Psyllid ID: psy6712
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| 194216574 | 375 | PREDICTED: eukaryotic initiation factor | 0.942 | 0.528 | 0.764 | 1e-101 | |
| 432111715 | 324 | Eukaryotic initiation factor 4A-III [Myo | 0.919 | 0.595 | 0.762 | 3e-82 | |
| 428174639 | 382 | hypothetical protein GUITHDRAFT_153197 [ | 0.942 | 0.518 | 0.609 | 7e-79 | |
| 432096348 | 322 | Eukaryotic initiation factor 4A-III [Myo | 0.814 | 0.531 | 0.743 | 4e-77 | |
| 357154181 | 323 | PREDICTED: LOW QUALITY PROTEIN: DEAD-box | 0.933 | 0.606 | 0.671 | 5e-74 | |
| 405950923 | 1228 | Eukaryotic initiation factor 4A-III [Cra | 0.585 | 0.100 | 0.926 | 2e-62 | |
| 170071047 | 222 | DEAD box ATP-dependent RNA helicase [Cul | 0.561 | 0.531 | 0.966 | 3e-61 | |
| 291242437 | 398 | PREDICTED: eukaryotic translation initia | 0.561 | 0.296 | 0.957 | 4e-61 | |
| 196014693 | 401 | DEAD box ATP-dependent RNA helicase [Tri | 0.561 | 0.294 | 0.957 | 5e-61 | |
| 125775187 | 399 | GA20384 [Drosophila pseudoobscura pseudo | 0.561 | 0.295 | 0.957 | 5e-61 |
| >gi|194216574|ref|XP_001490317.2| PREDICTED: eukaryotic initiation factor 4A-III [Equus caballus] | Back alignment and taxonomy information |
|---|
Score = 372 bits (954), Expect = e-101, Method: Compositional matrix adjust.
Identities = 182/238 (76%), Positives = 192/238 (80%), Gaps = 40/238 (16%)
Query: 1 MNVQCHACIGGTNLSEDLRKLDYGQHVVSGTPGRVFDMIRRRVLRTRNIKMLVLDEADEM 60
MNVQCHACIGGTN+ ED+RKLDYGQHVV+GTPGRVFDMIRRR LRTR IKMLVLDEADEM
Sbjct: 133 MNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEM 192
Query: 61 LNKGFKEQIYDVYRYLPPATQV-------------------------------------- 82
LNKGFKEQIYDVYRYLPPATQV
Sbjct: 193 LNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRFYYIHPLFD 252
Query: 83 --DWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSL 140
DWLTEKMREANFTVSSMHGDMPQKER+ IMKEFRSG SRVLI+TDVWARG+DV QVSL
Sbjct: 253 PVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL 312
Query: 141 VINYDLPNNRELYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMN 198
+INYDLPNNRELYIHRIGRSGR+GRKGVAI+FVK+DDIRILRDIEQYYSTQIDEMPMN
Sbjct: 313 IINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMN 370
|
Source: Equus caballus Species: Equus caballus Genus: Equus Family: Equidae Order: Perissodactyla Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|432111715|gb|ELK34777.1| Eukaryotic initiation factor 4A-III [Myotis davidii] | Back alignment and taxonomy information |
|---|
| >gi|428174639|gb|EKX43533.1| hypothetical protein GUITHDRAFT_153197 [Guillardia theta CCMP2712] | Back alignment and taxonomy information |
|---|
| >gi|432096348|gb|ELK27104.1| Eukaryotic initiation factor 4A-III [Myotis davidii] | Back alignment and taxonomy information |
|---|
| >gi|357154181|ref|XP_003576698.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 34-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|405950923|gb|EKC18878.1| Eukaryotic initiation factor 4A-III [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|170071047|ref|XP_001869798.1| DEAD box ATP-dependent RNA helicase [Culex quinquefasciatus] gi|167866996|gb|EDS30379.1| DEAD box ATP-dependent RNA helicase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|291242437|ref|XP_002741112.1| PREDICTED: eukaryotic translation initiation factor 4A-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|196014693|ref|XP_002117205.1| DEAD box ATP-dependent RNA helicase [Trichoplax adhaerens] gi|190580170|gb|EDV20255.1| DEAD box ATP-dependent RNA helicase [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|125775187|ref|XP_001358845.1| GA20384 [Drosophila pseudoobscura pseudoobscura] gi|195144826|ref|XP_002013397.1| GL23429 [Drosophila persimilis] gi|54638586|gb|EAL27988.1| GA20384 [Drosophila pseudoobscura pseudoobscura] gi|194102340|gb|EDW24383.1| GL23429 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 210 | ||||||
| FB|FBgn0037573 | 399 | eIF4AIII "eIF4AIII" [Drosophil | 0.561 | 0.295 | 0.949 | 6.8e-98 | |
| ZFIN|ZDB-GENE-040426-915 | 406 | eif4a3 "eukaryotic translation | 0.561 | 0.290 | 0.906 | 3.3e-96 | |
| UNIPROTKB|Q5ZM36 | 412 | EIF4A3 "Eukaryotic initiation | 0.561 | 0.286 | 0.906 | 4.2e-96 | |
| UNIPROTKB|Q2NL22 | 411 | EIF4A3 "Eukaryotic initiation | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| UNIPROTKB|E2RDZ4 | 411 | EIF4A3 "Uncharacterized protei | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| UNIPROTKB|P38919 | 411 | EIF4A3 "Eukaryotic initiation | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| UNIPROTKB|A6M931 | 411 | EIF4A3 "Eukaryotic initiation | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| UNIPROTKB|F1RZ83 | 411 | EIF4A3 "Eukaryotic initiation | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| RGD|1591139 | 411 | Eif4a3 "eukaryotic translation | 0.561 | 0.287 | 0.906 | 4.2e-96 | |
| WB|WBGene00018007 | 399 | F33D11.10 [Caenorhabditis eleg | 0.561 | 0.295 | 0.872 | 1.8e-93 |
| FB|FBgn0037573 eIF4AIII "eIF4AIII" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 583 (210.3 bits), Expect = 6.8e-98, Sum P(2) = 6.8e-98
Identities = 112/118 (94%), Positives = 116/118 (98%)
Query: 81 QVDWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSL 140
+VDWLTEKMREANFTVSSMHGDMPQKERD IMKEFR+G SRVLITTDVWARGIDVQQVSL
Sbjct: 277 KVDWLTEKMREANFTVSSMHGDMPQKERDEIMKEFRAGQSRVLITTDVWARGIDVQQVSL 336
Query: 141 VINYDLPNNRELYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMN 198
VINYDLPNNRELYIHRIGRSGRFGRKGVAI+FVKSDDIRILRDIEQYYSTQIDEMP+N
Sbjct: 337 VINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIRILRDIEQYYSTQIDEMPVN 394
|
|
| ZFIN|ZDB-GENE-040426-915 eif4a3 "eukaryotic translation initiation factor 4A, isoform 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZM36 EIF4A3 "Eukaryotic initiation factor 4A-III" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2NL22 EIF4A3 "Eukaryotic initiation factor 4A-III" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDZ4 EIF4A3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P38919 EIF4A3 "Eukaryotic initiation factor 4A-III" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6M931 EIF4A3 "Eukaryotic initiation factor 4A-III" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZ83 EIF4A3 "Eukaryotic initiation factor 4A-III" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1591139 Eif4a3 "eukaryotic translation initiation factor 4A, isoform 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00018007 F33D11.10 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 7e-67 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-41 | |
| cd00079 | 131 | cd00079, HELICc, Helicase superfamily c-terminal d | 3e-38 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 2e-36 | |
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 3e-36 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 7e-36 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 7e-34 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 3e-32 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 3e-31 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 5e-29 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 3e-26 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-25 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 8e-25 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 8e-25 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 4e-23 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 6e-22 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 4e-20 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 5e-20 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 5e-16 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 5e-16 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 1e-15 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 1e-12 | |
| COG0514 | 590 | COG0514, RecQ, Superfamily II DNA helicase [DNA re | 2e-11 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 1e-10 | |
| COG1111 | 542 | COG1111, MPH1, ERCC4-like helicases [DNA replicati | 8e-10 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 1e-09 | |
| TIGR01389 | 591 | TIGR01389, recQ, ATP-dependent DNA helicase RecQ | 1e-09 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-09 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 1e-08 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-08 | |
| TIGR00614 | 470 | TIGR00614, recQ_fam, ATP-dependent DNA helicase, R | 5e-08 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 9e-08 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 1e-06 | |
| PLN03137 | 1195 | PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 | 2e-06 | |
| COG1200 | 677 | COG1200, RecG, RecG-like helicase [DNA replication | 3e-06 | |
| PRK13766 | 773 | PRK13766, PRK13766, Hef nuclease; Provisional | 4e-06 | |
| PRK11057 | 607 | PRK11057, PRK11057, ATP-dependent DNA helicase Rec | 4e-06 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 5e-06 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 3e-05 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 4e-05 | |
| PRK10917 | 681 | PRK10917, PRK10917, ATP-dependent DNA helicase Rec | 8e-05 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 3e-04 | |
| COG0556 | 663 | COG0556, UvrB, Helicase subunit of the DNA excisio | 6e-04 | |
| PRK09751 | 1490 | PRK09751, PRK09751, putative ATP-dependent helicas | 0.002 | |
| TIGR00580 | 926 | TIGR00580, mfd, transcription-repair coupling fact | 0.002 | |
| TIGR00595 | 505 | TIGR00595, priA, primosomal protein N' | 0.003 | |
| TIGR00631 | 655 | TIGR00631, uvrb, excinuclease ABC, B subunit | 0.004 |
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
Score = 210 bits (536), Expect = 7e-67
Identities = 87/117 (74%), Positives = 104/117 (88%)
Query: 81 QVDWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSL 140
+VD+LT+KM E +FTVS MHGDM QK+RD IM+EFRSG++RVLITTD+ ARGIDVQQVSL
Sbjct: 279 KVDYLTKKMHERDFTVSCMHGDMDQKDRDLIMREFRSGSTRVLITTDLLARGIDVQQVSL 338
Query: 141 VINYDLPNNRELYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPM 197
VINYDLP + E YIHRIGRSGRFGRKGVAI+FV DDI L++IE++Y+TQI+EMPM
Sbjct: 339 VINYDLPASPENYIHRIGRSGRFGRKGVAINFVTPDDIEQLKEIERHYNTQIEEMPM 395
|
Length = 401 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >gnl|CDD|233040 TIGR00595, priA, primosomal protein N' | Back alignment and domain information |
|---|
| >gnl|CDD|233063 TIGR00631, uvrb, excinuclease ABC, B subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| KOG0328|consensus | 400 | 100.0 | ||
| KOG0330|consensus | 476 | 100.0 | ||
| KOG0331|consensus | 519 | 100.0 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 100.0 | |
| KOG0326|consensus | 459 | 100.0 | ||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| KOG0333|consensus | 673 | 100.0 | ||
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 100.0 | |
| KOG0342|consensus | 543 | 100.0 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 100.0 | |
| KOG0336|consensus | 629 | 100.0 | ||
| KOG0341|consensus | 610 | 100.0 | ||
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 100.0 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 100.0 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 100.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| KOG0338|consensus | 691 | 100.0 | ||
| KOG0335|consensus | 482 | 100.0 | ||
| KOG0340|consensus | 442 | 100.0 | ||
| KOG0345|consensus | 567 | 100.0 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PTZ00424 | 401 | helicase 45; Provisional | 100.0 | |
| KOG0339|consensus | 731 | 100.0 | ||
| KOG0343|consensus | 758 | 100.0 | ||
| KOG0348|consensus | 708 | 100.0 | ||
| KOG0347|consensus | 731 | 100.0 | ||
| KOG0327|consensus | 397 | 100.0 | ||
| KOG4284|consensus | 980 | 100.0 | ||
| KOG0350|consensus | 620 | 100.0 | ||
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 100.0 | |
| KOG0332|consensus | 477 | 99.98 | ||
| KOG0334|consensus | 997 | 99.97 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.97 | |
| KOG0346|consensus | 569 | 99.97 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.97 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.97 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.97 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.97 | |
| KOG0337|consensus | 529 | 99.96 | ||
| KOG0344|consensus | 593 | 99.96 | ||
| KOG0329|consensus | 387 | 99.96 | ||
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.96 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.96 | |
| KOG0349|consensus | 725 | 99.95 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.94 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.94 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.94 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.94 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.93 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.93 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.93 | |
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.92 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.92 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.91 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.91 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.9 | |
| KOG0351|consensus | 941 | 99.9 | ||
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.89 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.89 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.88 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.88 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.88 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.87 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.86 | |
| KOG0352|consensus | 641 | 99.86 | ||
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.85 | |
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 99.85 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.85 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.85 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.85 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.85 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.84 | |
| KOG0354|consensus | 746 | 99.84 | ||
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.84 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.83 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.82 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.8 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.79 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.78 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.77 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 99.76 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.76 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.75 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.75 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 99.74 | |
| KOG0353|consensus | 695 | 99.74 | ||
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 99.73 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.73 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 99.73 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.72 | |
| KOG0952|consensus | 1230 | 99.69 | ||
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.65 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.63 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.61 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.61 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.57 | |
| KOG0951|consensus | 1674 | 99.56 | ||
| KOG0953|consensus | 700 | 99.53 | ||
| KOG0385|consensus | 971 | 99.52 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.49 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 99.48 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 99.48 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 99.47 | |
| KOG0947|consensus | 1248 | 99.47 | ||
| KOG0950|consensus | 1008 | 99.47 | ||
| KOG0948|consensus | 1041 | 99.4 | ||
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.36 | |
| KOG0384|consensus | 1373 | 99.35 | ||
| KOG0949|consensus | 1330 | 99.35 | ||
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.35 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.32 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.31 | |
| KOG0922|consensus | 674 | 99.28 | ||
| KOG4150|consensus | 1034 | 99.25 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 99.21 | |
| KOG0923|consensus | 902 | 99.13 | ||
| KOG0387|consensus | 923 | 99.09 | ||
| KOG0920|consensus | 924 | 99.09 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.06 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 99.03 | |
| KOG0389|consensus | 941 | 99.01 | ||
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.0 | |
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 99.0 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 98.97 | |
| KOG0924|consensus | 1042 | 98.95 | ||
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 98.94 | |
| KOG0390|consensus | 776 | 98.84 | ||
| KOG1123|consensus | 776 | 98.83 | ||
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.73 | |
| KOG1002|consensus | 791 | 98.7 | ||
| KOG0386|consensus | 1157 | 98.68 | ||
| KOG0392|consensus | 1549 | 98.67 | ||
| KOG0926|consensus | 1172 | 98.66 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 98.65 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 98.62 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 98.54 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 98.53 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 98.44 | |
| KOG1000|consensus | 689 | 98.34 | ||
| KOG0925|consensus | 699 | 98.33 | ||
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.29 | |
| KOG0951|consensus | 1674 | 98.29 | ||
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 98.26 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 98.17 | |
| KOG0388|consensus | 1185 | 98.08 | ||
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 97.91 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 97.84 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 97.72 | |
| PF13871 | 278 | Helicase_C_4: Helicase_C-like | 97.68 | |
| PF13307 | 167 | Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 | 97.65 | |
| smart00491 | 142 | HELICc2 helicase superfamily c-terminal domain. | 97.64 | |
| KOG0391|consensus | 1958 | 97.64 | ||
| smart00492 | 141 | HELICc3 helicase superfamily c-terminal domain. | 97.62 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 97.49 | |
| KOG2340|consensus | 698 | 97.49 | ||
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 97.49 | |
| KOG4439|consensus | 901 | 97.47 | ||
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 97.43 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.29 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 97.28 | |
| KOG1015|consensus | 1567 | 97.2 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 97.0 | |
| KOG0921|consensus | 1282 | 96.96 | ||
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 96.88 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 96.18 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.14 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 96.13 | |
| KOG0701|consensus | 1606 | 96.07 | ||
| PF10593 | 239 | Z1: Z1 domain; InterPro: IPR018310 This entry repr | 95.54 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 95.25 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 95.19 | |
| KOG1513|consensus | 1300 | 94.99 | ||
| KOG3089|consensus | 271 | 94.55 | ||
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 94.44 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 94.35 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 94.14 | |
| KOG1016|consensus | 1387 | 93.54 | ||
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 93.35 | |
| KOG1001|consensus | 674 | 93.17 | ||
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 93.13 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 92.73 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 92.01 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 91.98 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 91.78 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 91.71 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 91.42 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 91.14 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 90.47 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 89.91 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 89.91 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 88.83 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 88.61 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 87.79 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 87.47 | |
| KOG1133|consensus | 821 | 87.26 | ||
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 86.64 | |
| KOG0339|consensus | 731 | 85.72 | ||
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 84.69 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 84.52 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 83.68 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 83.52 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 82.82 | |
| PF05872 | 502 | DUF853: Bacterial protein of unknown function (DUF | 82.71 | |
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 82.56 | |
| KOG0391|consensus | 1958 | 81.17 | ||
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 80.5 | |
| KOG0952|consensus | 1230 | 80.06 |
| >KOG0328|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.2e-45 Score=274.50 Aligned_cols=201 Identities=89% Similarity=1.383 Sum_probs=196.1
Q ss_pred CCceEEEEEcCcchHHHHHHhcCCCcEEEEChHHHHHHHHhcCccCCCccEEEechhhHHhccchHHHHHHHHhhCCCch
Q psy6712 1 MNVQCHACIGGTNLSEDLRKLDYGQHVVSGTPGRVFDMIRRRVLRTRNIKMLVLDEADEMLNKGFKEQIYDVYRYLPPAT 80 (210)
Q Consensus 1 ~~i~~~~~~gg~~~~~~~~~l~~~~~Ili~Tp~~l~~~l~~~~~~~~~~~~lviDE~~~l~~~~~~~~~~~i~~~~~~~~ 80 (210)
|||+|+.++||.+..+.++.+.-|.+++.||||++.+++.++.+..+.++++|+||||.|++.+|.+++..++.++|+..
T Consensus 122 mnvq~hacigg~n~gedikkld~G~hvVsGtPGrv~dmikr~~L~tr~vkmlVLDEaDemL~kgfk~Qiydiyr~lp~~~ 201 (400)
T KOG0328|consen 122 MNVQCHACIGGKNLGEDIKKLDYGQHVVSGTPGRVLDMIKRRSLRTRAVKMLVLDEADEMLNKGFKEQIYDIYRYLPPGA 201 (400)
T ss_pred ccceEEEEecCCccchhhhhhcccceEeeCCCchHHHHHHhccccccceeEEEeccHHHHHHhhHHHHHHHHHHhCCCCc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999888
Q ss_pred h----------------------------------------------------------------------------HHH
Q psy6712 81 Q----------------------------------------------------------------------------VDW 84 (210)
Q Consensus 81 ~----------------------------------------------------------------------------~~~ 84 (210)
| ++|
T Consensus 202 Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQavIFcnTk~kVdw 281 (400)
T KOG0328|consen 202 QVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 281 (400)
T ss_pred eEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehheEEEEecccchhhH
Confidence 8 899
Q ss_pred HHHHHHhcCceEEEecCCCCHhHHHHHHHHHhcCCCcEEEEecCccccCCCCCCcEEEEecCCCChhHHHHhhhhhcCCC
Q psy6712 85 LTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFG 164 (210)
Q Consensus 85 l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~g~d~~~~~~vi~~~~p~s~~~~~q~~GR~gR~g 164 (210)
|.+.+++.++.+..+||+|++++|.+++..|+.|+.++|++|+..++|+|+|.+++|||||+|.+...|+||+||.||.|
T Consensus 282 Ltekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~nre~YIHRIGRSGRFG 361 (400)
T KOG0328|consen 282 LTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFG 361 (400)
T ss_pred HHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecCCCccHHHHhhhhccccccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CceeEEEEeccCcHHHHHHHHHHhcCccccccCCccc
Q psy6712 165 RKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMNGKR 201 (210)
Q Consensus 165 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 201 (210)
+.|.++-|+..++...++.++++++..+.++|++.-.
T Consensus 362 RkGvainFVk~~d~~~lrdieq~yst~i~emp~nvad 398 (400)
T KOG0328|consen 362 RKGVAINFVKSDDLRILRDIEQYYSTQIDEMPMNVAD 398 (400)
T ss_pred CcceEEEEecHHHHHHHHHHHHHHhhhcccccchhhh
Confidence 9999999999999999999999999999999998654
|
|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PF13871 Helicase_C_4: Helicase_C-like | Back alignment and domain information |
|---|
| >PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A | Back alignment and domain information |
|---|
| >smart00491 HELICc2 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >smart00492 HELICc3 helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2340|consensus | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0701|consensus | Back alignment and domain information |
|---|
| >PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >KOG1513|consensus | Back alignment and domain information |
|---|
| >KOG3089|consensus | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05872 DUF853: Bacterial protein of unknown function (DUF853); InterPro: IPR008571 Members of this family have a P-loop containing nucleotide triphosphate hydrolases fold | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 210 | ||||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 2e-61 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 2e-61 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 2e-61 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 3e-61 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 9e-61 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 9e-61 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 3e-40 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 4e-40 | ||
| 1fuk_A | 165 | Crystal Structure Of The Carboxy Terminal Domain Of | 1e-35 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 2e-35 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 3e-34 | ||
| 2hjv_A | 163 | Structure Of The Second Domain (Residues 207-368) O | 3e-26 | ||
| 2wax_A | 193 | Structure Of The Human Ddx6 C-Terminal Domain In Co | 2e-25 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 2e-25 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 2e-25 | ||
| 2kbf_A | 187 | Solution Structure Of Carboxyl-Terminal Domain Of D | 4e-25 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 5e-25 | ||
| 1qva_A | 223 | Yeast Initiation Factor 4a N-Terminal Domain Length | 7e-25 | ||
| 1qde_A | 224 | Crystal Structure Of The Atpase Domain Of Translati | 9e-25 | ||
| 3gfp_A | 189 | Structure Of The C-Terminal Domain Of The Dead-Box | 1e-24 | ||
| 3peu_A | 188 | S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To | 1e-24 | ||
| 2rb4_A | 175 | Crystal Structure Of The Helicase Domain Of Human D | 1e-23 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 1e-23 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 4e-23 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 4e-23 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 4e-23 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 4e-23 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 7e-23 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 7e-23 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 7e-23 | ||
| 1t5i_A | 172 | Crystal Structure Of The C-Terminal Domain Of Uap56 | 1e-22 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 1e-22 | ||
| 2g9n_A | 221 | Structure Of The Dead Domain Of Human Eukaryotic In | 2e-22 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 2e-21 | ||
| 2jgn_A | 185 | Ddx3 Helicase Domain Length = 185 | 3e-21 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 4e-21 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 3e-19 | ||
| 2yjt_D | 170 | Crystal Structure Of E. Coli Dead-Box Protein Srmb | 2e-18 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 7e-17 | ||
| 2p6n_A | 191 | Human Dead-box Rna Helicase Ddx41, Helicase Domain | 3e-16 | ||
| 4db4_A | 256 | Mss116p Dead-Box Helicase Domain 2 Bound To A Chima | 6e-14 | ||
| 4db2_C | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 6e-14 | ||
| 4db2_A | 257 | Mss116p Dead-Box Helicase Domain 2 Bound To An Rna | 6e-14 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 8e-14 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 9e-14 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 1e-13 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 5e-13 | ||
| 3i32_A | 300 | Dimeric Structure Of A Hera Helicase Fragment Inclu | 8e-13 | ||
| 3eaq_A | 212 | Novel Dimerization Motif In The Dead Box Rna Helica | 3e-12 | ||
| 2oxc_A | 230 | Human Dead-Box Rna Helicase Ddx20, Dead Domain In C | 6e-12 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 8e-10 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 8e-10 | ||
| 2kbe_A | 226 | Solution Structure Of Amino-Terminal Domain Of Dbp5 | 2e-09 | ||
| 1q0u_A | 219 | Crystal Structure Of The Bstdead N-Terminal Domain | 7e-09 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 1e-08 | ||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 4e-08 | ||
| 1t6n_A | 220 | Crystal Structure Of The N-Terminal Domain Of Human | 5e-07 | ||
| 1oyy_A | 523 | Structure Of The Recq Catalytic Core Bound To Atp-G | 1e-06 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 2e-06 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 2e-06 | ||
| 1oyw_A | 523 | Structure Of The Recq Catalytic Core Length = 523 | 3e-06 | ||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 1e-05 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 3e-05 | ||
| 4gl2_A | 699 | Structural Basis For Dsrna Duplex Backbone Recognit | 4e-05 | ||
| 1gm5_A | 780 | Structure Of Recg Bound To Three-Way Dna Junction L | 4e-05 | ||
| 1d9z_A | 657 | Crystal Structure Of The Dna Repair Protein Uvrb In | 5e-05 | ||
| 1d9x_A | 658 | Crystal Structure Of The Dna Repair Protein Uvrb Le | 5e-05 | ||
| 2fdc_A | 658 | Structural Basis Of Dna Damage Recognition And Proc | 6e-05 | ||
| 1t5l_A | 658 | Crystal Structure Of The Dna Repair Protein Uvrb Po | 6e-05 | ||
| 3uwx_B | 683 | Crystal Structure Of Uvra-Uvrb Complex Length = 683 | 6e-05 | ||
| 1wp9_A | 494 | Crystal Structure Of Pyrococcus Furiosus Hef Helica | 9e-05 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 4e-04 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 4e-04 | ||
| 3v4r_A | 667 | Crystal Structure Of A Uvrb Dimer-Dna Complex Lengt | 5e-04 | ||
| 2d7d_A | 661 | Structural Insights Into The Cryptic Dna Dependent | 5e-04 | ||
| 3fhc_B | 235 | Crystal Structure Of Human Dbp5 In Complex With Nup | 6e-04 |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
|
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 | Back alignment and structure |
| >pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 | Back alignment and structure |
| >pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 | Back alignment and structure |
| >pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 | Back alignment and structure |
| >pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 | Back alignment and structure |
| >pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 | Back alignment and structure |
| >pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 | Back alignment and structure |
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 | Back alignment and structure |
| >pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 | Back alignment and structure |
| >pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 | Back alignment and structure |
| >pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 | Back alignment and structure |
| >pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 | Back alignment and structure |
| >pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 | Back alignment and structure |
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
| >pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 | Back alignment and structure |
| >pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 | Back alignment and structure |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By Mda5 Length = 699 | Back alignment and structure |
| >pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 | Back alignment and structure |
| >pdb|1D9Z|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb In Complex With Atp Length = 657 | Back alignment and structure |
| >pdb|1D9X|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Length = 658 | Back alignment and structure |
| >pdb|2FDC|A Chain A, Structural Basis Of Dna Damage Recognition And Processing By Uvrb: Crystal Structure Of A UvrbDNA COMPLEX Length = 658 | Back alignment and structure |
| >pdb|1T5L|A Chain A, Crystal Structure Of The Dna Repair Protein Uvrb Point Mutant Y96a Revealing A Novel Fold For Domain 2 Length = 658 | Back alignment and structure |
| >pdb|3UWX|B Chain B, Crystal Structure Of Uvra-Uvrb Complex Length = 683 | Back alignment and structure |
| >pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
| >pdb|3V4R|A Chain A, Crystal Structure Of A Uvrb Dimer-Dna Complex Length = 667 | Back alignment and structure |
| >pdb|2D7D|A Chain A, Structural Insights Into The Cryptic Dna Dependent Atp-Ase Activity Of Uvrb Length = 661 | Back alignment and structure |
| >pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 210 | |||
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 9e-81 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 5e-45 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 1e-80 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 7e-44 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 1e-80 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-80 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 2e-46 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 3e-80 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 4e-41 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 7e-78 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 5e-45 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 1e-77 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 2e-76 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 5e-75 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 9e-75 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 2e-36 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 9e-74 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 8e-36 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 3e-73 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 4e-39 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 2e-71 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 9e-36 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 2e-50 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 6e-49 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 3e-48 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 1e-47 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 8e-21 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 1e-47 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 9e-46 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 3e-43 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 4e-18 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 7e-43 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 2e-42 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 7e-17 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 3e-42 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 3e-42 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 3e-19 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 2e-41 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 3e-41 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 4e-19 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 5e-41 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 3e-17 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 4e-40 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 4e-38 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 2e-37 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 7e-26 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 4e-10 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 5e-24 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 3e-21 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 1e-19 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 6e-18 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 1e-17 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 4e-17 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 2e-16 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 5e-16 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 8e-15 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 5e-13 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 3e-12 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 3e-11 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 4e-11 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 5e-11 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 5e-11 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 3e-10 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 1e-07 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 4e-07 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 7e-06 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 1e-05 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 3e-05 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 5e-05 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 2e-04 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 7e-04 |
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
Score = 245 bits (628), Expect = 9e-81
Identities = 90/117 (76%), Positives = 101/117 (86%)
Query: 82 VDWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSLV 141
VDWLTEKM +FTVS+MHGDM QKERD IM+EFRSG+SRVLITTD+ ARGIDVQQVSLV
Sbjct: 293 VDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLV 352
Query: 142 INYDLPNNRELYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMN 198
INYDLP NRE YIHRIGR GRFGRKGVAI+ V +D R LRDIE +Y+T I+EMP+N
Sbjct: 353 INYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPLN 409
|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Length = 780 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 100.0 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 100.0 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 100.0 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 100.0 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 100.0 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 100.0 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 100.0 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 100.0 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 100.0 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 100.0 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 100.0 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 100.0 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 100.0 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.97 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.97 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.97 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.97 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.97 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.95 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.95 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.95 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 99.95 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.95 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 99.95 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.94 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 99.94 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 99.94 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.94 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 99.94 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.94 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.94 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.94 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.94 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.94 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.93 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 99.93 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.93 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 99.93 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.93 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.93 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.93 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.93 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.92 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.92 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 99.86 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.92 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.91 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.91 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.91 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.9 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.9 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.89 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.89 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.88 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.87 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.87 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.87 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.87 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 99.86 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.86 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 99.86 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.84 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.83 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.8 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.79 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.78 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.76 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.74 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.72 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.6 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.48 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 99.39 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 99.32 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 99.29 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 99.28 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 99.26 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 99.25 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 99.23 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 99.23 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 99.21 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 99.2 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 99.14 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 99.14 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 99.11 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.04 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 98.9 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 98.61 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 98.19 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 97.67 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 97.41 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.96 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 96.56 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 96.51 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 96.22 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 94.88 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 94.17 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 93.47 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 92.16 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 84.88 |
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.4e-38 Score=262.98 Aligned_cols=200 Identities=35% Similarity=0.627 Sum_probs=183.7
Q ss_pred CceEEEEEcCcchHHHHHHhcCCCcEEEEChHHHHHHHHhcCccCCCccEEEechhhHHhccchHHHHHHHHhhCC--Cc
Q psy6712 2 NVQCHACIGGTNLSEDLRKLDYGQHVVSGTPGRVFDMIRRRVLRTRNIKMLVLDEADEMLNKGFKEQIYDVYRYLP--PA 79 (210)
Q Consensus 2 ~i~~~~~~gg~~~~~~~~~l~~~~~Ili~Tp~~l~~~l~~~~~~~~~~~~lviDE~~~l~~~~~~~~~~~i~~~~~--~~ 79 (210)
++++..++||.+...+...+..+++|+|+||++|.+++.++.+.+++++++|+||||+|++.++...+..++..+. ..
T Consensus 157 ~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~ 236 (434)
T 2db3_A 157 YLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPE 236 (434)
T ss_dssp SCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSS
T ss_pred CcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCC
Confidence 5788899999999999999999999999999999999999989999999999999999999999999988887642 22
Q ss_pred hh--------------------------------------------------------------------------HHHH
Q psy6712 80 TQ--------------------------------------------------------------------------VDWL 85 (210)
Q Consensus 80 ~~--------------------------------------------------------------------------~~~l 85 (210)
.+ ++.+
T Consensus 237 ~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~~~lVF~~t~~~a~~l 316 (434)
T 2db3_A 237 HQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQADGTIVFVETKRGADFL 316 (434)
T ss_dssp CEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCTTEEEECSSHHHHHHH
T ss_pred ceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCCCEEEEEeCcHHHHHH
Confidence 22 8889
Q ss_pred HHHHHhcCceEEEecCCCCHhHHHHHHHHHhcCCCcEEEEecCccccCCCCCCcEEEEecCCCChhHHHHhhhhhcCCCC
Q psy6712 86 TEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGR 165 (210)
Q Consensus 86 ~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~g~d~~~~~~vi~~~~p~s~~~~~q~~GR~gR~g~ 165 (210)
++.|.+.++++..+||+|++.+|.+++++|++|+.+|||||+++++|+|+|++++||+||+|.+..+|+||+||+||.|+
T Consensus 317 ~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~ 396 (434)
T 2db3_A 317 ASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGN 396 (434)
T ss_dssp HHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTC
T ss_pred HHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeEEEEecc-CcHHHHHHHHHHhcCccccccCCccc
Q psy6712 166 KGVAISFVKS-DDIRILRDIEQYYSTQIDEMPMNGKR 201 (210)
Q Consensus 166 ~g~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~ 201 (210)
.|.+++|+.+ .+......+.+.+....+++|..+.+
T Consensus 397 ~G~a~~~~~~~~~~~~~~~l~~~l~~~~~~vp~~l~~ 433 (434)
T 2db3_A 397 NGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRT 433 (434)
T ss_dssp CEEEEEEECTTTCGGGHHHHHHHHHHTTCCCCGGGC-
T ss_pred CCEEEEEEeccccHHHHHHHHHHHHHcCCCCCHHHHh
Confidence 9999999995 57788889999999998888876543
|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 210 | ||||
| d2j0sa2 | 168 | c.37.1.19 (A:244-411) Probable ATP-dependent RNA h | 1e-26 | |
| d1a1va2 | 299 | c.37.1.14 (A:326-624) HCV helicase domain {Human h | 2e-26 | |
| d1fuka_ | 162 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 2e-26 | |
| d1wp9a2 | 286 | c.37.1.19 (A:201-486) putative ATP-dependent RNA h | 4e-23 | |
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 5e-20 | |
| d1hv8a2 | 155 | c.37.1.19 (A:211-365) Putative DEAD box RNA helica | 9e-20 | |
| d2rb4a1 | 168 | c.37.1.19 (A:307-474) ATP-dependent RNA helicase D | 9e-20 | |
| d1gkub2 | 248 | c.37.1.16 (B:251-498) Helicase-like "domain" of re | 1e-19 | |
| d1s2ma2 | 171 | c.37.1.19 (A:252-422) Putative ATP-dependent RNA h | 8e-19 | |
| d1t5la2 | 181 | c.37.1.19 (A:415-595) Nucleotide excision repair e | 2e-16 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 2e-15 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 3e-12 | |
| d1c4oa2 | 174 | c.37.1.19 (A:410-583) Nucleotide excision repair e | 1e-11 | |
| d1jr6a_ | 138 | c.37.1.14 (A:) HCV helicase domain {Human hepatiti | 1e-11 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 4e-11 | |
| d1oywa3 | 200 | c.37.1.19 (A:207-406) RecQ helicase domain {Escher | 9e-11 | |
| d1t5ia_ | 168 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 1e-10 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 8e-09 | |
| d2eyqa5 | 211 | c.37.1.19 (A:779-989) Transcription-repair couplin | 5e-08 | |
| d2p6ra4 | 201 | c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob | 7e-08 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 2e-07 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 2e-06 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 8e-06 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 1e-05 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 1e-04 | |
| d1tf5a4 | 175 | c.37.1.19 (A:396-570) Translocation ATPase SecA, n | 2e-04 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 4e-04 |
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Score = 98.5 bits (244), Expect = 1e-26
Identities = 107/118 (90%), Positives = 115/118 (97%)
Query: 81 QVDWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSL 140
+VDWLTEKMREANFTVSSMHGDMPQKER+ IMKEFRSG SRVLI+TDVWARG+DV QVSL
Sbjct: 46 KVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSL 105
Query: 141 VINYDLPNNRELYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMN 198
+INYDLPNNRELYIHRIGRSGR+GRKGVAI+FVK+DDIRILRDIEQYYSTQIDEMPMN
Sbjct: 106 IINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMN 163
|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 210 | |||
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.97 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.96 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.96 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.96 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 99.96 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.95 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.94 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 99.92 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 99.92 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.84 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.84 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.82 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.79 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.76 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 99.76 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.72 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.7 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.68 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 99.58 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 99.53 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 99.53 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 99.49 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.44 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 99.42 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 99.42 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 99.4 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.34 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 99.33 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.31 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.29 | |
| d1tf5a4 | 175 | Translocation ATPase SecA, nucleotide-binding doma | 99.15 | |
| d1nkta4 | 219 | Translocation ATPase SecA, nucleotide-binding doma | 98.47 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 98.14 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 97.93 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.7 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.37 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.95 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 96.77 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 96.68 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 95.98 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.14 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.5 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 93.99 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 93.81 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 93.81 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 91.33 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 87.2 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 85.51 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 85.08 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 84.51 |
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Initiation factor 4a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.97 E-value=1.6e-30 Score=187.06 Aligned_cols=133 Identities=59% Similarity=0.958 Sum_probs=121.4
Q ss_pred HHhhCCCchhHHHHHHHHHhcCceEEEecCCCCHhHHHHHHHHHhcCCCcEEEEecCccccCCCCCCcEEEEecCCCChh
Q psy6712 72 VYRYLPPATQVDWLTEKMREANFTVSSMHGDMPQKERDGIMKEFRSGTSRVLITTDVWARGIDVQQVSLVINYDLPNNRE 151 (210)
Q Consensus 72 i~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~g~~~ilv~T~~~~~g~d~~~~~~vi~~~~p~s~~ 151 (210)
.+.|+.....++.+++.|...++.+..+||+|+..+|..+++.|+.|+.++||||+++++|+|+|++++||+||+|+++.
T Consensus 30 ~iIF~~s~~~~~~l~~~L~~~~~~~~~~~~~~~~~~r~~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~~ 109 (162)
T d1fuka_ 30 AVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKE 109 (162)
T ss_dssp EEEEESSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCSSGG
T ss_pred EEEEEEEEchHHHHHHHHhhcCceEEEeccCCchhhHHHHHHHHhhcccceeeccccccccccCCCceEEEEeccchhHH
Confidence 34466677779999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhhhhcCCCCceeEEEEeccCcHHHHHHHHHHhcCccccccCCccccCC
Q psy6712 152 LYIHRIGRSGRFGRKGVAISFVKSDDIRILRDIEQYYSTQIDEMPMNGKRSLH 204 (210)
Q Consensus 152 ~~~q~~GR~gR~g~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 204 (210)
.|+||+||+||.|+.|.+++++++.|...++.+++.++..++++|.++.++++
T Consensus 110 ~yihR~GR~gR~g~~g~~i~~~~~~d~~~~~~i~~~~~~~~~~ip~~~~~l~~ 162 (162)
T d1fuka_ 110 NYIHRIGRGGRFGRKGVAINFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN 162 (162)
T ss_dssp GGGGSSCSCC-----CEEEEEEETTTHHHHHHHHHHSSCCCEECCSCCTTTTC
T ss_pred HHHhhccccccCCCccEEEEEcCHHHHHHHHHHHHHHcCcCCCCChHHHHhhC
Confidence 99999999999999999999999999999999999999999999999988764
|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|