (276)
T ss_dssp             EEEEECCTTSSHHHHHHHHHHH
T ss_pred             ceEEECCCCCCHHHHHHHHHHH
Confidence            5899999999999999987643

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: MJ1267
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=92.99  E-value=0.017  Score=39.16  Aligned_cols=21  Identities=14%  Similarity=0.042  Sum_probs=18.5

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +-|+|..+|||||+++.++-.
T Consensus        33 ~~liG~nGaGKSTLl~~i~Gl   53 (254)
T d1g6ha_          33 TLIIGPNGSGKSTLINVITGF   53 (254)
T ss_dssp             EEEECSTTSSHHHHHHHHTTS
T ss_pred             EEEECCCCCcHHHHHHHHHCC
Confidence            478999999999999988765

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Rep 40 protein helicase domain
species: Adeno-associated virus 2, AAV2 [TaxId: 10804]

Probab=92.95  E-value=0.024  Score=38.72  Aligned_cols=28  Identities=18%  Similarity=0.137  Sum_probs=22.2

Q ss_pred             CccceeeccCCCccchhhhhhhhhhccc
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALCTTTSK   59 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~~~~~~   59 (76)
                      ++.=+.|.|.|.+|||||+.+++-.-..
T Consensus       103 k~n~~~l~G~~~tGKS~f~~~i~~~lg~  130 (267)
T d1u0ja_         103 KRNTIWLFGPATTGKTNIAEAIAHTVPF  130 (267)
T ss_dssp             TCCEEEEECSTTSSHHHHHHHHHHHSSC
T ss_pred             ccEEEEEEcCCCCCHHHHHHHHHHHhcc
Confidence            3445678899999999999998876543

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Dephospho-CoA kinase
species: Haemophilus influenzae [TaxId: 727]

Probab=92.88  E-value=0.018  Score=36.72  Aligned_cols=17  Identities=18%  Similarity=-0.037  Sum_probs=14.8

Q ss_pred             eeccCCCccchhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        37 LLLGaGESGKST~~~~~   53 (76)
                      =+-|..+|||||+++.+
T Consensus         6 gITG~igSGKStv~~~l   22 (205)
T d1jjva_           6 GLTGGIGSGKTTIANLF   22 (205)
T ss_dssp             EEECSTTSCHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHH
Confidence            47899999999999876

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Thermus aquaticus [TaxId: 271]

Probab=92.87  E-value=0.018  Score=38.52  Aligned_cols=22  Identities=9%  Similarity=0.075  Sum_probs=19.0

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      ++|-|+.-||||||+++..+..
T Consensus        38 ~iiTGpN~~GKSt~lk~i~l~~   59 (224)
T d1ewqa2          38 VLITGPNMAGKSTFLRQTALIA   59 (224)
T ss_dssp             EEEESCSSSSHHHHHHHHHHHH
T ss_pred             EEEECCCccccchhhhhhHHHH
Confidence            6889999999999999877653

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: LAO/AO transport system kinase ArgK
species: Escherichia coli [TaxId: 562]

Probab=92.85  E-value=0.045  Score=38.36  Aligned_cols=26  Identities=12%  Similarity=-0.008  Sum_probs=22.2

Q ss_pred             hhhCccceeeccCCCccchhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      ...+...|=+.|+++||||||+.++.
T Consensus        50 ~~~~~~~IgitG~pGaGKSTLi~~l~   75 (327)
T d2p67a1          50 YCGNTLRLGVTGTPGAGKSTFLEAFG   75 (327)
T ss_dssp             GCSCSEEEEEEECTTSCHHHHHHHHH
T ss_pred             ccCCceEEEeeCCCCCCHHHHHHHHH
Confidence            34568889999999999999999875

>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Dynamin G domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=92.67  E-value=0.018  Score=38.56  Aligned_cols=21  Identities=10%  Similarity=0.112  Sum_probs=19.1

Q ss_pred             cceeeccCCCccchhhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~   54 (76)
                      -+|.++|.--||||||+.++-
T Consensus        25 P~ivVvG~~ssGKSSliNaLl   45 (306)
T d1jwyb_          25 PQIVVVGSQSSGKSSVLENIV   45 (306)
T ss_dssp             CEEEEEECSSSSHHHHHHHHH
T ss_pred             CeEEEEeCCCCCHHHHHHHHh
Confidence            478999999999999999985

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Staphylococcus xylosus [TaxId: 1288]

Probab=92.66  E-value=0.049  Score=35.27  Aligned_cols=35  Identities=20%  Similarity=0.324  Sum_probs=24.9

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceeeeCceeEE
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEI   70 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~   70 (76)
                      .=+|+.|.+++||||+..++.--  .--+|.++.|.|
T Consensus        16 ~gvli~G~sg~GKS~la~~l~~~--g~~li~DD~~~~   50 (169)
T d1ko7a2          16 VGVLITGDSGIGKSETALELIKR--GHRLVADDNVEI   50 (169)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHT--TCEEEESSEEEE
T ss_pred             EEEEEEeCCCCCHHHHHHHHHHc--CCeEEeCCeEEE
Confidence            34799999999999988775433  334666666654

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Replication factor C4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=92.66  E-value=0.039  Score=35.06  Aligned_cols=20  Identities=10%  Similarity=0.089  Sum_probs=17.7

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      .+||-|..++||||+++.++
T Consensus        38 ~~ll~Gp~G~GKTt~a~~la   57 (224)
T d1sxjb2          38 HMIISGMPGIGKTTSVHCLA   57 (224)
T ss_dssp             CEEEECSTTSSHHHHHHHHH
T ss_pred             eEEEECCCCCCchhhHHHHH
Confidence            58999999999999988665

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Adenosine-5'phosphosulfate kinase (APS kinase)
domain: Adenosine-5'phosphosulfate kinase (APS kinase)
species: Fungus (Penicillium chrysogenum) [TaxId: 5076]

Probab=92.60  E-value=0.034  Score=36.16  Aligned_cols=20  Identities=20%  Similarity=0.245  Sum_probs=17.3

Q ss_pred             cceeeccCCCccchhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~   53 (76)
                      .=|++-|-++|||||+++.+
T Consensus        25 ~vIwltGlsGsGKTTia~~L   44 (208)
T d1m7ga_          25 LTIWLTGLSASGKSTLAVEL   44 (208)
T ss_dssp             EEEEEECSTTSSHHHHHHHH
T ss_pred             eEEEEECCCCCCHHHHHHHH
Confidence            34789999999999999876

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=92.59  E-value=0.02  Score=35.29  Aligned_cols=20  Identities=15%  Similarity=0.102  Sum_probs=17.1

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +++-|..+||||+|+.+++.
T Consensus        29 ~~I~G~~G~GKT~la~~~~~   48 (242)
T d1tf7a1          29 TLVSGTSGTGKTLFSIQFLY   48 (242)
T ss_dssp             EEEEESTTSSHHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHHH
Confidence            57789999999999988754

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Hypothetical protein Ygr205W
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=92.54  E-value=0.059  Score=37.45  Aligned_cols=42  Identities=14%  Similarity=0.042  Sum_probs=27.5

Q ss_pred             hhHHHHHHHHHhHHhhhCcc-ceeeccCCCccchhhhhhhhhh
Q psy6625          15 RSKQIEKNLKEDGIQAAKDI-KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        15 ~Sk~IDk~L~kekk~~~~ev-KLLLLGaGESGKST~~~~~~~~   56 (76)
                      ....+|+.+....+...+.- =|-+-|+.+|||||++..+...
T Consensus         8 ~~~~~~~~~~~~~~~~~~~P~iIGi~G~qGSGKSTl~~~l~~~   50 (286)
T d1odfa_           8 TIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNH   50 (286)
T ss_dssp             HHHHHHHHHHHHHTTTCCSCEEEEEECCTTSSHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCCCCCEEEEeECCCCCCHHHHHHHHHHH
Confidence            34566777776655444322 2235689999999999877654

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: DNA repair protein MutS, the C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=92.51  E-value=0.021  Score=38.23  Aligned_cols=21  Identities=10%  Similarity=0.096  Sum_probs=18.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++-|+.-||||||+++..+.
T Consensus        44 ~iiTGpN~~GKSt~lk~i~l~   64 (234)
T d1wb9a2          44 LIITGPNMGGKSTYMRQTALI   64 (234)
T ss_dssp             EEEECCTTSSHHHHHHHHHHH
T ss_pred             EEEeccCchhhHHHHHHHHHH
Confidence            577899999999999987654

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]

Probab=92.32  E-value=0.02  Score=38.68  Aligned_cols=22  Identities=14%  Similarity=0.075  Sum_probs=18.4

Q ss_pred             eeeccCCCccchhhhhhhhhhc
Q psy6625          36 LLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~~   57 (76)
                      +-|+|..+|||||+++.+.-..
T Consensus        31 ~glvG~nGaGKSTLl~~l~G~~   52 (238)
T d1vpla_          31 FGLIGPNGAGKTTTLRIISTLI   52 (238)
T ss_dssp             EEEECCTTSSHHHHHHHHTTSS
T ss_pred             EEEECCCCCCHHHHHHHHhcCC
Confidence            3589999999999999877553

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=92.26  E-value=0.025  Score=36.86  Aligned_cols=19  Identities=11%  Similarity=-0.081  Sum_probs=16.1

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      ++|.|+++|||+|+.+.++
T Consensus         5 ivi~GPSG~GK~tl~~~L~   23 (205)
T d1s96a_           5 YIVSAPSGAGKSSLIQALL   23 (205)
T ss_dssp             EEEECCTTSCHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4677999999999998765

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Circadian clock protein KaiC
species: Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]

Probab=92.24  E-value=0.023  Score=36.04  Aligned_cols=22  Identities=9%  Similarity=0.043  Sum_probs=18.4

Q ss_pred             ceeeccCCCccchhhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~   56 (76)
                      =+++-|.++||||+|++++..-
T Consensus        28 l~li~G~pGsGKT~l~~qia~~   49 (242)
T d1tf7a2          28 IILATGATGTGKTLLVSRFVEN   49 (242)
T ss_dssp             EEEEEECTTSSHHHHHHHHHHH
T ss_pred             EEEEEeCCCCCHHHHHHHHHHH
Confidence            3588899999999999887544

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Thermus thermophilus [TaxId: 274]

Probab=92.09  E-value=0.026  Score=36.54  Aligned_cols=21  Identities=14%  Similarity=0.162  Sum_probs=19.3

Q ss_pred             ccceeeccCCCccchhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~   53 (76)
                      ++++-++|-..+||||++.++
T Consensus         3 ~ini~iiGhvd~GKSTL~~~L   23 (204)
T d2c78a3           3 HVNVGTIGHVDHGKTTLTAAL   23 (204)
T ss_dssp             EEEEEEECSTTSSHHHHHHHH
T ss_pred             CeEEEEEeCCCCcHHHHHHHH
Confidence            578999999999999999887

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Metallochaperone MeaB
species: Methylobacterium extorquens [TaxId: 408]

Probab=91.74  E-value=0.067  Score=37.32  Aligned_cols=27  Identities=19%  Similarity=0.100  Sum_probs=22.8

Q ss_pred             hhhCccceeeccCCCccchhhhhhhhh
Q psy6625          29 QAAKDIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        29 ~~~~evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ...+...|=+.|++++|||||+-+++-
T Consensus        47 ~~~~~~~igitG~pGaGKSTli~~l~~   73 (323)
T d2qm8a1          47 QTGRAIRVGITGVPGVGKSTTIDALGS   73 (323)
T ss_dssp             GCCCSEEEEEECCTTSCHHHHHHHHHH
T ss_pred             ccCCceEEeeeCCCCCCHHHHHHHHHH
Confidence            334677888999999999999999875

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: HPr kinase HprK C-terminal domain
domain: HPr kinase HprK C-terminal domain
species: Lactobacillus casei [TaxId: 1582]

Probab=91.70  E-value=0.03  Score=36.62  Aligned_cols=35  Identities=17%  Similarity=0.259  Sum_probs=25.3

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceeeeCceeEEe
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMINNNTVEIG   71 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~~~~~   71 (76)
                      =+|+.|.+++||||++.++.-  ..--+|.++.|.|-
T Consensus        16 gvl~~G~sG~GKStlal~l~~--~g~~lv~DD~~~i~   50 (176)
T d1kkma_          16 GVLITGDSGVGKSETALELVQ--RGHRLIADDRVDVY   50 (176)
T ss_dssp             EEEEECCTTSCHHHHHHHHHH--TTCEEEEEEEEEEE
T ss_pred             EEEEEeCCCCCHHHHHHHHHH--cCCeEEecCeEEEE
Confidence            369999999999999876543  34456666666553

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Transcriptional activator sigm54 (NtrC1), C-terminal domain
species: Aquifex aeolicus [TaxId: 63363]

Probab=91.60  E-value=0.087  Score=35.02  Aligned_cols=40  Identities=15%  Similarity=0.130  Sum_probs=31.8

Q ss_pred             hhHHHHHHHHHhHHhhhCccceeeccCCCccchhhhhhhh
Q psy6625          15 RSKQIEKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        15 ~Sk~IDk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +|..+.+.+++-.+......-+|+.|..++||+++++++-
T Consensus         5 ~S~~~~~~~~~~~~~a~~~~pvlI~Ge~GtGK~~~A~~ih   44 (247)
T d1ny5a2           5 ESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIH   44 (247)
T ss_dssp             CSHHHHHHHHHHHHHTTCCSCEEEECSTTSSHHHHHHHHH
T ss_pred             cCHHHHHHHHHHHHHhCCCCCEEEECCCCcCHHHHHHHHH
Confidence            3556666666667777777789999999999999998874

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxynucleoside monophosphate kinase
species: Bacteriophage T4 [TaxId: 10665]

Probab=91.48  E-value=0.034  Score=35.56  Aligned_cols=19  Identities=16%  Similarity=0.072  Sum_probs=15.6

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |-|-|...|||||+++.+.
T Consensus         4 IgiTG~igSGKsTva~~l~   22 (241)
T d1deka_           4 IFLSGVKRSGKDTTADFIM   22 (241)
T ss_dssp             EEEECCTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4466999999999998763

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=91.33  E-value=0.05  Score=37.12  Aligned_cols=29  Identities=14%  Similarity=0.235  Sum_probs=24.5

Q ss_pred             ceeeccCCCccchhhhhhhhhhcccceee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMMI   63 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~~   63 (76)
                      -+||+|..++||+.+++++.-....|+..
T Consensus        51 ~iLl~GPpG~GKT~lAkalA~~~~~~~~~   79 (309)
T d1ofha_          51 NILMIGPTGVGKTEIARRLAKLANAPFIK   79 (309)
T ss_dssp             CEEEECCTTSSHHHHHHHHHHHHTCCEEE
T ss_pred             eEEEECCCCCCHHHHHHHHhhccccchhc
Confidence            47999999999999999998877666543

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Gene 4 protein (g4p, DNA primase), helicase domain
species: Bacteriophage T7 [TaxId: 10760]

Probab=91.22  E-value=0.037  Score=35.97  Aligned_cols=19  Identities=0%  Similarity=-0.183  Sum_probs=16.3

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      +++-|.+++|||||+.++.
T Consensus        38 ~vi~G~~G~GKT~~~~~la   56 (277)
T d1cr2a_          38 IMVTSGSGMGKSTFVRQQA   56 (277)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEEeCCCCCHHHHHHHHH
Confidence            5677889999999998875

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Bacterial conjugative coupling protein TrwB
species: Escherichia coli [TaxId: 562]

Probab=91.13  E-value=0.034  Score=38.25  Aligned_cols=20  Identities=25%  Similarity=0.172  Sum_probs=16.8

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -++++|+.+||||++++.+.
T Consensus        52 H~~I~G~tGsGKT~~l~~li   71 (433)
T d1e9ra_          52 HLLVNGATGTGKSVLLRELA   71 (433)
T ss_dssp             CEEEEECTTSSHHHHHHHHH
T ss_pred             eEEEEeCCCCcHHHHHHHHH
Confidence            37999999999999986543

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Pantothenate kinase PanK
species: Escherichia coli [TaxId: 562]

Probab=90.86  E-value=0.036  Score=38.85  Aligned_cols=24  Identities=8%  Similarity=0.018  Sum_probs=19.1

Q ss_pred             cceeeccCCCccchhhhhhhhhhc
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTT   57 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~   57 (76)
                      +=|-+-|+..||||||++.+-..-
T Consensus        81 ~iIGIaG~sgSGKSTla~~L~~lL  104 (308)
T d1sq5a_          81 YIISIAGSVAVGKSTTARVLQALL  104 (308)
T ss_dssp             EEEEEEECTTSSHHHHHHHHHHHH
T ss_pred             EEEEEeCCCCCCCcHHHHHHHHHH
Confidence            445577899999999999887653

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Extracellular secretion NTPase EpsE
species: Vibrio cholerae [TaxId: 666]

Probab=90.80  E-value=0.041  Score=39.15  Aligned_cols=24  Identities=17%  Similarity=-0.036  Sum_probs=19.8

Q ss_pred             ccceeeccCCCccchhhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~~   56 (76)
                      .-=+|+-|.-+|||||.+.++---
T Consensus       158 ~GliLvtGpTGSGKSTTl~~~l~~  181 (401)
T d1p9ra_         158 HGIILVTGPTGSGKSTTLYAGLQE  181 (401)
T ss_dssp             SEEEEEECSTTSCHHHHHHHHHHH
T ss_pred             hceEEEEcCCCCCccHHHHHHhhh
Confidence            345789999999999999987653

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

Probab=90.60  E-value=0.041  Score=37.22  Aligned_cols=21  Identities=19%  Similarity=0.278  Sum_probs=18.7

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      -+||.|..++||||+++++.-
T Consensus        30 ~vLl~G~pG~GKT~lar~~~~   50 (333)
T d1g8pa_          30 GVLVFGDRGTGKSTAVRALAA   50 (333)
T ss_dssp             CEEEECCGGGCTTHHHHHHHH
T ss_pred             eEEEECCCCccHHHHHHHHHH
Confidence            579999999999999998753

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CDC6-like protein APE0152, N-terminal domain
species: Aeropyrum pernix [TaxId: 56636]

Probab=90.41  E-value=0.05  Score=34.25  Aligned_cols=21  Identities=5%  Similarity=-0.164  Sum_probs=17.3

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      +++.|..++||||++++++--
T Consensus        49 l~l~GppGtGKT~l~~~l~~~   69 (287)
T d1w5sa2          49 YGSIGRVGIGKTTLAKFTVKR   69 (287)
T ss_dssp             EECTTCCSSSHHHHHHHHHHH
T ss_pred             EEeECCCCCCHHHHHHHHHHH
Confidence            455699999999999998743

>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor eIF2 gamma subunit, N-terminal (G) domain
species: Archaeon Pyrococcus abyssi [TaxId: 29292]

Probab=89.95  E-value=0.057  Score=33.85  Aligned_cols=22  Identities=14%  Similarity=0.232  Sum_probs=19.9

Q ss_pred             CccceeeccCCCccchhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~   53 (76)
                      .++++-++|--.+||||++.++
T Consensus         4 ~~inIaiiGhvd~GKSTL~~~L   25 (195)
T d1kk1a3           4 AEVNIGMVGHVDHGKTTLTKAL   25 (195)
T ss_dssp             EEEEEEEECSTTSSHHHHHHHH
T ss_pred             CcEEEEEEeccCCcHHHHHHHH
Confidence            3678999999999999999988

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=89.92  E-value=0.058  Score=33.35  Aligned_cols=19  Identities=11%  Similarity=-0.046  Sum_probs=15.9

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.+=|.-+|||||+++.+.
T Consensus         3 I~ieG~dGsGKST~~~~L~   21 (208)
T d1gsia_           3 IAIEGVDGAGKRTLVEKLS   21 (208)
T ss_dssp             EEEECSTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4566999999999998775

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor eIF2 gamma subunit, N-terminal (G) domain
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=89.65  E-value=0.064  Score=34.00  Aligned_cols=24  Identities=8%  Similarity=0.142  Sum_probs=20.9

Q ss_pred             hCccceeeccCCCccchhhhhhhh
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~   54 (76)
                      +-++.+-.+|--.+||||++.++-
T Consensus         6 ~p~ini~iiGhVd~GKSTL~~~L~   29 (205)
T d2qn6a3           6 QPEVNIGVVGHVDHGKTTLVQAIT   29 (205)
T ss_dssp             CCCEEEEEECSTTSSHHHHHHHHH
T ss_pred             CCCeEEEEEEccCCcHHHHHHHHH
Confidence            446889999999999999998874

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

Probab=89.55  E-value=0.064  Score=35.86  Aligned_cols=31  Identities=19%  Similarity=0.223  Sum_probs=21.4

Q ss_pred             hCccceeeccCCCccchhhhhhhh-----hhcccce
Q psy6625          31 AKDIKLLLLGEYFSSQMVPSLALC-----TTTSKPM   61 (76)
Q Consensus        31 ~~evKLLLLGaGESGKST~~~~~~-----~~~~~~~   61 (76)
                      .+.+++.++|-+.+|||||+.++.     .|.+.|-
T Consensus       110 ~~~~~v~vvG~PNvGKSsliN~L~~~~~~~~~~~pG  145 (273)
T d1puja_         110 PRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPG  145 (273)
T ss_dssp             CCCEEEEEEESTTSSHHHHHHHHHTSCCC-------
T ss_pred             CCceEEEEEecCccchhhhhhhhhccceEEECCccc
Confidence            367899999999999999999864     4555554

>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Aminoacid dehydrogenase-like, C-terminal domain
domain: Shikimate 5-dehydrogenase-like protein HI0607
species: Haemophilus influenzae [TaxId: 727]

Probab=89.16  E-value=0.1  Score=32.56  Aligned_cols=44  Identities=16%  Similarity=0.138  Sum_probs=26.1

Q ss_pred             HHHHHHhHHhhhCccceeeccCCCccchhhhhhhhhhcccceeeeCc
Q psy6625          20 EKNLKEDGIQAAKDIKLLLLGEYFSSQMVPSLALCTTTSKPMMINNN   66 (76)
Q Consensus        20 Dk~L~kekk~~~~evKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~   66 (76)
                      .+.|++.+..  +.-|+|+||+|+++|+.. .+++--..+.+.|-|.
T Consensus         6 ~~~l~~~~~~--~~~~vlIlGaGGaarai~-~aL~~~g~~~I~I~nR   49 (167)
T d1npya1           6 VKLIEKYHLN--KNAKVIVHGSGGMAKAVV-AAFKNSGFEKLKIYAR   49 (167)
T ss_dssp             HHHHHHTTCC--TTSCEEEECSSTTHHHHH-HHHHHTTCCCEEEECS
T ss_pred             HHHHHHcCCC--CCCeEEEECCCHHHHHHH-HHHHHCCCCEEEEecc
Confidence            3444444322  345899999999999954 4454444344444443

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=88.79  E-value=0.065  Score=37.42  Aligned_cols=21  Identities=5%  Similarity=-0.058  Sum_probs=14.2

Q ss_pred             eeeccCCCccchhhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT   56 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~   56 (76)
                      |-+-|+++||||||.+++--+
T Consensus         7 IgIaG~SGSGKTTva~~l~~i   27 (288)
T d1a7ja_           7 ISVTGSSGAGTSTVKHTFDQI   27 (288)
T ss_dssp             EEEESCC---CCTHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHHH
Confidence            567799999999999887543

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxycytidine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=88.63  E-value=0.079  Score=33.18  Aligned_cols=21  Identities=14%  Similarity=0.044  Sum_probs=17.3

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      .|.+=|.-+|||||+++.+--
T Consensus         4 ~I~ieG~dGsGKST~~~~L~~   24 (241)
T d1p5zb_           4 KISIEGNIAAGKSTFVNILKQ   24 (241)
T ss_dssp             EEEEECSTTSSHHHHHTTTGG
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            356679999999999998764

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=88.56  E-value=0.08  Score=35.73  Aligned_cols=20  Identities=10%  Similarity=-0.208  Sum_probs=17.7

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ...++|.++.||||++.++.
T Consensus        97 t~~~~G~SGVGKSTLiN~L~  116 (225)
T d1u0la2          97 ISTMAGLSGVGKSSLLNAIN  116 (225)
T ss_dssp             EEEEECSTTSSHHHHHHHHS
T ss_pred             eEEEECCCCCCHHHHHHhhc
Confidence            45888999999999999884

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

Probab=88.49  E-value=0.075  Score=35.82  Aligned_cols=23  Identities=13%  Similarity=0.027  Sum_probs=20.7

Q ss_pred             CccceeeccCCCccchhhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~~   54 (76)
                      .-.|+=|+|=+.+|||||..++.
T Consensus         9 ~~~kiGivG~Pn~GKSTlfnalT   31 (296)
T d1ni3a1           9 NNLKTGIVGMPNVGKSTFFRAIT   31 (296)
T ss_dssp             SCCEEEEEECSSSSHHHHHHHHH
T ss_pred             CCcEEEEECCCCCCHHHHHHHHH
Confidence            45789999999999999999986

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: RecA protein, ATPase-domain
species: Escherichia coli [TaxId: 562]

Probab=88.25  E-value=0.069  Score=36.29  Aligned_cols=24  Identities=13%  Similarity=0.169  Sum_probs=20.5

Q ss_pred             eeccCCCccchhhhhhhhhhcccc
Q psy6625          37 LLLGEYFSSQMVPSLALCTTTSKP   60 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~~~~~~~   60 (76)
                      ++-|...||||||+.++|.-..+|
T Consensus        58 ei~G~~gsGKTtl~l~~~~~~q~~   81 (263)
T d1u94a1          58 EIYGPESSGKTTLTLQVIAAAQRE   81 (263)
T ss_dssp             EEECSTTSSHHHHHHHHHHHHHHT
T ss_pred             EEecCCCcHHHHHHHHHHHHHHcC
Confidence            566788899999999999888765

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Deoxyguanosine kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=88.04  E-value=0.065  Score=33.95  Aligned_cols=20  Identities=15%  Similarity=0.026  Sum_probs=16.3

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      |.+=|.-+|||||+++.+.-
T Consensus         5 IviEG~~GsGKST~~~~L~~   24 (241)
T d2ocpa1           5 LSIEGNIAVGKSTFVKLLTK   24 (241)
T ss_dssp             EEEEECTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHH
Confidence            34558999999999998864

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein PH0525
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=87.91  E-value=0.086  Score=35.33  Aligned_cols=19  Identities=11%  Similarity=-0.053  Sum_probs=17.8

Q ss_pred             ceeeccCCCccchhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~   53 (76)
                      |+=|.|-+.+||||+..++
T Consensus         2 ~v~lvG~pn~GKStlfn~l   20 (319)
T d1wxqa1           2 EIGVVGKPNVGKSTFFSAA   20 (319)
T ss_dssp             EEEEEECTTSSHHHHHHHH
T ss_pred             cEeEECCCCCCHHHHHHHH
Confidence            6789999999999999998

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: YjeE-like
domain: Hypothetical protein HI0065
species: Haemophilus influenzae [TaxId: 727]

Probab=87.90  E-value=0.099  Score=33.60  Aligned_cols=21  Identities=10%  Similarity=0.108  Sum_probs=18.5

Q ss_pred             ceeeccCCCccchhhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~   55 (76)
                      =++|=|.=+|||+||++.++-
T Consensus        35 ii~L~G~LGaGKTtfvr~~~~   55 (158)
T d1htwa_          35 MVYLNGDLGAGKTTLTRGMLQ   55 (158)
T ss_dssp             EEEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEecCCCccHHHHHHHHHh
Confidence            378889999999999999874

>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Dethiobiotin synthetase
species: Escherichia coli [TaxId: 562]

Probab=87.55  E-value=0.097  Score=31.89  Aligned_cols=22  Identities=23%  Similarity=0.232  Sum_probs=18.1

Q ss_pred             ceeeccCC-Cccchhhhhhhhhh
Q psy6625          35 KLLLLGEY-FSSQMVPSLALCTT   56 (76)
Q Consensus        35 KLLLLGaG-ESGKST~~~~~~~~   56 (76)
                      |+.+-|+| +.||||+...+...
T Consensus         3 ~~~i~gt~~GVGKTtvs~~La~a   25 (224)
T d1byia_           3 RYFVTGTDTEVGKTVASCALLQA   25 (224)
T ss_dssp             EEEEEESSTTSCHHHHHHHHHHH
T ss_pred             eEEEEECCCCccHHHHHHHHHHH
Confidence            67889998 99999998766543

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Initiation factor IF2/eIF5b, N-terminal (G) domain
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]

Probab=87.20  E-value=0.11  Score=33.44  Aligned_cols=20  Identities=10%  Similarity=-0.026  Sum_probs=17.7

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +-++|-..+|||||+.++.-
T Consensus         8 IaIiGh~d~GKSTL~~~L~~   27 (227)
T d1g7sa4           8 VSVLGHVDHGKTTLLDHIRG   27 (227)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEEeCCCccHHHHHHHHHh
Confidence            67899999999999988854

>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

Probab=87.20  E-value=0.099  Score=33.81  Aligned_cols=21  Identities=14%  Similarity=0.205  Sum_probs=19.0

Q ss_pred             ccceeeccCCCccchhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~   53 (76)
                      ++.+-++|--.|||||++-++
T Consensus         3 ~iNi~viGHVd~GKTTL~~~L   23 (224)
T d1jnya3           3 HLNLIVIGHVDHGKSTLVGRL   23 (224)
T ss_dssp             EEEEEEEESTTSSHHHHHHHH
T ss_pred             ccEEEEEecCCCCHHHHHHHH
Confidence            578899999999999999877

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=87.14  E-value=0.31  Score=31.03  Aligned_cols=20  Identities=20%  Similarity=-0.037  Sum_probs=17.5

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      -+|+-|..++||+|+++.+.
T Consensus        26 ~lLl~Gp~G~GKtt~a~~~a   45 (207)
T d1a5ta2          26 ALLIQALPGMGDDALIYALS   45 (207)
T ss_dssp             EEEEECCTTSCHHHHHHHHH
T ss_pred             EEEEECCCCCcHHHHHHHHH
Confidence            48999999999999998654

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Escherichia coli [TaxId: 562]

Probab=87.04  E-value=0.11  Score=32.65  Aligned_cols=19  Identities=5%  Similarity=0.036  Sum_probs=15.9

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.+=|.-+|||||++..+.
T Consensus         5 IviEG~dGsGKsT~~~~L~   23 (210)
T d4tmka_           5 IVIEGLEGAGKTTARNVVV   23 (210)
T ss_dssp             EEEEECTTSCHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4556999999999998876

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Papillomavirus large T antigen helicase domain
species: Simian virus 40 [TaxId: 10633]

Probab=86.94  E-value=0.14  Score=36.11  Aligned_cols=28  Identities=18%  Similarity=0.084  Sum_probs=24.9

Q ss_pred             ceeeccCCCccchhhhhhhhhhccccee
Q psy6625          35 KLLLLGEYFSSQMVPSLALCTTTSKPMM   62 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~~~~~~~~~   62 (76)
                      -+|+-|.+++|||+|..+++--...|+.
T Consensus       156 ~~~~~g~~~~gk~~~~~~~~~~~~~~~i  183 (362)
T d1svma_         156 YWLFKGPIDSGKTTLAAALLELCGGKAL  183 (362)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHHHCCEEE
T ss_pred             eEEEECCCCCCHHHHHHHHHHHcCCCEE
Confidence            3899999999999999999988887765

>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU
species: Salmonella typhimurium [TaxId: 90371]

Probab=86.68  E-value=0.15  Score=33.07  Aligned_cols=18  Identities=28%  Similarity=0.224  Sum_probs=16.6

Q ss_pred             eeeccCCCccchhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~   53 (76)
                      +|++|..-||||.|..++
T Consensus         2 iLVtGGarSGKS~~AE~l   19 (180)
T d1c9ka_           2 ILVTGGARSGKSRHAEAL   19 (180)
T ss_dssp             EEEEECTTSSHHHHHHHH
T ss_pred             EEEECCCCccHHHHHHHH
Confidence            589999999999999886

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: Hypothetical protein YjiA, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=86.26  E-value=0.13  Score=33.41  Aligned_cols=18  Identities=17%  Similarity=0.012  Sum_probs=14.5

Q ss_pred             eeccCCCccchhhhhhhh
Q psy6625          37 LLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        37 LLLGaGESGKST~~~~~~   54 (76)
                      ++-|--+||||||++.+-
T Consensus         7 iitGFLGaGKTTll~~lL   24 (222)
T d1nija1           7 LLTGFLGAGKTTLLRHIL   24 (222)
T ss_dssp             EEEESSSSSCHHHHHHHH
T ss_pred             EEeeCCCCCHHHHHHHHH
Confidence            566778999999998763

>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain
species: Cow (Bos taurus), mitochondrial [TaxId: 9913]

Probab=85.76  E-value=0.15  Score=32.86  Aligned_cols=23  Identities=9%  Similarity=0.125  Sum_probs=20.1

Q ss_pred             ccceeeccCCCccchhhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~~   55 (76)
                      ++++-++|-..+||||++.++.-
T Consensus         3 ~ini~iiGHvd~GKSTL~~~l~~   25 (196)
T d1d2ea3           3 HVNVGTIGHVDHGKTTLTAAITK   25 (196)
T ss_dssp             EEEEEEESSTTSSHHHHHHHHHH
T ss_pred             CcEEEEEeCCCCcHHHHHHHHHH
Confidence            57888999999999999998853

>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain
species: Pseudomonas syringae pv. tomato [TaxId: 323]

Probab=85.72  E-value=0.11  Score=34.10  Aligned_cols=22  Identities=14%  Similarity=0.073  Sum_probs=19.8

Q ss_pred             CccceeeccCCCccchhhhhhh
Q psy6625          32 KDIKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        32 ~evKLLLLGaGESGKST~~~~~   53 (76)
                      ..+++..+|=-.+||||++.++
T Consensus         8 ~~~~i~viGHVd~GKSTL~~~L   29 (222)
T d1zunb3           8 EMLRFLTCGNVDDGKSTLIGRL   29 (222)
T ss_dssp             EEEEEEEECCTTSSHHHHHHHH
T ss_pred             CcceEEEEcCCCCCHHHHHHHH
Confidence            4678999999999999999887

>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: YchF GTP-binding protein N-terminal domain
species: Haemophilus influenzae [TaxId: 727]

Probab=85.59  E-value=0.15  Score=33.85  Aligned_cols=20  Identities=20%  Similarity=-0.026  Sum_probs=17.9

Q ss_pred             cceeeccCCCccchhhhhhh
Q psy6625          34 IKLLLLGEYFSSQMVPSLAL   53 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~   53 (76)
                      +|+=|+|=+.+|||||..++
T Consensus         3 ~~~GivG~Pn~GKSTlf~~l   22 (278)
T d1jala1           3 FKCGIVGLPNVGKSTLFNAL   22 (278)
T ss_dssp             CEEEEECCTTSSHHHHHHHH
T ss_pred             ceEEEECCCCCCHHHHHHHH
Confidence            57789999999999999976

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: HslU
species: Haemophilus influenzae [TaxId: 727]

Probab=84.69  E-value=0.24  Score=35.83  Aligned_cols=34  Identities=15%  Similarity=0.189  Sum_probs=29.4

Q ss_pred             cceeeccCCCccchhhhhhhhhhcccceeeeCce
Q psy6625          34 IKLLLLGEYFSSQMVPSLALCTTTSKPMMINNNT   67 (76)
Q Consensus        34 vKLLLLGaGESGKST~~~~~~~~~~~~~~~~~~~   67 (76)
                      -.+||+|..+|||+-+++.+--...-|+.+-.-|
T Consensus        50 sNILliGPTGvGKTlLAr~LAk~l~VPFv~~daT   83 (443)
T d1g41a_          50 KNILMIGPTGVGKTEIARRLAKLANAPFIKVEAT   83 (443)
T ss_dssp             CCEEEECCTTSSHHHHHHHHHHHTTCCEEEEEGG
T ss_pred             ccEEEECCCCCCHHHHHHHHHHHhCCCEEEeecc
Confidence            3699999999999999998877789999886655

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: delta prime subunit of DNA polymerase III, N-domain
species: Escherichia coli [TaxId: 562]

Probab=84.35  E-value=0.5  Score=30.19  Aligned_cols=20  Identities=15%  Similarity=0.042  Sum_probs=17.3

Q ss_pred             eeeccCCCccchhhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALCT   55 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~   55 (76)
                      +|+=|..++||+|++..++-
T Consensus        37 ~Ll~Gp~G~GKtt~a~~~~~   56 (239)
T d1njfa_          37 YLFSGTRGVGKTSIARLLAK   56 (239)
T ss_dssp             EEEECSTTSSHHHHHHHHHH
T ss_pred             EEEECCCCCcHHHHHHHHHH
Confidence            67789999999999988753

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nitrogenase iron protein-like
domain: GTPase domain of the signal sequence recognition protein Ffh
species: Thermus aquaticus [TaxId: 271]

Probab=84.14  E-value=0.17  Score=33.23  Aligned_cols=34  Identities=18%  Similarity=0.287  Sum_probs=21.2

Q ss_pred             eeeccCCCccchhhhhhhhhh----cccceeeeCceeE
Q psy6625          36 LLLLGEYFSSQMVPSLALCTT----TSKPMMINNNTVE   69 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~~~----~~~~~~~~~~~~~   69 (76)
                      ++|.|..++||||.+--+..-    -.++.+|.-.|..
T Consensus        13 i~lvGp~GvGKTTTiaKLA~~~~~~g~kV~lit~Dt~R   50 (207)
T d1ls1a2          13 WFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR   50 (207)
T ss_dssp             EEEECCTTTTHHHHHHHHHHHHHHTTCCEEEEECCSSC
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHCCCcEEEEeccccc
Confidence            577899999999987544321    2344555444443

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase EngC (YjeQ), C-terminal domain
species: Bacillus subtilis [TaxId: 1423]

Probab=83.94  E-value=0.069  Score=36.25  Aligned_cols=20  Identities=10%  Similarity=-0.014  Sum_probs=17.6

Q ss_pred             ceeeccCCCccchhhhhhhh
Q psy6625          35 KLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        35 KLLLLGaGESGKST~~~~~~   54 (76)
                      ..+|+|.++.||||++.++.
T Consensus        99 ~~vl~G~SGVGKSSLiN~L~  118 (231)
T d1t9ha2          99 TTVFAGQSGVGKSSLLNAIS  118 (231)
T ss_dssp             EEEEEESHHHHHHHHHHHHC
T ss_pred             eEEEECCCCccHHHHHHhhc
Confidence            45788999999999999885

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Thymidylate kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=81.76  E-value=0.25  Score=31.59  Aligned_cols=19  Identities=21%  Similarity=0.169  Sum_probs=14.7

Q ss_pred             eeeccCCCccchhhhhhhh
Q psy6625          36 LLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        36 LLLLGaGESGKST~~~~~~   54 (76)
                      |.+-|.-+|||||.++.+.
T Consensus         6 I~ieG~dGsGKsT~~~~L~   24 (209)
T d1nn5a_           6 IVLEGVDRAGKSTQSRKLV   24 (209)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            4455999999999777653

>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Elongation factor eEF-1alpha, N-terminal (G) domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=80.51  E-value=0.28  Score=32.45  Aligned_cols=22  Identities=18%  Similarity=0.256  Sum_probs=19.4

Q ss_pred             ccceeeccCCCccchhhhhhhh
Q psy6625          33 DIKLLLLGEYFSSQMVPSLALC   54 (76)
Q Consensus        33 evKLLLLGaGESGKST~~~~~~   54 (76)
                      .+.|-++|-.++||||++-++-
T Consensus         6 ~iNi~iiGHvD~GKsTl~~~ll   27 (239)
T d1f60a3           6 HINVVVIGHVDSGKSTTTGHLI   27 (239)
T ss_dssp             EEEEEEEECTTSCHHHHHHHHH
T ss_pred             ccEEEEEeCCCCCHHHHHHHHH
Confidence            4789999999999999987774