Psyllid ID: psy667

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MTSSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHccccHHHcccccccccHHHHHHHccccccccHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccEEEEEccEEEccccHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccEEEEEEEccccccccEEEEEcccccccccccEEEEEcccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEcccccccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHcccccEcHHHHHHcccccccccccHHHHHHHHHHccccccHcccccEEEcccccccccccccccEcEEEEEEccccHHHHHHHHHHHccEEEEEcHHHcccccccEEcccccccccccccEEEEEEEEEEccccEEEEEEccEcccccEccEEEEEcccccccHHHccEEEEEccc
MTSSIQRLVLEKKAIMLIQAVFLLCGVAsclclpsltdritDQVVARVDTLAIegsltfdneNILETFKAFIVKRGRQYANDEEIKERFEYFKqdghkkherygtsefsdrspeeilCKTGFKWSERTYERIVADREKVEKMLMEVEkdgpvpdawdwrkknvtgpagdqaacgscwafsiAGKFSNYLLQYLNHIDQFCLLifpgmlegqyaiktgklveFSKSQLVECAkqcsgcdgcffepsiEYTHqaglesekdypyknangekfkcaydkskvklftgkdflhfngsETMKKILYkygplsvllnsdlihdyngtpirkndetcspydlGHAVLLVGygkqdnipywlvrnswgpigpdegffkiergnnacgieqiagyatidvv
MTSSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIegsltfdneniLETFKAFIVKRGRQYANDEEIKERFEyfkqdghkkherygtsefsdrspeeilcktgfkwsertyeRIVADREKVEKMLMEVekdgpvpdawdWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
MTSSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTYERIVADRekvekmlmevekDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
******RLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYF***********************ILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATID**
********VLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKW************************DGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
MTSSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHK**************PEEILCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
**SSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWS******************MEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDV*
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSIQRLVLEKKAIMLIQAVFLLCGVASCLCLPSLTDRITDQVVARVDTLAIEGSLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHERYGTSEFSDRSPEEILCKTGFKWSERTxxxxxxxxxxxxxxxxxxxxxGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATIDVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query392 2.2.26 [Sep-21-2011]
Q8V5U0367 Viral cathepsin OS=Heliot N/A N/A 0.729 0.779 0.284 7e-40
Q80LP4337 Viral cathepsin OS=Adoxop N/A N/A 0.803 0.934 0.311 1e-39
Q9VN93614 Putative cysteine protein yes N/A 0.829 0.529 0.297 2e-39
Q10716371 Cysteine proteinase 1 OS= N/A N/A 0.727 0.768 0.306 8e-37
O10364324 Viral cathepsin OS=Orgyia N/A N/A 0.716 0.867 0.289 1e-35
Q9UBX1484 Cathepsin F OS=Homo sapie yes N/A 0.795 0.644 0.284 3e-35
Q8QLK1337 Viral cathepsin OS=Mamest N/A N/A 0.798 0.928 0.312 8e-35
P43295361 Probable cysteine protein no N/A 0.801 0.869 0.280 2e-34
P43296368 Cysteine proteinase RD19a no N/A 0.724 0.771 0.305 3e-34
P05167362 Thiol protease aleurain O N/A N/A 0.788 0.853 0.281 3e-34
>sp|Q8V5U0|CATV_NPVHZ Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function desciption
 Score =  165 bits (417), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 98/345 (28%), Positives = 171/345 (49%), Gaps = 59/345 (17%)

Query: 68  FKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHER--------------------YGTSE 107
           FK F+ +  + Y + +E + R+  FK + +K + +                    +G ++
Sbjct: 57  FKHFLQQYNKSYDDPKEYQYRYNVFKDNLNKINSQNRENLLNNKNNNDSLSTSAQFGVNK 116

Query: 108 FSDRSPEEIL-CKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGP 166
           FSD++P+E+L   TGF  +   +  +  +R      +++   D  +PD +DWR  N   P
Sbjct: 117 FSDKTPDEVLHSNTGFFLNLSQHYTLCENR------IVKGAPDIRLPDYYDWRDTNKVTP 170

Query: 167 AGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQ 226
             DQ  CGSCWAF                       +  G +E QYAI+  KL++ S+ Q
Sbjct: 171 IKDQGVCGSCWAF-----------------------VAIGNIESQYAIRHNKLIDLSEQQ 207

Query: 227 LVECAKQCSGCDGCFFEPSI-EYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGK 285
           L++C +   GC+G     +  E     G+E+E DYPY+   G +  C  D  K+ +    
Sbjct: 208 LLDCDEVDLGCNGGLMHLAFQELLLMGGVETEADYPYQ---GSEQMCTLDNRKIAVKLNS 264

Query: 286 DFLH-FNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGY 344
            F +       +K+++Y  GP+++ +++  I +Y    + +    C  YDL HAVLL+G+
Sbjct: 265 CFKYDIRDENKLKELVYTTGPVAIAVDAMDIINYRRGILNQ----CHIYDLNHAVLLIGW 320

Query: 345 GKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATI 389
           G ++N+PYW+++NSWG    + GF ++ R  NACG+    G +++
Sbjct: 321 GIENNVPYWIIKNSWGEDWGENGFLRVRRNVNACGLLNEFGASSV 365
Cysteine protease that plays an essential role in host liquefaction to facilitate horizontal transmission of the virus. May participate in the degradation of foreign protein expressed by the baculovirus system.
Lepidoptera (taxid: 7088)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 5EC: 0
>sp|Q80LP4|CATV_NPVAH Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2 Back     alignment and function description
>sp|Q10716|CYSP1_MAIZE Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1 Back     alignment and function description
>sp|O10364|CATV_NPVOP Viral cathepsin OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|Q9UBX1|CATF_HUMAN Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1 Back     alignment and function description
>sp|Q8QLK1|CATV_NPVMC Viral cathepsin OS=Mamestra configurata nucleopolyhedrovirus GN=VCATH PE=3 SV=1 Back     alignment and function description
>sp|P43295|A494_ARATH Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2 Back     alignment and function description
>sp|P43296|RD19A_ARATH Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1 Back     alignment and function description
>sp|P05167|ALEU_HORVU Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
67773380322 cysteine protease 9 [Paragonimus westerm 0.724 0.881 0.354 2e-43
67773370321 cysteine protease 3 [Paragonimus westerm 0.727 0.887 0.346 2e-42
156546466 1036 PREDICTED: hypothetical protein LOC10012 0.739 0.279 0.334 5e-42
67773374325 cysteine protease 6 [Paragonimus westerm 0.719 0.867 0.329 6e-42
56718883327 westerpain-10 [Paragonimus westermani] 0.780 0.935 0.327 2e-41
242014216434 Cathepsin F precursor, putative [Pedicul 0.770 0.695 0.312 2e-41
56718881322 westerpain-1 [Paragonimus westermani] 0.729 0.888 0.335 2e-41
67773382322 cysteine protease 11 [Paragonimus wester 0.724 0.881 0.343 3e-41
244790097 586 cathepsin F isoform 2 precursor [Acyrtho 0.772 0.517 0.320 7e-41
260234113 2676 cysteine proteinase inhibitor precursor 0.729 0.106 0.318 1e-40
>gi|67773380|gb|AAY81947.1| cysteine protease 9 [Paragonimus westermani] Back     alignment and taxonomy information
 Score =  183 bits (464), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 171/336 (50%), Gaps = 52/336 (15%)

Query: 66  ETFKAFIVKRGRQYANDEEIKERFEYFKQDGHKKHE---------RYGTSEFSDRSPEEI 116
           E ++ F    G+ YAN+++ K RF  FK +  +  +         RYG ++FSD +PEE 
Sbjct: 25  ELYEQFKRDYGKVYANEDDQK-RFAIFKDNLVRAQKLQLKDQGTARYGVTQFSDLTPEEF 83

Query: 117 LCKTGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSC 176
             K         Y R   + ++VE++     K    P+  DWR+K       +Q +CGSC
Sbjct: 84  AAK---------YLRAAVNNDQVERVRPTGLK--AAPERMDWREKGAVTAVENQGSCGSC 132

Query: 177 WAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEFSKSQLVECAKQCSG 236
           WAFS AG                        +EGQ+ IKTG+LV  SK QLV+C +   G
Sbjct: 133 WAFSAAGN-----------------------VEGQWFIKTGQLVSLSKQQLVDCDRVAEG 169

Query: 237 CDGCFFEPS-IEYTHQAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKDFLHFNGS-- 293
           C+G +   S +E  H  GLESE DYPY    G +  CA +K K  L    D L   G+  
Sbjct: 170 CNGGWPVSSYLEIKHMGGLESESDYPYV---GAEQTCALNKEK--LLAKIDDLIVLGAYE 224

Query: 294 ETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYW 353
           E     L ++GPLS LLN+  +  Y    +    E C   +L HAVL VGY K+ ++PYW
Sbjct: 225 EEHAAYLAEHGPLSTLLNAVALQHYQSGVLNPTYEECPDTELNHAVLTVGYDKEGDMPYW 284

Query: 354 LVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATI 389
           +++NSWG    ++G+F++ RG+  CGI ++A  A I
Sbjct: 285 IIKNSWGTDWGEKGYFRLFRGDYTCGINRMATSAII 320

Source: Paragonimus westermani

Species: Paragonimus westermani

Genus: Paragonimus

Family: Paragonimidae

Order: Plagiorchiida

Class: Trematoda

Phylum: Platyhelminthes

Superkingdom: Eukaryota
>gi|67773370|gb|AAY81942.1| cysteine protease 3 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|156546466|ref|XP_001607324.1| PREDICTED: hypothetical protein LOC100123649 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|67773374|gb|AAY81944.1| cysteine protease 6 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|56718883|gb|AAW28152.1| westerpain-10 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|242014216|ref|XP_002427787.1| Cathepsin F precursor, putative [Pediculus humanus corporis] gi|212512256|gb|EEB15049.1| Cathepsin F precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|56718881|gb|AAW28151.1| westerpain-1 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|67773382|gb|AAY81948.1| cysteine protease 11 [Paragonimus westermani] Back     alignment and taxonomy information
>gi|244790097|ref|NP_001156454.1| cathepsin F isoform 2 precursor [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|260234113|dbj|BAI44279.1| cysteine proteinase inhibitor precursor [Manduca sexta] gi|261336196|dbj|BAH59606.2| cysteine proteinase inhibitor precursor [Manduca sexta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
WB|WBGene00007055477 tag-196 [Caenorhabditis elegan 0.456 0.375 0.365 8.8e-40
FB|FBgn0260462614 CG12163 [Drosophila melanogast 0.459 0.293 0.347 1e-39
TAIR|locus:2050145361 AT2G21430 [Arabidopsis thalian 0.520 0.565 0.337 1.9e-39
UNIPROTKB|O46427335 CTSH "Pro-cathepsin H" [Sus sc 0.441 0.516 0.366 1.1e-38
UNIPROTKB|Q3T0I2335 CTSH "Pro-cathepsin H" [Bos ta 0.443 0.519 0.363 9.3e-38
UNIPROTKB|E2RR02460 CTSF "Uncharacterized protein" 0.451 0.384 0.340 3.1e-37
UNIPROTKB|F7B939336 CTSH "Uncharacterized protein" 0.443 0.517 0.347 4e-37
UNIPROTKB|F1RU48460 CTSF "Uncharacterized protein" 0.451 0.384 0.340 4.3e-37
UNIPROTKB|Q9UBX1484 CTSF "Cathepsin F" [Homo sapie 0.459 0.371 0.329 4.7e-37
UNIPROTKB|F1P3U9261 CTSH "Uncharacterized protein" 0.448 0.674 0.372 5.1e-37
WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 302 (111.4 bits), Expect = 8.8e-40, Sum P(2) = 8.8e-40
 Identities = 69/189 (36%), Positives = 101/189 (53%)

Query:   206 GMLEGQYAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTH---QAGLESEKDYPY 262
             G +EG + I   KLV  S+ +LV+C     GC+G    PS  Y       GLE E  YPY
Sbjct:   295 GNVEGAWFIAKNKLVSLSEQELVDCDSMDQGCNGGL--PSNAYKEIIRMGGLEPEDAYPY 352

Query:   263 KNANGEKFKCAYDKSKVKLF-TGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGT 321
              +  GE   C   +  + ++  G   L  +  E M+K L   GP+S+ LN++ +  Y   
Sbjct:   353 -DGRGET--CHLVRKDIAVYINGSVELPHDEVE-MQKWLVTKGPISIGLNANTLQFYRHG 408

Query:   322 PIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIE 381
              +      C P+ L H VL+VGYGK    PYW+V+NSWGP   + G+FK+ RG N CG++
Sbjct:   409 VVHPFKIFCEPFMLNHGVLIVGYGKDGRKPYWIVKNSWGPNWGEAGYFKLYRGKNVCGVQ 468

Query:   382 QIAGYATID 390
             ++A  A ++
Sbjct:   469 EMATSALVN 477
GO:0004869 "cysteine-type endopeptidase inhibitor activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008234 "cysteine-type peptidase activity" evidence=IEA
FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2050145 AT2G21430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O46427 CTSH "Pro-cathepsin H" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0I2 CTSH "Pro-cathepsin H" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F7B939 CTSH "Uncharacterized protein" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBX1 CTSF "Cathepsin F" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3U9 CTSH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.22LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 1e-67
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 5e-67
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 6e-48
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 3e-38
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 7e-34
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 3e-33
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 9e-33
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 3e-31
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 3e-25
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 2e-16
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 1e-15
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 1e-08
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 5e-06
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 4e-05
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 4e-05
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 3e-04
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information 
 Score =  212 bits (542), Expect = 1e-67
 Identities = 95/238 (39%), Positives = 125/238 (52%), Gaps = 31/238 (13%)

Query: 153 PDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQY 212
           P++ DWR+K    P  DQ +CGSCWAFS  G                        LEG Y
Sbjct: 1   PESVDWREKGAVTPVKDQGSCGSCWAFSTVG-----------------------ALEGAY 37

Query: 213 AIKTGKLVEFSKSQLVECAKQCS-GCDGCFFEPSIEYTHQAGLESEKDYPYKNANGEKFK 271
           AIKTGKLV  S+ QLV+C+   + GC+G   + + EY    GL SE DYPY   +G    
Sbjct: 38  AIKTGKLVSLSEQQLVDCSTSGNNGCNGGNPDNAFEYVKNGGLASESDYPYTGKDG---T 94

Query: 272 CAYDKSKVKLF-TGKDFLHFNGSETMKKILYKYGPLSVLLN-SDLIHDYNGTPIRKNDET 329
           C Y+ SKV    TG   +     E +K  L  YGP+SV ++ S     Y G     +   
Sbjct: 95  CKYNSSKVGAKITGYSNVPPGDEEALKAALANYGPVSVAIDASSSFQFYKGGIY--SGPC 152

Query: 330 CSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYA 387
           CS  +L HAVLLVGYG ++ + YW+V+NSWG    ++G+ +I RG+N CGI   A Y 
Sbjct: 153 CSNTNLNHAVLLVGYGTENGVDYWIVKNSWGTSWGEKGYIRIARGSNLCGIASYASYP 210

Papain is an endopeptidase with specific substrate preferences, primarily for bulky hydrophobic or aromatic residues at the S2 subsite, a hydrophobic pocket in papain that accommodates the P2 sidechain of the substrate (the second residue away from the scissile bond). Most members of the papain subfamily are endopeptidases. Some exceptions to this rule can be explained by specific details of the catalytic domains like the occluding loop in cathepsin B which confers an additional carboxydipeptidyl activity and the mini-chain of cathepsin H resulting in an N-terminal exopeptidase activity. Papain-like CPs have different functions in various organisms. Plant CPs are used to mobilize storage proteins in seeds. Parasitic CPs act extracellularly to help invade tissues and cells, to hatch or to evade the host immune system. Mammalian CPs are primarily lysosomal enzymes with the exception of cathepsin W, which is retained in the endoplasmic reticulum. They are responsible for protein degradation in the lysosome. Papain-like CPs are synthesized as inactive proenzymes with N-terminal propeptide regions, which are removed upon activation. In addition to its inhibitory role, the propeptide is required for proper folding of the newly synthesized enzyme and its stabilization in denaturing pH conditions. Residues within the propeptide region also play a role in the transport of the proenzyme to lysosomes or acidified vesicles. Also included in this subfamily are proteins classified as non-peptidase homologs, which lack peptidase activity or have missing active site residues. Length = 210
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 392
KOG1542|consensus372 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
KOG1543|consensus325 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
PTZ00462 1004 Serine-repeat antigen protein; Provisional 100.0
KOG1544|consensus470 100.0
COG4870372 Cysteine protease [Posttranslational modification, 99.94
cd00585437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.9
PF03051438 Peptidase_C1_2: Peptidase C1-like family This fami 99.64
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.42
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 99.18
COG3579444 PepC Aminopeptidase C [Amino acid transport and me 98.69
KOG4128|consensus457 96.7
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 95.27
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 95.21
PF09778212 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP 89.22
PF14399 317 Transpep_BrtH: NlpC/p60-like transpeptidase 83.79
>KOG1542|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.3e-84  Score=613.32  Aligned_cols=290  Identities=40%  Similarity=0.755  Sum_probs=263.0

Q ss_pred             HHHHHHHHHHHhCCCcCChHHHHHHHHHHHHHHH--hhh-------hhccCCcCCCCChHHHhhhcCccccccc--hhhh
Q psy667           64 ILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH--KKH-------ERYGTSEFSDRSPEEILCKTGFKWSERT--YERI  132 (392)
Q Consensus        64 ~~~~F~~f~~ky~K~Y~~~~E~~~R~~iF~~Nl~--~~h-------~~lgiN~FsDlT~eEf~~~~~~~~~~~~--~~~~  132 (392)
                      ..+.|..|+.+|+|+|.+.+|+..|+.||++|++  +++       ..+|+|+|||||+|||  ++.|++.+..  ..+.
T Consensus        67 ~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEF--kk~~l~~~~~~~~~~~  144 (372)
T KOG1542|consen   67 LEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEF--KKIYLGVKRRGSKLPG  144 (372)
T ss_pred             hHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHH--HHHhhccccccccCcc
Confidence            4789999999999999999999999999999999  444       7789999999999999  8887765542  1111


Q ss_pred             hhhhhHHHHHhhhccCCCCCCCeeecccCCCCCCCCCCCCCchhhhHhhhhhhhhhHHhhhcccchhhhcccccchhHHH
Q psy667          133 VADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQY  212 (392)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pVkdQg~cgsCwAfa~~~~~~~~~~~~~~~~dr~c~~~~~~~le~~~  212 (392)
                      .....+       ..+..++|++||||++|+||||||||.||||||||++++                       +|+++
T Consensus       145 ~~~~~~-------~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~-----------------------vEga~  194 (372)
T KOG1542|consen  145 DAAEAP-------IEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGA-----------------------VEGAW  194 (372)
T ss_pred             ccccCc-------CCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhh-----------------------hhhHH
Confidence            111111       123458999999999999999999999999999999999                       99999


Q ss_pred             HHHhCCccccchhhhhhhccCCCCCCCCCchhhHHHH-HhCCCCCCCCCCCCCCCCCCc-ccccCCCCceeEecccceec
Q psy667          213 AIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYT-HQAGLESEKDYPYKNANGEKF-KCAYDKSKVKLFTGKDFLHF  290 (392)
Q Consensus       213 ~~~~~~~~~lS~q~l~dc~~~~~gC~GG~~~~a~~~~-~~~Gi~~e~~yPY~~~~~~~~-~C~~~~~~~~~~i~~~y~~~  290 (392)
                      +|++|++++||||+|+||+..++||+||.+..||+|+ +..|+..|++|||+   +..+ .|..++....+.|+ +|..+
T Consensus       195 ~i~~g~LvsLSEQeLvDCD~~d~gC~GGl~~nA~~~~~~~gGL~~E~dYPY~---g~~~~~C~~~~~~~~v~I~-~f~~l  270 (372)
T KOG1542|consen  195 AIATGKLVSLSEQELVDCDSCDNGCNGGLMDNAFKYIKKAGGLEKEKDYPYT---GKKGNQCHFDKSKIVVSIK-DFSML  270 (372)
T ss_pred             HhhcCcccccchhhhhcccCcCCcCCCCChhHHHHHHHHhCCccccccCCcc---ccCCCccccchhhceEEEe-ccEec
Confidence            9999999999999999999999999999999999996 88999999999999   8887 99999999999999 99999


Q ss_pred             C-CHHHHHHHHHcCCCeEEEEEcCCCcccCCceeeCCCCCCCCCCCCeEEEEEEEeecC-CccEEEEEcCCCCCCCCCcE
Q psy667          291 N-GSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQD-NIPYWLVRNSWGPIGPDEGF  368 (392)
Q Consensus       291 ~-~~~~ik~~l~~~gPV~v~i~~~~f~~y~~Giy~~~~~~c~~~~~~Hav~iVGyg~~~-g~~ywiikNSWG~~WG~~GY  368 (392)
                      + ++++|.+.|.++|||+|+|++..+|+|.+||+.+....|++..++|||+|||||... .++|||||||||++|||+||
T Consensus       271 ~~nE~~ia~wLv~~GPi~vgiNa~~mQ~YrgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY  350 (372)
T KOG1542|consen  271 SNNEDQIAAWLVTFGPLSVGINAKPMQFYRGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGY  350 (372)
T ss_pred             CCCHHHHHHHHHhcCCeEEEEchHHHHHhcccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccce
Confidence            9 999999999999999999999899999999999966689987899999999999987 89999999999999999999


Q ss_pred             EEEEecCCccccccceeEEEE
Q psy667          369 FKIERGNNACGIEQIAGYATI  389 (392)
Q Consensus       369 ~~i~r~~n~cgi~~~~~~~~~  389 (392)
                      +|+.||.|.|||++.++.+.+
T Consensus       351 ~~l~RG~N~CGi~~mvss~~v  371 (372)
T KOG1542|consen  351 YKLCRGSNACGIADMVSSAAV  371 (372)
T ss_pred             EEEeccccccccccchhhhhc
Confidence            999999999999999988765

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>KOG1543|consensus Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>KOG1544|consensus Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4128|consensus Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information
>PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate Back     alignment and domain information
>PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 1e-30
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 3e-30
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 4e-30
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 2e-29
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 2e-29
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 4e-29
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 4e-29
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 4e-29
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 4e-29
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 2e-28
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 3e-28
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 7e-28
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 3e-27
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 6e-27
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 2e-26
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 2e-26
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 5e-26
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 2e-24
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 2e-24
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 2e-24
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 2e-24
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 2e-24
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 2e-24
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 3e-24
3hwn_A258 Cathepsin L With Az13010160 Length = 258 4e-24
3of8_A221 Structural Basis For Reversible And Irreversible In 6e-24
3h89_A220 A Combined Crystallographic And Molecular Dynamics 7e-24
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 7e-24
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 9e-24
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 9e-24
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 1e-23
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 2e-23
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 2e-23
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 2e-23
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 4e-23
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 6e-23
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 6e-23
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 8e-23
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 2e-22
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 2e-22
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 2e-22
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 2e-22
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 3e-22
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 3e-22
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 7e-22
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 7e-22
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 3e-21
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 3e-21
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 3e-21
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 3e-21
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 4e-21
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 1e-20
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 1e-20
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-20
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 5e-20
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 6e-20
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 1e-19
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 2e-19
1pci_A322 Procaricain Length = 322 2e-19
2vhs_A217 Cathsilicatein, A Chimera Length = 217 9e-19
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 1e-18
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 2e-18
2act_A220 Crystallographic Refinement Of The Structure Of Act 1e-17
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 2e-17
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 6e-17
1ppo_A216 Determination Of The Structure Of Papaya Protease O 6e-17
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 8e-17
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 4e-16
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 4e-16
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 9e-16
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 2e-15
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 3e-15
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 3e-15
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 3e-15
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 4e-15
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 6e-15
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 9e-15
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 1e-14
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 2e-14
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 8e-14
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 1e-13
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 1e-13
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 2e-13
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 2e-13
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 2e-13
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 3e-13
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 1e-12
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 2e-12
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 2e-12
1mir_A322 Rat Procathepsin B Length = 322 3e-12
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 3e-12
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 3e-12
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 3e-12
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 2e-11
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 3e-11
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 3e-11
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 2e-10
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 2e-10
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 4e-10
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 5e-10
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 6e-10
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 5e-09
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 1e-08
1k3b_B164 Crystal Structure Of Human Dipeptidyl Peptidase I ( 2e-06
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 1e-05
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 1e-05
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 118/242 (48%), Gaps = 31/242 (12%)
Query: 152 VPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQ 211
            P  WDWR K       DQ  CGSCWAFS+ G                        +EGQ
Sbjct: 1   APPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGN-----------------------VEGQ 37
Query: 212 YAIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYT---HQAGLESEKDYPYKNANGE 268
           + +  G L+  S+ +L++C K    C G    PS  Y+   +  GLE+E DY Y+   G 
Sbjct: 38  WFLNQGTLLSLSEQELLDCDKMDKACMGGL--PSNAYSAIKNLGGLETEDDYSYQ---GH 92
Query: 269 KFKCAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDE 328
              C +   K K++           + +   L K GP+SV +N+  +  Y     R    
Sbjct: 93  MQSCQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRP 152
Query: 329 TCSPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYAT 388
            CSP+ + HAVLLVGYG++ ++P+W ++NSWG    ++G++ + RG+ ACG+  +A  A 
Sbjct: 153 LCSPWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAV 212
Query: 389 ID 390
           +D
Sbjct: 213 VD 214
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-69
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 1e-69
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 6e-69
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 2e-68
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 4e-67
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 7e-67
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 4e-65
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 2e-63
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 5e-63
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 9e-63
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 8e-62
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 2e-60
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 2e-58
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 2e-58
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 3e-57
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 6e-57
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 7e-56
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 3e-54
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 5e-54
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 5e-54
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 6e-54
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 1e-53
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 2e-53
1cqd_A221 Protein (protease II); cysteine protease, glycopro 5e-53
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 6e-53
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 6e-53
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 8e-53
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 3e-52
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 2e-51
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 1e-50
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 2e-50
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 4e-50
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 4e-49
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 4e-49
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 6e-49
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 7e-49
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 2e-48
3u8e_A222 Papain-like cysteine protease; papain-like cystein 2e-47
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 4e-44
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 9e-06
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 3e-04
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
 Score =  221 bits (565), Expect = 1e-69
 Identities = 95/360 (26%), Positives = 152/360 (42%), Gaps = 64/360 (17%)

Query: 56  SLTFDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQ-----DGH-KKHERYGTS--- 106
                +  + E ++ F     R Y N +E   R + F++     + H +K+ +   S   
Sbjct: 10  GSALPSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTL 69

Query: 107 ---EFSDRSPEEILCK-TGFKWSERTYERIVADREKVEKMLMEVEKDGPVPDAWDWRKKN 162
               F+D +PEE+     G       ++  +  + + +   + +      P ++DWR + 
Sbjct: 70  GVNLFTDMTPEEMKAYTHGLIMPADLHKNGIPIKTRED---LGLNASVRYPASFDWRDQG 126

Query: 163 VTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQYAIKTGKLVEF 222
           +  P  +Q +CGS WAFS  G                        +E Q  I  G   + 
Sbjct: 127 MVSPVKNQGSCGSSWAFSSTGA-----------------------IESQMKIANGAGYDS 163

Query: 223 SKS--QLVECAKQCSGCDGCFFEPSIEYTHQA-GLESEKDYPYKNANGEKFKCAYDKSKV 279
           S S  QLV+C     GC G +   +  Y  Q  G++SE  YPY+ A+G    C YD ++V
Sbjct: 164 SVSEQQLVDCVPNALGCSGGWMNDAFTYVAQNGGIDSEGAYPYEMADG---NCHYDPNQV 220

Query: 280 KLF-TGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHD--------YNGTPIRKNDETC 330
               +G  +L       +  ++   GP++V  ++D            Y          TC
Sbjct: 221 AARLSGYVYLSGPDENMLADMVATKGPVAVAFDAD--DPFGSYSGGVYYN-------PTC 271

Query: 331 SPYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERG-NNACGIEQIAGYATI 389
                 HAVL+VGYG ++   YWLV+NSWG     +G+FKI R  NN CGI  +A   T+
Sbjct: 272 ETNKFTHAVLIVGYGNENGQDYWLVKNSWGDGWGLDGYFKIARNANNHCGIAGVASVPTL 331
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
2cb5_A453 Protein (bleomycin hydrolase); aminopeptidase, cys 100.0
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 100.0
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.54
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.37
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 97.22
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 96.94
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 96.34
3erv_A236 Putative C39-like peptidase; structural genomics, 85.68
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
Probab=100.00  E-value=6.6e-81  Score=612.75  Aligned_cols=299  Identities=30%  Similarity=0.571  Sum_probs=259.7

Q ss_pred             CChhHHHHHHHHHHHHhCCCcCChHHHHHHHHHHHHHHH--hhh----------hhccCCcCCCCChHHHhhhcCccccc
Q psy667           59 FDNENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH--KKH----------ERYGTSEFSDRSPEEILCKTGFKWSE  126 (392)
Q Consensus        59 ~~~~~~~~~F~~f~~ky~K~Y~~~~E~~~R~~iF~~Nl~--~~h----------~~lgiN~FsDlT~eEf~~~~~~~~~~  126 (392)
                      ..+..++.+|++|+++|+|.|.+.+|+.+|+.||++|++  ++|          |++|+|+|||||.|||  ++.+++..
T Consensus        13 ~~~~~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf--~~~~~~~~   90 (331)
T 3qj3_A           13 LPSTFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEM--KAYTHGLI   90 (331)
T ss_dssp             CCHHHHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHH--HHHHSCCC
T ss_pred             CCCHHHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHH--HHHhcccc
Confidence            566778899999999999999998899999999999999  554          7789999999999999  77666543


Q ss_pred             cchhhhh-hhhhHHHHHhhhccCCCCCCCeeecccCCCCCCCCCCCCCchhhhHhhhhhhhhhHHhhhcccchhhhcccc
Q psy667          127 RTYERIV-ADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFP  205 (392)
Q Consensus       127 ~~~~~~~-~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pVkdQg~cgsCwAfa~~~~~~~~~~~~~~~~dr~c~~~~~  205 (392)
                      .+..... ....... .........+||++||||++|+||||||||.||||||||++++                     
T Consensus        91 ~~~~~~~~~~~~~~~-~~~~~~~~~~lP~s~DwR~~g~vtpVkdQg~CGSCWAFaa~~a---------------------  148 (331)
T 3qj3_A           91 MPADLHKNGIPIKTR-EDLGLNASVRYPASFDWRDQGMVSPVKNQGSCGSSWAFSSTGA---------------------  148 (331)
T ss_dssp             CCSSTTTTCEEECSG-GGGTCCSSCCCCSSEEGGGGTCSCCCCBCCSSCCHHHHHHHHH---------------------
T ss_pred             ccccccccCcccccc-cccccccccCCCcceecccCCccCCCccCcccchhhHHHHHHH---------------------
Confidence            3211100 0000000 0000012247999999999999999999999999999999999                     


Q ss_pred             cchhHHHHHHhCC--ccccchhhhhhhccCCCCCCCCCchhhHHHHHh-CCCCCCCCCCCCCCCCCCcccccCCCCceeE
Q psy667          206 GMLEGQYAIKTGK--LVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQ-AGLESEKDYPYKNANGEKFKCAYDKSKVKLF  282 (392)
Q Consensus       206 ~~le~~~~~~~~~--~~~lS~q~l~dc~~~~~gC~GG~~~~a~~~~~~-~Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~  282 (392)
                        +|+++++++++  ++.||+|+|+||+..+.||+||++..|++|+.+ .||++|++|||.   +.++.|........++
T Consensus       149 --lE~~~~i~~g~~~~~~LSeQ~LvdC~~~~~GC~GG~~~~a~~yi~~~~Gi~~e~~yPY~---~~~~~C~~~~~~~~~~  223 (331)
T 3qj3_A          149 --IESQMKIANGAGYDSSVSEQQLVDCVPNALGCSGGWMNDAFTYVAQNGGIDSEGAYPYE---MADGNCHYDPNQVAAR  223 (331)
T ss_dssp             --HHHHHHHHHCTTSCCCBCHHHHHHHCTTSCGGGCCCHHHHHHHHHHHTCEEBTTTSCCC---SSCCCCCCCTTSEEEC
T ss_pred             --HHHHHHHHhCCCcccCcCHHHHhhhccCCCCCCCCCHHHHHHHHHHcCCcCcccccCcc---CCCCCCCCCcccceeE
Confidence              99999999998  999999999999977999999999999999954 599999999999   8888999887777889


Q ss_pred             ecccceecC--CHHHHHHHHHcCCCeEEEEEcC-CCcccCCceeeCCCCCCCCCCCCeEEEEEEEeecCCccEEEEEcCC
Q psy667          283 TGKDFLHFN--GSETMKKILYKYGPLSVLLNSD-LIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQDNIPYWLVRNSW  359 (392)
Q Consensus       283 i~~~y~~~~--~~~~ik~~l~~~gPV~v~i~~~-~f~~y~~Giy~~~~~~c~~~~~~Hav~iVGyg~~~g~~ywiikNSW  359 (392)
                      |. +|..++  ++++||++|+++|||+|+|+++ +|++|++|||..+  .|+...++|||+|||||+++|++||||||||
T Consensus       224 i~-~~~~v~~~~e~~lk~al~~~GPV~v~i~a~~~f~~Y~~Gvy~~~--~c~~~~~~HaV~iVGyg~~~g~~yWivkNSW  300 (331)
T 3qj3_A          224 LS-GYVYLSGPDENMLADMVATKGPVAVAFDADDPFGSYSGGVYYNP--TCETNKFTHAVLIVGYGNENGQDYWLVKNSW  300 (331)
T ss_dssp             CS-EEEEESSCCHHHHHHHHHHHCCEEEEECCCTTGGGEEEEEECCT--TCCSSCCCEEEEEEEEEEETTEEEEEEECSB
T ss_pred             ee-EEEEeCCCCHHHHHHHHHhCCCEEEEEEcccccccccCceEeCC--CCCCCcCCEEEEEEEEeccCCceEEEEEcCC
Confidence            98 999887  8999999999999999999995 5999999999987  7976689999999999999999999999999


Q ss_pred             CCCCCCCcEEEEEecC-CccccccceeEEEE
Q psy667          360 GPIGPDEGFFKIERGN-NACGIEQIAGYATI  389 (392)
Q Consensus       360 G~~WG~~GY~~i~r~~-n~cgi~~~~~~~~~  389 (392)
                      |++||++|||||+|+. |.|||++.++||++
T Consensus       301 G~~WGe~GY~~i~r~~~n~CgI~~~~~~p~v  331 (331)
T 3qj3_A          301 GDGWGLDGYFKIARNANNHCGIAGVASVPTL  331 (331)
T ss_dssp             CTTSTBTTEEEEECSSSSGGGTTTSCEEEEC
T ss_pred             CCCcCCCCEEEEEcCCCCccCcCCceeeeeC
Confidence            9999999999999998 99999999999985
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure
>3erv_A Putative C39-like peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.10A {Bacillus anthracis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 392
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 5e-48
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 2e-46
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 2e-42
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 6e-42
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 2e-41
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 4e-41
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 1e-40
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-40
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 1e-38
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 2e-38
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 7e-38
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 1e-37
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 2e-37
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 3e-37
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 8e-37
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 2e-36
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-35
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 6e-35
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 8e-35
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 2e-32
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 2e-05
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 2e-04
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: Cathepsin F
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  160 bits (405), Expect = 5e-48
 Identities = 74/239 (30%), Positives = 113/239 (47%), Gaps = 27/239 (11%)

Query: 153 PDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLEGQY 212
           P  WDWR K       DQ  CGSCWAFS+ G                        +EGQ+
Sbjct: 2   PPEWDWRSKGAVTKVKDQGMCGSCWAFSVTG-----------------------NVEGQW 38

Query: 213 AIKTGKLVEFSKSQLVECAKQCSGCDGCFFEPSIEYTHQAG-LESEKDYPYKNANGEKFK 271
            +  G L+  S+ +L++C K    C G     +       G LE+E DY Y+        
Sbjct: 39  FLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQ---S 95

Query: 272 CAYDKSKVKLFTGKDFLHFNGSETMKKILYKYGPLSVLLNSDLIHDYNGTPIRKNDETCS 331
           C +   K K++           + +   L K GP+SV +N+  +  Y     R     CS
Sbjct: 96  CQFSAEKAKVYIQDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCS 155

Query: 332 PYDLGHAVLLVGYGKQDNIPYWLVRNSWGPIGPDEGFFKIERGNNACGIEQIAGYATID 390
           P+ + HAVLLVGYG++ ++P+W ++NSWG    ++G++ + RG+ ACG+  +A  A +D
Sbjct: 156 PWLIDHAVLLVGYGQRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD 214
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d3gcba_458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.71
d2cb5a_453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.63
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 95.5
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 95.23
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-74  Score=564.08  Aligned_cols=288  Identities=30%  Similarity=0.564  Sum_probs=245.9

Q ss_pred             hHHHHHHHHHHHHhCCCcCChHHHHHHHHHHHHHHH--hhh----------hhccCCcCCCCChHHHhhhcCccccccch
Q psy667           62 ENILETFKAFIVKRGRQYANDEEIKERFEYFKQDGH--KKH----------ERYGTSEFSDRSPEEILCKTGFKWSERTY  129 (392)
Q Consensus        62 ~~~~~~F~~f~~ky~K~Y~~~~E~~~R~~iF~~Nl~--~~h----------~~lgiN~FsDlT~eEf~~~~~~~~~~~~~  129 (392)
                      +.++.+|++||++|+|.|.+ +|+.+|++||++|++  ++|          |+||+|+|||||.|||  .+.++......
T Consensus         6 ~~l~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf--~~~~~~~~~~~   82 (316)
T d1cs8a_           6 HSLEAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEF--RQVMNGFQNRK   82 (316)
T ss_dssp             GGGHHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHH--HHHHCCBCCCC
T ss_pred             HHHHHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHH--Hhhhccccccc
Confidence            44567899999999999987 467899999999999  555          7899999999999999  66665543321


Q ss_pred             hhhhhhhhHHHHHhhhccCCCCCCCeeecccCCCCCCCCCCCCCchhhhHhhhhhhhhhHHhhhcccchhhhcccccchh
Q psy667          130 ERIVADREKVEKMLMEVEKDGPVPDAWDWRKKNVTGPAGDQAACGSCWAFSIAGKFSNYLLQYLNHIDQFCLLIFPGMLE  209 (392)
Q Consensus       130 ~~~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pVkdQg~cgsCwAfa~~~~~~~~~~~~~~~~dr~c~~~~~~~le  209 (392)
                      .... ...       ..+...+||++||||++|+|+||||||.||||||||++++                       +|
T Consensus        83 ~~~~-~~~-------~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~-----------------------~E  131 (316)
T d1cs8a_          83 PRKG-KVF-------QEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGA-----------------------LE  131 (316)
T ss_dssp             CSCC-EEC-------CCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHH-----------------------HH
T ss_pred             cccC-ccc-------cCcccccCCCceECCcCCcccccccCCCCceeeehhhhHH-----------------------HH
Confidence            1110 000       0122358999999999999999999999999999999999                       99


Q ss_pred             HHHHHHhCCccccchhhhhhhc--cCCCCCCCCCchhhHHHHH-hCCCCCCCCCCCCCCCCCCcccccCCCCceeEeccc
Q psy667          210 GQYAIKTGKLVEFSKSQLVECA--KQCSGCDGCFFEPSIEYTH-QAGLESEKDYPYKNANGEKFKCAYDKSKVKLFTGKD  286 (392)
Q Consensus       210 ~~~~~~~~~~~~lS~q~l~dc~--~~~~gC~GG~~~~a~~~~~-~~Gi~~e~~yPY~~~~~~~~~C~~~~~~~~~~i~~~  286 (392)
                      ++++++++..+.||+|+|+||+  ..+.||.||++..|++|+. +.++.+|..|||.   +....|..........+. .
T Consensus       132 ~~~~i~~~~~~~lS~Q~lvdC~~~~~~~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~---~~~~~~~~~~~~~~~~~~-~  207 (316)
T d1cs8a_         132 GQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQDNGGLDSEESYPYE---ATEESCKYNPKYSVANDA-G  207 (316)
T ss_dssp             HHHHHHHSCCCCBCHHHHHHHCGGGTCCGGGCBCHHHHHHHHHHHTCEEBTTTSCCC---SSCCCCCCCGGGEEECCC-C
T ss_pred             HHHHhhcCCcccchhhhhhhccccccCCCCCCCchHHHHHHHHhcCccccccccccc---cccccccccccccccccc-c
Confidence            9999999999999999999998  4578999999999999995 4457889999999   778888766666666666 6


Q ss_pred             ceecC-CHHHHHHHHHcCCCeEEEEEcC--CCcccCCceeeCCCCCCCCCCCCeEEEEEEEeec----CCccEEEEEcCC
Q psy667          287 FLHFN-GSETMKKILYKYGPLSVLLNSD--LIHDYNGTPIRKNDETCSPYDLGHAVLLVGYGKQ----DNIPYWLVRNSW  359 (392)
Q Consensus       287 y~~~~-~~~~ik~~l~~~gPV~v~i~~~--~f~~y~~Giy~~~~~~c~~~~~~Hav~iVGyg~~----~g~~ywiikNSW  359 (392)
                      |.... +++.|+++|+.+|||+|+++++  +|++|++|||..+  .|+...++|||+|||||.+    ++.+||||||||
T Consensus       208 ~~~~~~~~~~l~~~l~~~gpv~v~i~~~~~~f~~y~~Gi~~~~--~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSW  285 (316)
T d1cs8a_         208 FVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEP--DCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSW  285 (316)
T ss_dssp             EEECCSCHHHHHHHHHHHCCEEEEECCCSHHHHTEEEEEECCT--TCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSB
T ss_pred             cccccCcHHHHHHHHHHhCCeEEEEEeccchhccccCCcccCC--CCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCC
Confidence            66666 8999999999999999999985  6999999999987  7887788999999999964    678999999999


Q ss_pred             CCCCCCCcEEEEEecC-CccccccceeEEEE
Q psy667          360 GPIGPDEGFFKIERGN-NACGIEQIAGYATI  389 (392)
Q Consensus       360 G~~WG~~GY~~i~r~~-n~cgi~~~~~~~~~  389 (392)
                      |++|||+|||||+|+. |.|||++.++||+|
T Consensus       286 G~~WGe~GY~ri~r~~~n~CGI~~~~~yP~v  316 (316)
T d1cs8a_         286 GEEWGMGGYVKMAKDRRNHCGIASAASYPTV  316 (316)
T ss_dssp             CTTSTBTTEEEEECSSSSGGGTTTSCEEECC
T ss_pred             CCCcccCCEEEEeeCCCCcCccCCeeeeeeC
Confidence            9999999999999986 99999999999985
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure