Psyllid ID: psy669

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLETGSGESEATLETGSGESEATLEVLFENSTWENFHETNITGDFLFRAVQ
cEEEccccccccccEEEEEEEEEEccccccEEEEEEEEEEEEccccccccccccEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccEEEEccccEEEEcccccccccccEEEEEEEEEEccccccccEEEEEEEEEEEcccccccccccEEEEEEccccccccccEEEEEEEEEccccccccEEEEEEEEccccccEEEEcccEEEEEccccccccccEEEEEEEEEEccccccccc
cEEEcccccHHccccEEEEEEEEcccccccccEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEEccccccccEEEEEEcccccccEEEEEccccEEEEEcccccHHHcccEEEEEEEEccccccccccEEEEEEEEEEcccccccEccccEEEEEcccccccccEEEEEEEEEEccccccccEEEEEEEcccccccEEEEccccEEEEEccccHHHcccEEEEEEEEcccccccccc
nirtstildvetKTHYWLTVFAqdhgvvplhartDVYIQVqnvndnvpmtldPVYYAQIVEnqsgilpivqlaasdgdldpdqrisykisagnpesyfnidigsglisttgrkldrenqAEHVLEvtvtddgapaplssttrVIISvedvndnapefeqnfyhvnipetrhrdeplsqvsLISTtgrkldrenQAEHvletgsgeseatletgsgeseaTLEVLFenstwenfhetnitGDFLFRAVQ
nirtstildvetKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKIsagnpesyfniDIGSGLISTTGRKLDRENQAEHVLevtvtddgapaplsSTTRVIISVEDVNDNAPEFEQNFYHVNIpetrhrdeplsqVSLISTtgrkldrenqaehvletgsgeseatletgsgesEATLEVLFENstwenfhetniTGDFLFRAVQ
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLETGSGESEATLETGSGESEATLEVLFENSTWENFHETNITGDFLFRAVQ
*****TILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDL****RISYKISAGNPESYFNIDIGSGLISTTG***********VLEVTV***********TTRVIISVEDVNDNAPEFEQNFYHVNI******************************************************LEVLFENSTWENFHETNITGDFLFR***
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLETGSGESEATLETGSGESEATLEVLFENSTWENFHETNITGDF*F****
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLET***************SEATLEVLFENSTWENFHETNITGDFLFRAVQ
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLETGSGESEATLETGSGESEATLEVLFENSTWENFHETNITGD*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGRKLDRENQAEHVLETGSGESEATLETGSGESEATLEVLFENSTWENFHETNITGDFLFRAVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query248 2.2.26 [Sep-21-2011]
Q9VW71 4705 Fat-like cadherin-related yes N/A 0.822 0.043 0.451 7e-47
Q14517 4588 Protocadherin Fat 1 OS=Ho yes N/A 0.713 0.038 0.502 8e-47
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.701 0.037 0.485 1e-45
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.701 0.038 0.480 9e-45
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.677 0.036 0.485 8e-44
Q5F226 4351 Protocadherin Fat 2 OS=Mu no N/A 0.689 0.039 0.431 1e-32
Q9NYQ8 4349 Protocadherin Fat 2 OS=Ho no N/A 0.741 0.042 0.412 1e-31
O88277 4351 Protocadherin Fat 2 OS=Ra no N/A 0.689 0.039 0.420 2e-31
Q91ZI0 3301 Cadherin EGF LAG seven-pa no N/A 0.887 0.066 0.344 3e-24
O88278 3313 Cadherin EGF LAG seven-pa no N/A 0.887 0.066 0.344 3e-24
>sp|Q9VW71|FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster GN=kug PE=2 SV=2 Back     alignment and function desciption
 Score =  187 bits (475), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 137/208 (65%), Gaps = 4/208 (1%)

Query: 8    LDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGIL 67
            LD ETK  YWLT+ AQD  +VPL    +VYIQV+N NDN+P+T  PVYY  + E     +
Sbjct: 1148 LDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENV 1207

Query: 68   PIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVT 127
             I+ L A D D+DP Q I+Y I +GN   YF ID  +G+I TT RKLDRENQAEH+LEV 
Sbjct: 1208 EIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVA 1267

Query: 128  VTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTGR 187
            ++D+G+P  LSST+R+++SV D+NDN+PEF+Q  Y V +P +   ++ + QV  I +   
Sbjct: 1268 ISDNGSPV-LSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSG 1326

Query: 188  KLDRENQAEHVLETGSGESEATLETGSG 215
            +  R     + +++G G+++  +++  G
Sbjct: 1327 ENGR---ITYSIKSGKGKNKFRIDSQRG 1351
Required for the planar polarity of actin filament orientation at the basal side of ovarian follicle cells. Required for proper egg chamber shape; elongation of the egg chamber during oogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus GN=Fat2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NYQ8|FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens GN=FAT2 PE=1 SV=2 Back     alignment and function description
>sp|O88277|FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus GN=Fat2 PE=1 SV=1 Back     alignment and function description
>sp|Q91ZI0|CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus GN=Celsr3 PE=2 SV=2 Back     alignment and function description
>sp|O88278|CELR3_RAT Cadherin EGF LAG seven-pass G-type receptor 3 OS=Rattus norvegicus GN=Celsr3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
242006694 4716 protocadherin fat 2 precursor, putative 0.669 0.035 0.621 3e-55
328703041 4147 PREDICTED: fat-like cadherin-related tum 0.870 0.052 0.489 3e-55
328703039 4140 PREDICTED: fat-like cadherin-related tum 0.870 0.052 0.489 3e-55
380020280 4753 PREDICTED: LOW QUALITY PROTEIN: fat-like 0.713 0.037 0.581 6e-53
328790298 3599 PREDICTED: fat-like cadherin-related tum 0.713 0.049 0.575 2e-52
350417212 4739 PREDICTED: fat-like cadherin-related tum 0.713 0.037 0.575 2e-52
340715254 3597 PREDICTED: fat-like cadherin-related tum 0.713 0.049 0.575 3e-52
158284498234 AGAP011528-PA [Anopheles gambiae str. PE 0.709 0.752 0.598 4e-52
383855810 4739 PREDICTED: fat-like cadherin-related tum 0.713 0.037 0.575 2e-51
189234730 4676 PREDICTED: similar to fat2 CG7749-PA [Tr 0.713 0.037 0.544 3e-51
>gi|242006694|ref|XP_002424182.1| protocadherin fat 2 precursor, putative [Pediculus humanus corporis] gi|212507523|gb|EEB11444.1| protocadherin fat 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 138/169 (81%), Gaps = 3/169 (1%)

Query: 2    IRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVE 61
            I+T  + DVETK+HYWLTV+A+DHGV+PL +R +VY+ ++NVNDN P+T +P+YYA + E
Sbjct: 1189 IKTLAVFDVETKSHYWLTVYAEDHGVIPLSSRLEVYVAIENVNDNSPLTDEPIYYASVPE 1248

Query: 62   N-QSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQA 120
            N +SG L IV+L+A+D DLDP+ +I YKI+AGNP+SYF ID  SG+I TT RKLDRENQ+
Sbjct: 1249 NSESGKL-IVELSATDADLDPNNKIFYKITAGNPQSYFTIDSISGIIKTTERKLDRENQS 1307

Query: 121  EHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPET 169
            EH LE+T+TD+G P  LSSTT+VIISV DVND+APEF Q +Y + +P T
Sbjct: 1308 EHSLEITITDNGTPQ-LSSTTKVIISVSDVNDHAPEFNQPYYKITVPAT 1355

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328703041|ref|XP_003242077.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328703039|ref|XP_003242076.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 1 [Acyrthosiphon pisum] gi|328703043|ref|XP_003242078.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380020280|ref|XP_003694018.1| PREDICTED: LOW QUALITY PROTEIN: fat-like cadherin-related tumor suppressor homolog [Apis florea] Back     alignment and taxonomy information
>gi|328790298|ref|XP_394631.4| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|350417212|ref|XP_003491311.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715254|ref|XP_003396132.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|158284498|ref|XP_307204.4| AGAP011528-PA [Anopheles gambiae str. PEST] gi|157020991|gb|EAA03230.4| AGAP011528-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383855810|ref|XP_003703403.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|189234730|ref|XP_973752.2| PREDICTED: similar to fat2 CG7749-PA [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query248
UNIPROTKB|E1BKL9 4587 FAT1 "Uncharacterized protein" 0.858 0.046 0.449 2.7e-44
UNIPROTKB|F1SER9 4587 FAT1 "Uncharacterized protein" 0.858 0.046 0.444 4.5e-44
UNIPROTKB|F1LP84 4586 Fat1 "Protein Fat1" [Rattus no 0.862 0.046 0.447 1.5e-43
UNIPROTKB|F1LR23 4589 Fat1 "Protein Fat1" [Rattus no 0.862 0.046 0.447 1.5e-43
UNIPROTKB|E2R353 4591 FAT1 "Uncharacterized protein" 0.842 0.045 0.454 2.5e-43
FB|FBgn0261574 4705 kug "kugelei" [Drosophila mela 0.850 0.044 0.441 2.5e-43
UNIPROTKB|F6XXM1 5056 FAT1 "Uncharacterized protein" 0.842 0.041 0.454 2.8e-43
UNIPROTKB|Q14517 4588 FAT1 "Protocadherin Fat 1" [Ho 0.858 0.046 0.444 4e-43
UNIPROTKB|F1NWW5 4592 FAT1 "Uncharacterized protein" 0.858 0.046 0.435 5.2e-43
ZFIN|ZDB-GENE-050425-1 4611 fat1 "FAT tumor suppressor hom 0.858 0.046 0.431 5.2e-43
UNIPROTKB|E1BKL9 FAT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 486 (176.1 bits), Expect = 2.7e-44, P = 2.7e-44
 Identities = 98/218 (44%), Positives = 140/218 (64%)

Query:     2 IRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVE 61
             I TS  LD E+ +HYWLTV+A D GVVPL +  +VYI+V++VNDN P T +PVYY +I+E
Sbjct:  1091 IETSDRLDRESTSHYWLTVYASDQGVVPLSSFVEVYIEVEDVNDNAPQTSEPVYYPEIME 1150

Query:    62 NQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAE 121
             N    + +VQ+ A D D   D +++YKI++GNP+ +F+I+  +GLI+TT RKLDRE Q E
Sbjct:  1151 NSPKDVSVVQIEAFDPDSSSDDKLTYKITSGNPQGFFSINSKTGLITTTARKLDREQQDE 1210

Query:   122 HVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPETR--HRDEPLSQV 179
             H+LEVTVTD+G+P P  + TRVI+ + D NDN P+F Q FY + +PE     R+    + 
Sbjct:  1211 HILEVTVTDNGSP-PKLTITRVIVKILDENDNKPQFLQKFYKIRLPEREKPERERNAKRE 1269

Query:   180 SLISTTGRKLDRENQAE--HVLETGSGESEATLETGSG 215
              L        D    AE  + +E G+   +  +E  +G
Sbjct:  1270 PLYRVIATDKDEGPNAEISYSIEEGNEHGKFFIEPKTG 1307
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0030175 "filopodium" evidence=IEA
GO:0030027 "lamellipodium" evidence=IEA
GO:0007163 "establishment or maintenance of cell polarity" evidence=IEA
GO:0007015 "actin filament organization" evidence=IEA
GO:0005911 "cell-cell junction" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|F1SER9 FAT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP84 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR23 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0261574 kug "kugelei" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F6XXM1 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14517 FAT1 "Protocadherin Fat 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWW5 FAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050425-1 fat1 "FAT tumor suppressor homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q14517FAT1_HUMANNo assigned EC number0.50270.71370.0385yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-26
smart0011281 smart00112, CA, Cadherin repeats 2e-22
pfam0002892 pfam00028, Cadherin, Cadherin domain 3e-18
smart0011281 smart00112, CA, Cadherin repeats 7e-09
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 8e-09
cd0003198 cd00031, CA_like, Cadherin repeat-like domain 0.002
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 97.8 bits (244), Expect = 3e-26
 Identities = 41/100 (41%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 54  VYYAQIVENQSGILPIVQLAASDGDLDPDQRISYKISAGNPESYFNIDIGSGLISTTGRK 113
            Y   + EN      ++ ++A+D D   +  ++Y I +GN +  F+ID  +G I+T  + 
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTA-KP 59

Query: 114 LDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDN 153
           LDRE Q+ + L VT TD G P PLSST  V I+V DVNDN
Sbjct: 60  LDREEQSSYTLTVTATDGGGP-PLSSTATVTITVLDVNDN 98

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|206635 cd00031, CA_like, Cadherin repeat-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 248
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 100.0
KOG1219|consensus 4289 100.0
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.96
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.95
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.82
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.74
KOG1834|consensus 952 99.74
KOG1834|consensus 952 99.58
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.16
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 98.62
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.86
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.35
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.41
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 94.03
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 92.9
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 92.48
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 83.46
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 82.23
>KOG4289|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.3e-45  Score=334.92  Aligned_cols=229  Identities=34%  Similarity=0.422  Sum_probs=215.9

Q ss_pred             cEEccCCCCccCcEEEEEEEEEECCCCCCeeeEEEEEEEEecCCCCCccCCCceEEEEECCCCCCeeEEEEEEEeCCCCC
Q psy669            2 IRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDP   81 (248)
Q Consensus         2 i~~~~~LD~E~~~~y~l~v~a~D~~~~~~~~~~~v~i~V~DvNDn~P~f~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~~   81 (248)
                      |++++.||||..+.+.|+|.|.|.+.|+++++++|+|.|.|+|||.|+|.+..|..++.||.+.|+.|++++|+|.|.++
T Consensus       221 irta~~lDREt~e~HvlrVtA~d~~~P~~SAtttv~V~V~D~nDhsPvFEq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~  300 (2531)
T KOG4289|consen  221 IRTAKSLDRETKETHVLRVTAQDHGDPRRSATTTVTVLVLDTNDHSPVFEQDEYREELRENLEVGYEVLTVRATDGDSPP  300 (2531)
T ss_pred             chhhhhhhhhhhheeEEEEEeeecCCCcccceeEEEEEEeecCCCCcccchhHHHHHHhhccccCceEEEEEeccCCCCC
Confidence            67899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEEEEecCCCCCcEEEeCCCeEEEEecCCCCccccceeEEEEEEEeCCCCCCCceEEEEEEEEEecCCCCCeeccCe
Q psy669           82 DQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVEDVNDNAPEFEQNF  161 (248)
Q Consensus        82 ~~~i~y~i~~~~~~~~F~id~~tg~i~~~~~~ld~e~~~~~~l~v~a~d~~~p~~~~~~~~v~I~V~d~Nd~~P~f~~~~  161 (248)
                      |+.++|++..|+....|.|++.+|.| .+..+||||+...|.|.|.|.|.|.| +...++.|.|+|.|+|||+|+|....
T Consensus       301 Nani~Yrl~eg~~~~~f~in~rSGvI-~T~a~lDRE~~~~y~L~VeAsDqG~~-pgp~Ta~V~itV~D~NDNaPqFse~~  378 (2531)
T KOG4289|consen  301 NANIRYRLLEGNAKNVFEINPRSGVI-STRAPLDREELESYQLDVEASDQGRP-PGPRTAMVEITVEDENDNAPQFSEKR  378 (2531)
T ss_pred             CCceEEEecCCCccceeEEcCcccee-eccCccCHHhhhheEEEEEeccCCCC-CCCceEEEEEEEEecCCCCccccccc
Confidence            99999999999888999999999999 89999999999999999999999988 66679999999999999999999999


Q ss_pred             eEEEecCCCCCCeeEEEEEEEeCCC-------------------------------CCCCccCceEEEEEEccCCCCcee
Q psy669          162 YHVNIPETRHRDEPLSQVSLISTTG-------------------------------RKLDRENQAEHVLETGSGESEATL  210 (248)
Q Consensus       162 y~~~v~E~~~~g~~v~~v~A~D~D~-------------------------------~~ld~e~~~~y~~~v~~~~~~~~~  210 (248)
                      |.++|.|+..++++|++|+|+|.|-                               .+||+|.. +|++.+++.|+..  
T Consensus       379 Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~G~f~id~~tGel~vv~plD~e~~-~ytl~IrAqDggr--  455 (2531)
T KOG4289|consen  379 YVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASGNGRGQFYIDSLTGELDVVEPLDFENS-EYTLRIRAQDGGR--  455 (2531)
T ss_pred             eEEEecccCCCCceEEEEEecccCCCcCceEEEEeeccCccccEEEecccceEEEeccccccCC-eeEEEEEcccCCC--
Confidence            9999999999999999999999993                               68999999 9999999888755  


Q ss_pred             ecCCceEEEEEEEEeeeCCcccccC
Q psy669          211 ETGSGESEATLEVLFENSTWENFHE  235 (248)
Q Consensus       211 ~~~~~t~~~~i~v~d~nd~~P~f~~  235 (248)
                      +..+.+.-++|.|+|+|||.|.|..
T Consensus       456 PpLsn~sgl~iqVlDINDhaPifvs  480 (2531)
T KOG4289|consen  456 PPLSNTSGLVIQVLDINDHAPIFVS  480 (2531)
T ss_pred             CCccCCCceEEEEEecCCCCceeEe
Confidence            4455566677999999999999943

>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 1e-15
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 1e-12
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 1e-10
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 5e-11
1l3w_A 546 C-Cadherin Ectodomain Length = 546 7e-11
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 2e-10
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 7e-10
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 6e-09
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 1e-05
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 7e-09
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 8e-09
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 4e-07
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 3e-08
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 4e-07
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 3e-08
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 1e-06
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 4e-08
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 2e-06
2yst_A119 Solution Structure Of The Third Cadherin Domain Fro 1e-07
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 1e-07
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 3e-07
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 1e-05
3ubh_A 419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 2e-06
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 2e-05
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 5e-05
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 8e-05
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 8e-05
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 8e-05
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 9e-05
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 9e-05
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 9e-05
1q1p_A212 E-Cadherin Activation Length = 212 1e-04
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 1e-04
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 1e-04
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 1e-04
3ubf_A316 Crystal Structure Of Drosophila N-Cadherin Ec1-3, I 4e-04
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 89/167 (53%), Gaps = 9/167 (5%)
Query: 8   LDVETKTHYWLTVFAQDHGV-VPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGI 66
           LD E K  Y LT  A D     PL   ++  I+VQ++NDN P  L+  Y+A + E     
Sbjct: 63  LDREEKAEYTLTAQAVDFETNKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMSILG 122
Query: 67  LPIVQLAASDGDLDP----DQRISYKISAGNPESYFNIDIGSGLISTTGRKLDRENQAEH 122
             +  + A+D D DP      ++ Y I  G P  YF+I+  + +I T    +DRE + E+
Sbjct: 123 TSVTNVTATDAD-DPVYGNSAKLVYSILEGQP--YFSIEPETAIIKTALPNMDREAKEEY 179
Query: 123 VLEVTVTDDGA-PAPLSSTTRVIISVEDVNDNAPEFEQNFYHVNIPE 168
           ++ +   D G     LS TT + +++ DVNDN P+F Q+ YH ++PE
Sbjct: 180 LVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPE 226
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query248
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 5e-47
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 1e-34
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 2e-43
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 4e-29
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 6e-29
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 7e-42
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-33
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-26
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 9e-26
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 8e-42
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-34
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 7e-34
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-29
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-24
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-13
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-40
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-33
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-27
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-27
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-04
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-40
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 8e-35
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 4e-33
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 8e-33
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-27
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-39
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 4e-32
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 3e-39
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 7e-34
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 1e-37
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 6e-31
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-37
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 7e-31
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-22
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 1e-36
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-30
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 2e-34
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 2e-31
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-34
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-30
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-33
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-31
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 7e-27
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 5e-24
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 9e-33
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-16
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-07
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 3e-26
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 1e-10
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 5e-26
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 6e-11
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 5e-25
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 1e-08
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 5e-07
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 4e-20
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 5e-06
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 5e-20
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 7e-06
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-19
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-05
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 3e-19
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 1e-04
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 1e-18
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 3e-04
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 2e-17
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 1e-06
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 5e-17
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 5e-05
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
 Score =  154 bits (391), Expect = 5e-47
 Identities = 50/162 (30%), Positives = 82/162 (50%), Gaps = 9/162 (5%)

Query: 1   NIRTSTILDVETKTHYWLTVFAQDHGV-VPLHARTDVYIQVQNVNDNVPMTLDPVYYAQI 59
           NI  +  LD E +  Y L   A D     PL   ++  ++VQ++NDN P  L  +Y+A +
Sbjct: 57  NIHATKTLDREERAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHEIYHANV 116

Query: 60  VENQSGILPIVQLAASDGDLDPDQ----RISYKISAGNPESYFNIDIGSGLISTTGRKLD 115
            E  +    ++Q+ ASD D DP      ++ Y I  G P  YF+++  +G+I T    +D
Sbjct: 117 PERSNVGTSVIQVTASDAD-DPTYGNSAKLVYSILEGQP--YFSVEAQTGIIRTALPNMD 173

Query: 116 RENQAEHVLEVTVTD-DGAPAPLSSTTRVIISVEDVNDNAPE 156
           RE + E+ + +   D  G    LS TT+V I++ D   +  +
Sbjct: 174 REAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDDYKDDDK 215
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.97
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.97
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.97
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.97
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.97
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.97
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.95
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.95
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.92
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.92
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.88
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.85
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.82
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.82
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.78
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.77
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.77
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.77
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.75
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.66
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.62
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.39
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.38
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.22
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 98.8
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 98.72
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 98.72
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 98.71
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 98.69
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 98.67
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 98.37
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 92.56
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 91.72
3rb5_A298 Na/Ca exchange protein; CBD12, calcium binding and 87.92
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 85.21
2yrl_A102 KIAA1837 protein; PKD domain, NPPSFA, national pro 81.53
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=4e-46  Score=339.22  Aligned_cols=242  Identities=25%  Similarity=0.328  Sum_probs=213.2

Q ss_pred             CcEEccCCCCccCcEEEEEEEEEECCCCCCeeeEEEEEEEEecCCCCCccCCCceEEEEECCCCCCeeEEEEEEEeCCCC
Q psy669            1 NIRTSTILDVETKTHYWLTVFAQDHGVVPLHARTDVYIQVQNVNDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLD   80 (248)
Q Consensus         1 ~i~~~~~LD~E~~~~y~l~v~a~D~~~~~~~~~~~v~i~V~DvNDn~P~f~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~   80 (248)
                      +|++.++||||+...|.|+|+|.|++++++++++.|.|+|.|+|||+|.|....|.++|+|++++|+.|+++.|+|+|.+
T Consensus        59 ~l~~~~~LDrE~~~~y~l~v~a~D~g~~~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~V~En~~~Gt~v~~v~A~D~D~g  138 (559)
T 3q2w_A           59 QLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDP  138 (559)
T ss_dssp             EEEECSCCCTTTCSEEEEEEEEEETTSCEEEEEEEEEEEEECCCCCCCEESCSEEEEEEETTCCTTCEEEECCEECSSCT
T ss_pred             EEEECCccCCCCCceEEEEEEEEECCCCccceeEEEEEEEEeCCCCCCccCCCeeEEEEeCCCCCCcEEEEEEEEcCCCC
Confidence            37889999999999999999999999988999999999999999999999999999999999999999999999999987


Q ss_pred             --CCceEEEEEecCCCC----CcEEEeCCCeEEEEecC-CCCccccceeEEEEEEEeCCC-C-CCCceEEEEEEEEEecC
Q psy669           81 --PDQRISYKISAGNPE----SYFNIDIGSGLISTTGR-KLDRENQAEHVLEVTVTDDGA-P-APLSSTTRVIISVEDVN  151 (248)
Q Consensus        81 --~~~~i~y~i~~~~~~----~~F~id~~tg~i~~~~~-~ld~e~~~~~~l~v~a~d~~~-p-~~~~~~~~v~I~V~d~N  151 (248)
                        .|+.++|+|.++.+.    ++|.|++.+|.| .+.+ .||||....|.|.|.|+|++. | .+++++++|+|+|.|+|
T Consensus       139 ~~~n~~v~Ysi~~~~~~~~~~~~F~Id~~tG~i-~~~~~~LD~E~~~~y~l~V~A~D~~g~p~~~~s~t~~v~I~V~DvN  217 (559)
T 3q2w_A          139 NALNGMLRYRILSQAPSTPSPNMFTINNETGDI-ITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVN  217 (559)
T ss_dssp             TSGGGCCEEEEEEEESCCSCTTCEEECTTTCEE-EECCSCCCTTTCCEEEEEEEEEHHHHCTTTCCEEEEEEEEEEECCS
T ss_pred             CCCceEEEEEEecCCCCCCCcceEEEeCCceEE-EEEeccCCcccCCEEEEEEEEEECCCCCCCCccceEEEEEEEEeCC
Confidence              589999999876543    689999999999 5555 999999999999999999753 2 15899999999999999


Q ss_pred             CCCCeeccCeeEEEecCCCCCCeeEEEEEEEeCCC-------------------------------------CCCCccCc
Q psy669          152 DNAPEFEQNFYHVNIPETRHRDEPLSQVSLISTTG-------------------------------------RKLDRENQ  194 (248)
Q Consensus       152 d~~P~f~~~~y~~~v~E~~~~g~~v~~v~A~D~D~-------------------------------------~~ld~e~~  194 (248)
                      ||+|+|....|.+.|+|++ +|+.|+++.|+|+|.                                     ++||||..
T Consensus       218 Dn~P~f~~~~y~~~V~En~-~g~~v~~v~a~D~D~~~~~n~~~~y~i~~g~~~~~F~I~~~~~~~~G~i~~~~~LD~E~~  296 (559)
T 3q2w_A          218 DNPPEFTAMTFYGEVPENR-VDVIVANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETN  296 (559)
T ss_dssp             CSCCEESSSEEEEEEESSC-SSEEEEEEEEECCSCTTSTTTSBCCEEEESCTTCCEEEEECTTTCEEEEEECSCCCTTTC
T ss_pred             CCCCccccccceeEecCCC-CCcEEEEEEEEcCCCCCCCceeEEEEEecCCCCCceEEEecCCCCcEEEEeCCCCCCccC
Confidence            9999999999999999996 899999999999983                                     56999999


Q ss_pred             eEEEEEEccCCCCce----eecCCceEEEEEEEEeeeCCcccccC---------CCCcccEEEE
Q psy669          195 AEHVLETGSGESEAT----LETGSGESEATLEVLFENSTWENFHE---------TNITGDFLFR  245 (248)
Q Consensus       195 ~~y~~~v~~~~~~~~----~~~~~~t~~~~i~v~d~nd~~P~f~~---------~~~~g~~~~~  245 (248)
                      ..|.|++.+.+....    ....+++++++|+|+|+|| +|.|..         +..+|..++.
T Consensus       297 ~~y~l~V~A~D~~~~~~g~~~~~~s~~~v~I~V~DvND-~P~f~~~~~~~~v~En~~~g~~v~~  359 (559)
T 3q2w_A          297 RMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNE-NPYFAPNPKIIRQEEGLHAGTMLTT  359 (559)
T ss_dssp             SEEEEEEECCBSSCCCTTCCCCGGGEEEEEEEEECCCC-CCEESSSEEEEEEESCCCTTCEEEE
T ss_pred             ceEEEEEEEEcCCccccCCCCCCceEEEEEEEEEeCCC-CCcccccceEEEEeCCCCCCCEEEE
Confidence            999999988875321    1335678999999999999 588844         4445666553
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 248
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 2e-12
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 0.004
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 1e-11
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 0.004
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 3e-11
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 4e-10
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 5e-10
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 9e-10
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 1e-09
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 7e-09
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 4e-07
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-06
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 0.004
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 60.1 bits (144), Expect = 2e-12
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 8/113 (7%)

Query: 44  NDNVPMTLDPVYYAQIVENQSGILPIVQLAASD---GDLDPDQRISYKISAGNPE----S 96
           NDN P     V+   + E       ++ ++A+D        +  +SY I   +PE    +
Sbjct: 2   NDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPN 61

Query: 97  YFNIDIGSGLISTTGRKLDRENQAEHVLEVTVTDDGAPAPLSSTTRVIISVED 149
            F I+  +G+IS  G  LDRE   E+ L V  TD      LS   + II + D
Sbjct: 62  LFTINRETGVISLIGTGLDREKFPEYTLTVQATDLEGA-GLSVEGKAIIQITD 113
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query248
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.9
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.9
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.88
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.87
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.84
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.81
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.75
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.67
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.67
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.66
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.43
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.41
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.38
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.37
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.36
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.2
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.18
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 98.55
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.53
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 98.5
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 89.44
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.90  E-value=1.4e-23  Score=149.80  Aligned_cols=105  Identities=30%  Similarity=0.452  Sum_probs=95.0

Q ss_pred             CCCCCccCCCceEEEEECCCCCCeeEEEEEEEeCCCCC---CceEEEEEecCCC----CCcEEEeCCCeEEEEecCCCCc
Q psy669           44 NDNVPMTLDPVYYAQIVENQSGILPIVQLAASDGDLDP---DQRISYKISAGNP----ESYFNIDIGSGLISTTGRKLDR  116 (248)
Q Consensus        44 NDn~P~f~~~~~~~~v~E~~~~g~~v~~v~a~D~D~~~---~~~i~y~i~~~~~----~~~F~id~~tg~i~~~~~~ld~  116 (248)
                      |||+|.|.+..|.+.|+|+.++|+.|+++.|+|+|.+.   |+.++|+|..+.+    ..+|.|++.+|.|+.+.+.|||
T Consensus         1 NDn~P~F~~~~y~~~V~E~~~~gt~v~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~lD~   80 (112)
T d1edha2           1 NDNRPEFTQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDR   80 (112)
T ss_dssp             SCCCCEESCSEEEEEEETTCCTTCEEEECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTCEEEECSSCCCT
T ss_pred             CCCCCccCCCEEEEEEECCCCCCCEEEEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccceEEEEeccccc
Confidence            89999999999999999999999999999999999864   6789999986432    3689999999999445678999


Q ss_pred             cccceeEEEEEEEeCCCCCCCceEEEEEEEEEe
Q psy669          117 ENQAEHVLEVTVTDDGAPAPLSSTTRVIISVED  149 (248)
Q Consensus       117 e~~~~~~l~v~a~d~~~p~~~~~~~~v~I~V~d  149 (248)
                      |....|.|.|.|+|.|.| +++++++|.|+|.|
T Consensus        81 E~~~~y~l~V~a~D~g~~-~~~~~~~v~I~V~D  112 (112)
T d1edha2          81 ESYPTYTLVVQAADLQGE-GLSTTAKAVITVKD  112 (112)
T ss_dssp             TTCCEEEEEEEEETGGGT-SCEEEEEEEEEEEC
T ss_pred             ccCcEEEEEEEEEECCCC-ccEEEEEEEEEEEC
Confidence            999999999999999999 89999999999987
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure