Psyllid ID: psy6717

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRRQQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKEFGDEDSSYDDDSVGKSEDEYIEESSHLFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQMLEEENEMNNDDDGDLSNEEYVQDSGSETSIIKSCDENK
cccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccHEHHEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHcccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcHccccccHccccccccc
mkchyevlgvplnvndeDLKKAYRKLALKwhpdknpnnlEEAKEQFQLIQQAYEVLsnpherafydkhkdvflrqdydesdsidltpyftascykgygdgekgfYSVYRDVFIKIAVEEmefseeemdipnfgnstssYYNTVHNFYAFWQSFSTKKTYSWLKAfdinmapnRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRRQQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKefgdedssydddsvgksedeYIEESSHLFCIACNKLFKTEKAFqnhenskkhKENVAILKEQMLEEEnemnndddgdlsneeyvqdsgsetsiikscdenk
mkchyevlgvplnvndedLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDydesdsidlTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAfdinmapnrrvLRLIEKENkrirdkakkeyndtvKNLVefvrkkdkrvqnqalikkqekeenalklkeRRRQQMIdrkkemesmkenewskfsnleKELKDIEASVakefgdedssydddSVGKSEDEYIEESSHLFCIACNKLFKTEKAFQnhenskkhkenVAILKEQMLEEENemnndddgdlsneeyvqdsgsetsiikscdenk
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVeemefseeemDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRRQQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKEFGDEDSSYDDDSVGKSEDEYIEESSHLFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQMLeeenemnndddgdLSNEEYVQDSGSETSIIKSCDENK
**CHYEVLGVPLNVNDEDLKKAYRKLALKWH*************QFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVLRLIEK**************DTVKNLVEFV*******************************************************************************************SSHLFCIACNKLFKTE*************************************************************
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKD**************LTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEF*************TSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDI*MA**R********************YNDTVKNLVEFVRKKDKRV**********************************************************************************EESSHLFCIACNKLFK***************************************************************
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRRQQMID*************SKFSNLEKELKDIEASVAKEFG*******************EESSHLFCIACNKLFKTEKAF*********KENVAILKEQMLEEENEMNNDDDGDLSNEE*******************
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRRQQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKE**********************ESSHLFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQMLEEENEM*******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYDESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEEMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRVxxxxxxxxxxxxxxxxxxxxxTVKNLVEFVRKKDKRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKENEWSKFSNLEKELKDIEASVAKEFGDEDSSYDDDSVGKSEDEYIEESSHLFCIACNKLFKTEKAFQNHENxxxxxxxxxxxxxxxxxxxxxMNNDDDGDLSNEEYVQDSGSETSIIKSCDENK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query373 2.2.26 [Sep-21-2011]
Q0II91 533 DnaJ homolog subfamily C yes N/A 0.908 0.636 0.524 2e-96
Q5F1R6 531 DnaJ homolog subfamily C yes N/A 0.898 0.630 0.527 1e-93
Q6PGY5 545 DnaJ homolog subfamily C yes N/A 0.903 0.618 0.495 3e-91
P53863 590 J protein JJJ1 OS=Sacchar yes N/A 0.804 0.508 0.323 1e-43
O14213380 Meiotically up-regulated yes N/A 0.777 0.763 0.265 2e-24
Q8NHS0232 DnaJ homolog subfamily B no N/A 0.179 0.288 0.597 8e-18
Q4R7Y5241 DnaJ homolog subfamily B N/A N/A 0.182 0.282 0.602 7e-17
A5IIT4369 Chaperone protein DnaJ OS yes N/A 0.211 0.214 0.468 1e-16
B1LCI2369 Chaperone protein DnaJ OS yes N/A 0.211 0.214 0.468 1e-16
Q9QYI7227 DnaJ homolog subfamily B no N/A 0.179 0.295 0.582 1e-16
>sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 Back     alignment and function desciption
 Score =  353 bits (905), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 241/353 (68%), Gaps = 14/353 (3%)

Query: 1   MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPH 60
           MKCHYE LGV  + ++E+LKKAYRKLALKWHPDKN +N  EA EQF+LIQ AY+VLS+P 
Sbjct: 1   MKCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQ 60

Query: 61  ERAFYDKHKDVFLRQDYD---ESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAV 117
           ERA+YD H++  L+   D   + DS+DL  YFT +CY GYGD EKGFY+VYR+VF  IA 
Sbjct: 61  ERAWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDEKGFYTVYRNVFEMIAK 120

Query: 118 EEMEFS-EEEM-DIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRV 175
           EE+E + EE+M D P FG+S S Y   VH FYA+WQSF T+K ++W + +D   A NR  
Sbjct: 121 EELESALEEDMEDFPTFGDSQSDYDTVVHPFYAYWQSFCTQKNFAWKEEYDTRQASNRWE 180

Query: 176 LRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRR 235
            R +EKENK+IRDKA+KE N+ V+ LV F+RK+D+RVQ    + +++  E A K +  RR
Sbjct: 181 KRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDRRVQAHRKLVEEQNAEKARKAEAMRR 240

Query: 236 QQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKEFGD-------EDSSYDDDSVGK 288
           QQ + + K  E  +E  W   ++LEKEL+++EA   K+FGD       ED    D   GK
Sbjct: 241 QQKLKQAKLAEQYREQSWMAVADLEKELREMEAQYEKQFGDGSGEDEAEDQELRDGQDGK 300

Query: 289 SEDEY--IEESSHLFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQMLEEE 339
             DE    E    L+C AC+K FKTEKA +NHE SKKH+E VA+LK+Q+ EEE
Sbjct: 301 DSDEAEDAELYDGLYCPACDKSFKTEKAMRNHEKSKKHREMVALLKQQLEEEE 353
May act as a co-chaperone for HSP70.
Bos taurus (taxid: 9913)
>sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 Back     alignment and function description
>sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 Back     alignment and function description
>sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 Back     alignment and function description
>sp|O14213|MU185_SCHPO Meiotically up-regulated gene 185 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug185 PE=1 SV=1 Back     alignment and function description
>sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 Back     alignment and function description
>sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
380023655 597 PREDICTED: dnaJ homolog subfamily C memb 0.967 0.604 0.572 1e-119
328792624 603 PREDICTED: dnaJ homolog subfamily C memb 0.965 0.597 0.561 1e-117
340708628 645 PREDICTED: dnaJ homolog subfamily C memb 0.949 0.548 0.537 1e-114
350413145 1654 PREDICTED: hypothetical protein LOC10074 0.943 0.212 0.559 1e-114
345483239 665 PREDICTED: dnaJ homolog subfamily C memb 0.884 0.496 0.590 1e-114
383861813 619 PREDICTED: dnaJ homolog subfamily C memb 0.898 0.541 0.580 1e-113
307183662 585 DnaJ-like protein subfamily C member 21 0.924 0.589 0.530 1e-107
322794346 675 hypothetical protein SINV_08718 [Solenop 0.863 0.477 0.548 1e-103
332025896 637 DnaJ-like protein subfamily C member 21 0.911 0.533 0.530 1e-102
328702457 580 PREDICTED: dnaJ homolog subfamily C memb 0.882 0.567 0.535 2e-98
>gi|380023655|ref|XP_003695631.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Apis florea] Back     alignment and taxonomy information
 Score =  434 bits (1117), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/372 (57%), Positives = 287/372 (77%), Gaps = 11/372 (2%)

Query: 1   MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPH 60
           MKCHYEVLGVP N +D+DLKKAYRKLALKWHPDKN NN EEAKEQFQL+QQA+EVLS+PH
Sbjct: 1   MKCHYEVLGVPRNASDDDLKKAYRKLALKWHPDKNLNNPEEAKEQFQLVQQAWEVLSDPH 60

Query: 61  ERAFYDKHKDVFLRQDYDES---DSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAV 117
           ER +YD H+D  L+    E+   DSIDL  YF+ +C+KGYGD EKGFY++YR+VF K+A 
Sbjct: 61  ERTWYDNHRDAILKGGIGENYKDDSIDLFQYFSTTCFKGYGDDEKGFYTIYRNVFEKLAA 120

Query: 118 EEMEFSEE---EMDIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRR 174
           E++E+S+E   + ++P FG+S SSY   VHNFYA+WQS++TKK+++WL  +DI  APNRR
Sbjct: 121 EDLEYSKEGDSDEEVPGFGDSQSSYKEVVHNFYAYWQSYNTKKSFAWLDPYDIRNAPNRR 180

Query: 175 VLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERR 234
           V+RLIEKENK++RDKAKKE N+ V+NLV F+RK+DKRVQ       +  +EN  K++ER+
Sbjct: 181 VVRLIEKENKKVRDKAKKERNEQVRNLVAFIRKRDKRVQIHTTKLIERAKENLRKVEERK 240

Query: 235 RQQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKEFGDEDSSYDDDSVGKSEDEYI 294
           RQQ+++R+K+++  K +EWSKFSN+E ELK+IEA++A+EFG ED S+D    G  +DE  
Sbjct: 241 RQQLLERQKQLKEHKVSEWSKFSNIEAELKNIEANLAQEFG-EDLSFD----GDIDDENT 295

Query: 295 EESSHLFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQMLEEENEMNNDDDGDLSNEE 354
            + + ++CIACNK+FKT KAF NHENSKKHK+N+AI+K  M++E+N + N    +  N+ 
Sbjct: 296 IDDNSMYCIACNKIFKTHKAFTNHENSKKHKDNIAIIKVSMIQEDNFLLNPIQNNSKNKN 355

Query: 355 YVQDSGSETSII 366
              +  SE  +I
Sbjct: 356 NTGEQTSEEELI 367

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328792624|ref|XP_003251751.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340708628|ref|XP_003392924.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413145|ref|XP_003489894.1| PREDICTED: hypothetical protein LOC100749410 [Bombus impatiens] Back     alignment and taxonomy information
>gi|345483239|ref|XP_001602150.2| PREDICTED: dnaJ homolog subfamily C member 21-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383861813|ref|XP_003706379.1| PREDICTED: dnaJ homolog subfamily C member 21-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307183662|gb|EFN70365.1| DnaJ-like protein subfamily C member 21 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322794346|gb|EFZ17454.1| hypothetical protein SINV_08718 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332025896|gb|EGI66052.1| DnaJ-like protein subfamily C member 21 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328702457|ref|XP_001943330.2| PREDICTED: dnaJ homolog subfamily C member 21-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query373
UNIPROTKB|Q5F1R6 531 DNAJC21 "DnaJ homolog subfamil 0.898 0.630 0.510 9.3e-91
UNIPROTKB|F1LPX6 533 Dnajc21 "Protein Dnajc21" [Rat 0.898 0.628 0.507 3.1e-90
UNIPROTKB|E2QZB7 532 DNAJC21 "Uncharacterized prote 0.898 0.629 0.510 6.5e-90
UNIPROTKB|Q0II91 533 DNAJC21 "DnaJ homolog subfamil 0.898 0.628 0.504 9.6e-89
UNIPROTKB|F1SND3 533 DNAJC21 "Uncharacterized prote 0.898 0.628 0.502 1.8e-87
UNIPROTKB|E1C4H3 537 DNAJC21 "Uncharacterized prote 0.895 0.621 0.5 2.6e-86
ZFIN|ZDB-GENE-030131-8928 545 dnajc21 "DnaJ (Hsp40) homolog, 0.898 0.614 0.472 1.3e-84
FB|FBgn0027599 540 CG2790 [Drosophila melanogaste 0.892 0.616 0.477 2.5e-81
WB|WBGene00001035 510 dnj-17 [Caenorhabditis elegans 0.863 0.631 0.439 4e-67
UNIPROTKB|G3MY70 485 G3MY70 "Uncharacterized protei 0.873 0.672 0.425 6.7e-65
UNIPROTKB|Q5F1R6 DNAJC21 "DnaJ homolog subfamily C member 21" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 905 (323.6 bits), Expect = 9.3e-91, P = 9.3e-91
 Identities = 178/349 (51%), Positives = 234/349 (67%)

Query:     1 MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPH 60
             MKCHYE LGV  + ++E+LKKAYRKLALKWHPDKN +N  EA EQF+LIQ AY+VLS+P 
Sbjct:     1 MKCHYEALGVRRDASEEELKKAYRKLALKWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQ 60

Query:    61 ERAFYDKHKDVFLRQDYD---ESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAV 117
             ERA+YD H++  L+  +D   + DS+DL  YFT +CY GYGD EKGFY+VYR+VF  IA 
Sbjct:    61 ERAWYDNHREALLKGGFDGEYQDDSLDLLRYFTVTCYSGYGDDEKGFYTVYRNVFEMIAK 120

Query:   118 XXXXXXXXXX--DIPNFGNSTSSYYNTVHNFYAFWQSFSTKKTYSWLKAFDINMAPNRRV 175
                         D P FG+S S Y   VH FYA+WQSF T+K ++W + +D   A NR  
Sbjct:   121 EELESVLEEEVDDFPTFGDSQSDYDTVVHPFYAYWQSFCTQKNFAWKEEYDTRQASNRWE 180

Query:   176 LRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQEKEENALKLKERRR 235
              R +EKENK+IRDKA+KE N+ V+ LV F+RK+DKRVQ    + +++  E A K +E RR
Sbjct:   181 KRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNAEKARKAEEMRR 240

Query:   236 QQMIDRKKEMESMKENEWSKFSNLEKELKDIEASVAKEFGD-------EDSSYDDDSVGK 288
             QQ + + K +E  +E  W   +NLEKEL+++EA   KEFGD       E+    D+  GK
Sbjct:   241 QQKLKQAKLVEQYREQSWMTMANLEKELQEMEARYEKEFGDGSDENEMEEHELKDEEDGK 300

Query:   289 SEDEYIEESSH--LFCIACNKLFKTEKAFQNHENSKKHKENVAILKEQM 335
               DE  +   +  L+C AC+K FKTEKA +NHE SKKH+E VA+LK+Q+
Sbjct:   301 DSDEAEDAELYDDLYCPACDKSFKTEKAMKNHEKSKKHREMVALLKQQL 349
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006457 "protein folding" evidence=NAS
GO:0005840 "ribosome" evidence=NAS
GO:0003674 "molecular_function" evidence=ND
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1LPX6 Dnajc21 "Protein Dnajc21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZB7 DNAJC21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q0II91 DNAJC21 "DnaJ homolog subfamily C member 21" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND3 DNAJC21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4H3 DNAJC21 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8928 dnajc21 "DnaJ (Hsp40) homolog, subfamily C, member 21" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0027599 CG2790 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001035 dnj-17 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G3MY70 G3MY70 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5F1R6DJC21_HUMANNo assigned EC number0.52720.89810.6308yesN/A
Q0II91DJC21_BOVINNo assigned EC number0.52400.90880.6360yesN/A
Q6PGY5DJC21_DANRENo assigned EC number0.49590.90340.6183yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-25
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-23
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 4e-23
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 6e-23
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-21
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-21
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-20
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 2e-19
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 3e-19
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-19
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-19
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 5e-19
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 9e-19
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 3e-18
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 4e-18
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-17
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 9e-17
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 2e-16
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 3e-16
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-16
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 9e-16
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-15
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-15
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-15
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 3e-15
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 1e-14
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-14
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 3e-14
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-13
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-12
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 3e-12
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-12
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 7e-12
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 9e-11
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 3e-09
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 4e-09
pfam1217127 pfam12171, zf-C2H2_jaz, Zinc-finger double-strande 2e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-08
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 2e-07
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 5e-07
smart0045135 smart00451, ZnF_U1, U1-like zinc finger 5e-06
pfam1287425 pfam12874, zf-met, Zinc-finger of C2H2 type 3e-05
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information 
 Score =  105 bits (266), Expect = 1e-25
 Identities = 37/67 (55%), Positives = 58/67 (86%), Gaps = 1/67 (1%)

Query: 2  KCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHE 61
          + +YEVLGV  N +++++KKAYRKLA+K+HPD+NP + +EA+E+F+ I++AYEVLS+P +
Sbjct: 4  RDYYEVLGVSRNASEDEIKKAYRKLAMKYHPDRNPGD-KEAEEKFKEIKEAYEVLSDPQK 62

Query: 62 RAFYDKH 68
          RA YD++
Sbjct: 63 RAAYDQY 69

Length = 371
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|204841 pfam12171, zf-C2H2_jaz, Zinc-finger double-stranded RNA-binding Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197732 smart00451, ZnF_U1, U1-like zinc finger Back     alignment and domain information
>gnl|CDD|205121 pfam12874, zf-met, Zinc-finger of C2H2 type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 373
KOG0717|consensus 508 100.0
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.9
KOG0713|consensus336 99.88
PRK14288369 chaperone protein DnaJ; Provisional 99.8
KOG0712|consensus337 99.78
PRK14286372 chaperone protein DnaJ; Provisional 99.78
PRK14296372 chaperone protein DnaJ; Provisional 99.78
PRK14285365 chaperone protein DnaJ; Provisional 99.77
PRK14287371 chaperone protein DnaJ; Provisional 99.75
PRK14276380 chaperone protein DnaJ; Provisional 99.74
PRK14294366 chaperone protein DnaJ; Provisional 99.74
PRK14297380 chaperone protein DnaJ; Provisional 99.74
PRK14278378 chaperone protein DnaJ; Provisional 99.74
PRK14301373 chaperone protein DnaJ; Provisional 99.73
PRK14279392 chaperone protein DnaJ; Provisional 99.73
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.72
PRK14299291 chaperone protein DnaJ; Provisional 99.72
PRK14281397 chaperone protein DnaJ; Provisional 99.72
PRK14298377 chaperone protein DnaJ; Provisional 99.72
PRK14282369 chaperone protein DnaJ; Provisional 99.71
PRK14277386 chaperone protein DnaJ; Provisional 99.71
PRK14290365 chaperone protein DnaJ; Provisional 99.71
PRK14291382 chaperone protein DnaJ; Provisional 99.71
PRK14280376 chaperone protein DnaJ; Provisional 99.71
PRK14295389 chaperone protein DnaJ; Provisional 99.7
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.7
PRK10767371 chaperone protein DnaJ; Provisional 99.7
KOG0716|consensus279 99.7
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.69
PRK14283378 chaperone protein DnaJ; Provisional 99.69
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.69
PRK14300372 chaperone protein DnaJ; Provisional 99.68
KOG0719|consensus264 99.68
PRK14284391 chaperone protein DnaJ; Provisional 99.67
KOG0691|consensus296 99.67
PRK14289386 chaperone protein DnaJ; Provisional 99.67
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.66
KOG0718|consensus 546 99.65
PRK14293374 chaperone protein DnaJ; Provisional 99.64
PRK14292371 chaperone protein DnaJ; Provisional 99.64
KOG0715|consensus288 99.62
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.6
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.57
KOG0721|consensus230 99.55
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.51
KOG0624|consensus504 99.51
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.5
PHA03102153 Small T antigen; Reviewed 99.48
PRK01356166 hscB co-chaperone HscB; Provisional 99.47
PRK05014171 hscB co-chaperone HscB; Provisional 99.42
KOG0550|consensus486 99.41
KOG0714|consensus306 99.35
KOG0720|consensus490 99.33
PRK03578176 hscB co-chaperone HscB; Provisional 99.33
PRK00294173 hscB co-chaperone HscB; Provisional 99.32
KOG0722|consensus329 99.26
KOG2785|consensus 390 99.23
PTZ00100116 DnaJ chaperone protein; Provisional 99.13
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.11
PRK01773173 hscB co-chaperone HscB; Provisional 99.1
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.08
PHA02624 647 large T antigen; Provisional 99.02
KOG1150|consensus250 98.96
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.75
KOG0724|consensus335 98.64
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 98.56
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 98.31
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 98.17
KOG0568|consensus342 97.95
KOG1789|consensus 2235 97.95
KOG3408|consensus129 97.72
KOG0723|consensus112 97.7
PF0622038 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc fi 97.13
COG5112126 UFD2 U1-like Zn-finger-containing protein [General 96.91
KOG3192|consensus168 96.8
KOG0717|consensus 508 96.51
COG5188 470 PRP9 Splicing factor 3a, subunit 3 [RNA processing 96.44
KOG4727|consensus193 96.35
PLN02748468 tRNA dimethylallyltransferase 95.56
KOG0431|consensus453 95.45
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 95.42
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 94.1
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 93.86
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.44
KOG3454|consensus165 92.77
KOG3032|consensus 264 92.7
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.35
smart0058649 ZnF_DBF Zinc finger in DBF-like proteins. 91.95
PF0753549 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc 91.8
smart0035526 ZnF_C2H2 zinc finger. 91.08
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 90.45
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 90.43
KOG2837|consensus 309 89.42
KOG0227|consensus222 87.84
PHA0061644 hypothetical protein 86.19
PHA0276855 hypothetical protein; Provisional 85.35
KOG0150|consensus 336 83.96
COG5246222 PRP11 Splicing factor 3a, subunit 2 [RNA processin 83.95
PF1344662 RPT: A repeated domain in UCH-protein 83.42
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 82.72
>KOG0717|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.3e-75  Score=568.98  Aligned_cols=317  Identities=47%  Similarity=0.810  Sum_probs=263.5

Q ss_pred             CCCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHcCChhhhhhhhhchhhhhcCCCC--
Q psy6717           1 MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVFLRQDYD--   78 (373)
Q Consensus         1 m~d~Y~iLgv~~~as~~eIKkaYrkl~l~~HPDk~~~~~~~a~~~f~~I~~Ay~vLsd~~~R~~YD~~~~~~l~~~~~--   78 (373)
                      |+|||+||||..+|++.+||++||+|||+|||||||+..++|++.|+.|+.||+|||||+.|+|||+|+.+||.|..+  
T Consensus         7 ~~c~YE~L~v~~~a~d~eik~~YRklALq~HPDknpd~ieeat~~F~~i~aAYeVLSdp~eR~wyd~hreqil~~~~s~~   86 (508)
T KOG0717|consen    7 KRCYYEVLGVERDADDDEIKKNYRKLALQYHPDKNPDRIEEATQQFQLIQAAYEVLSDPQERAWYDSHREQILRGKNSDT   86 (508)
T ss_pred             hhHHHHHhcccccCCHHHHHHHHHHHHHhhCCCCCCccHHHHHHHHHHHHHHHHHhcChHhhhhHHHHHHHHhcCCCCcc
Confidence            689999999999999999999999999999999999999999999999999999999999999999999999998654  


Q ss_pred             CCCcccCCccccCCCCCCCCCCCcchhHhhHHHHHHHHHHHhhhhhcc-CCCCCCCCCCCChhHHHHHHHHHhhcCcccc
Q psy6717          79 ESDSIDLTPYFTASCYKGYGDGEKGFYSVYRDVFIKIAVEEMEFSEEE-MDIPNFGNSTSSYYNTVHNFYAFWQSFSTKK  157 (373)
Q Consensus        79 ~~~~~~~~~~f~~~~~~g~~~~~~gf~~~~~~~F~~~~~ee~~~~~~~-~~~P~fG~~~s~~~~~v~~FY~~W~~F~t~r  157 (373)
                      .....++++||+++||.||+++..|||.||++||..++.+++.|.... .-+|-||.++|+|+.++ .||.||..|+|.+
T Consensus        87 ~~~~~dlf~ff~~~~y~gy~~~~~gfy~vy~dvf~~~~~~e~~~~~d~~~~ap~fg~~~t~ye~~~-~fY~~W~afsT~K  165 (508)
T KOG0717|consen   87 GVQIEDLFQFFTSSCYIGYENTSAGFYRVYQDVFNALASDELPFLGDSKLLYPLFGYSTTDYEQVV-PFYQFWLAFSTKK  165 (508)
T ss_pred             ccchHHHHHHhhhhhhcccccccchhHHHHHHHHHHHhhhhhhhccCCccccccccCCCCcHHHHH-HHHHHHHhhhhhh
Confidence            344668899999999999999999999999999999999999997643 48999999999999987 9999999999999


Q ss_pred             ccccccccccCCCCCHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHhHHHHHHHH-HHHHHHHHHHHHHH
Q psy6717         158 TYSWLKAFDINMAPNRRVLRLIEKENKRIRDKAKKEYNDTVKNLVEFVRKKDKRVQNQALIKKQE-KEENALKLKERRRQ  236 (373)
Q Consensus       158 ~F~w~d~~~~~~a~~R~~rR~mekeN~k~r~~~kke~~~~ir~Lv~~~~k~DpRv~~~~~~~~~~-~~~~~~k~~~~r~~  236 (373)
                      +|+|+|+|++.+..+|..+|+|+++|+++|+.+|++||.+||.||.||+||||||++   .++.+ .+..+.++++.|++
T Consensus       166 sf~W~d~Ydv~~~~~r~~~R~v~~enkk~rq~ak~eyNe~Vr~lv~fvkKrDpRvk~---~l~~k~~E~~r~kqe~~Rk~  242 (508)
T KOG0717|consen  166 SFEWLDEYDVEEESDRFTRRLMERENKKQRQYARQEYNETVRNLVGFVKKRDPRVKA---MLELKDAEAYRSKQEESRKQ  242 (508)
T ss_pred             hHHhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCHHHHH---HHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999   23333 33333366677776


Q ss_pred             HHHHHHHHHhhhhh----hhhhhhhhhHHHHHhHHHHHhhhhcCCCCCCCCccCCCCcchhhh-ccCcccccchhhhccC
Q psy6717         237 QMIDRKKEMESMKE----NEWSKFSNLEKELKDIEASVAKEFGDEDSSYDDDSVGKSEDEYIE-ESSHLFCIACNKLFKT  311 (373)
Q Consensus       237 ~~~~~~~~a~e~~~----~~w~~~~~le~~~~~l~~~~~~ef~~~~~~~~~~~~~~~~~~~~~-~~~~~~C~~C~K~F~s  311 (373)
                      +.+.++..+..+.+    ..|+.+...       +.. .    +.+.+...      +.++.+ +.+.+||+||+|+|+|
T Consensus       243 ~~~~r~e~~e~r~n~~e~~~~~~~~e~-------ed~-~----e~~~d~~~------e~de~d~~ge~lyC~vCnKsFKs  304 (508)
T KOG0717|consen  243 QLRKRREYAETRKNNGEGSEEALKEEI-------EDE-L----EKSSDDET------ESDEADNEGEVLYCVVCNKSFKS  304 (508)
T ss_pred             HHHHHHHHHHHHHhcccchHHHHHHHH-------Hhh-h----hhccccch------hhhhhhhcCCceEEeeccccccc
Confidence            65544443333332    233322111       110 1    11111100      111222 2333999999999999


Q ss_pred             hHHHHHhhhhHHHHHHHHHHHHHHHHHh
Q psy6717         312 EKAFQNHENSKKHKENVAILKEQMLEEE  339 (373)
Q Consensus       312 ~~~~~nH~~SKkH~~~~~~~~~~~~~e~  339 (373)
                      ++|+.||++||||+++|..|+++|.+|+
T Consensus       305 eKq~kNHEnSKKHkenv~eLrqemEEEe  332 (508)
T KOG0717|consen  305 EKQLKNHENSKKHKENVAELRQEMEEEE  332 (508)
T ss_pred             hHHHHhhHHHHHHHHHHHHHHHHHHHhh
Confidence            9999999999999999999999998775

>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG3408|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>PF06220 zf-U1: U1 zinc finger; InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification] Back     alignment and domain information
>KOG4727|consensus Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3454|consensus Back     alignment and domain information
>KOG3032|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00586 ZnF_DBF Zinc finger in DBF-like proteins Back     alignment and domain information
>PF07535 zf-DBF: DBF zinc finger; InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG2837|consensus Back     alignment and domain information
>KOG0227|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG0150|consensus Back     alignment and domain information
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 5e-19
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 7e-17
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 3e-16
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-14
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-13
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-12
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-12
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-11
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-11
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-11
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 6e-11
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 5e-10
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 6e-10
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 7e-10
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-09
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-08
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 4e-08
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 2e-07
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-07
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 3e-06
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 6e-06
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 1e-05
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 2e-05
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 2e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 2e-04
1iur_A88 Dnaj Domain Of Human Kiaa0730 Protein Length = 88 7e-04
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 92.0 bits (227), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 56/67 (83%)
Query: 1  MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPH 60
          M  +YEVLGV  + + ED+KKAYRKLAL+WHPDKNP+N EEA+++F+L+ +AYEVLS+  
Sbjct: 8  MANYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSK 67
Query: 61 ERAFYDK 67
          +R+ YD+
Sbjct: 68 KRSLYDR 74
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|1IUR|A Chain A, Dnaj Domain Of Human Kiaa0730 Protein Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query373
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 5e-28
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 5e-27
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-26
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 3e-25
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-24
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-24
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 6e-24
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 7e-24
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 1e-23
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 2e-23
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-23
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 5e-23
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-22
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 3e-22
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 1e-21
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-21
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 2e-21
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 3e-21
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 4e-21
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 2e-20
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-18
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-17
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-15
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 5e-13
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 7e-12
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 9e-12
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-10
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 2e-09
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 3e-09
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 1e-08
2guz_A71 Mitochondrial import inner membrane translocase su 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 7e-07
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 4e-04
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
 Score =  104 bits (262), Expect = 5e-28
 Identities = 35/68 (51%), Positives = 54/68 (79%)

Query: 1  MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPH 60
          M  +YE+L VP + + +D+KKAYR+ AL+WHPDKNP+N E A+++F+ + +AYEVLS+ H
Sbjct: 1  MASYYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKH 60

Query: 61 ERAFYDKH 68
          +R  YD++
Sbjct: 61 KREIYDRY 68
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 402 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.83
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.82
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.81
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.79
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.79
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.79
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.78
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.78
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.77
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.77
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.77
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.77
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.76
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.76
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.75
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.74
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.7
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.68
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.67
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.64
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.63
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.63
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.63
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.61
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.59
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.58
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.57
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.56
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.55
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.55
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.53
2guz_A71 Mitochondrial import inner membrane translocase su 99.51
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.93
2guz_B65 Mitochondrial import inner membrane translocase su 98.63
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 98.22
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.75
4dgw_A402 PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A 97.22
3cw1_L77 U1 small nuclear ribonucleoprotein C; PRE-mRNA spl 96.93
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.73
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.6
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 92.19
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 91.83
1ard_A29 Yeast transcription factor ADR1; transcription reg 91.43
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 91.42
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 91.32
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 91.05
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 90.26
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 90.41
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 90.05
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 90.04
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 89.98
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 89.88
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.68
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 88.84
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 89.13
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.05
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.03
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.02
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.0
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 88.87
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.85
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 88.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 88.57
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.24
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 88.05
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.89
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.28
1paa_A30 Yeast transcription factor ADR1; transcription reg 87.23
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 87.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 86.96
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 86.93
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 86.9
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 86.82
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.81
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.73
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.64
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 86.61
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.58
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.55
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.52
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.51
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 86.36
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 86.28
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.27
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 86.27
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.19
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 86.19
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.08
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 86.07
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.99
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.96
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 85.95
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.93
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.91
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 85.9
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 85.83
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 85.82
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 85.78
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.76
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 85.61
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 85.56
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 85.55
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.55
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.55
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.5
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 85.4
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.39
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.36
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 85.35
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.34
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.32
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.31
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.3
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.3
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 85.28
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 85.21
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.2
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 85.08
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 85.07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.03
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 85.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.03
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 85.02
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 84.91
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.89
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.89
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.87
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.83
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 84.72
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.69
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 84.67
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.66
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 84.66
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.62
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.59
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.56
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.51
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.43
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 84.41
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 84.35
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.33
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 84.28
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 84.23
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.22
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.2
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.12
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 84.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 84.06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.97
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.92
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.85
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 83.84
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 83.82
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 83.79
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.61
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.57
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.5
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 83.5
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.46
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 83.37
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.34
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 83.29
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.27
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.94
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 82.93
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 82.89
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.81
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 82.7
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.66
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 82.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 82.13
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 82.04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 81.54
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 81.51
4f9c_B144 Protein DBF4 homolog A; Ser/Thr protein kinase, tr 80.76
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 80.75
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 80.53
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 80.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 80.11
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.83  E-value=6.1e-21  Score=149.93  Aligned_cols=72  Identities=54%  Similarity=0.850  Sum_probs=67.2

Q ss_pred             CCCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHcCChhhhhhhhhchhhh
Q psy6717           1 MKCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDVF   72 (373)
Q Consensus         1 m~d~Y~iLgv~~~as~~eIKkaYrkl~l~~HPDk~~~~~~~a~~~f~~I~~Ay~vLsd~~~R~~YD~~~~~~   72 (373)
                      |.+||+||||+++|+..+||+|||+|+++||||+++...+.+.+.|+.|+.||+||+||.+|..||..+...
T Consensus         8 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~~~   79 (82)
T 2ej7_A            8 MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGSGP   79 (82)
T ss_dssp             SCCHHHHTTCCTTCCHHHHHHHHHHHHTTSCTTTCSTTHHHHHHHHHHHHHHHHHHSSTTHHHHHHHTCCCS
T ss_pred             CcCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHHCCHHHHHHHHHcCccc
Confidence            579999999999999999999999999999999998876788999999999999999999999999986543
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>4dgw_A PRE-mRNA-splicing factor PRP9; zinc finger; 3.11A {Saccharomyces cerevisiae} Back     alignment and structure
>3cw1_L U1 small nuclear ribonucleoprotein C; PRE-mRNA splicing, spliceosome, RNA-binding domain, SM fold, finger, RNA recognition motif, 5' splice site; 5.49A {Homo sapiens} PDB: 1uw2_A 2vrd_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4f9c_B Protein DBF4 homolog A; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_B* 4f9b_B* 4f9a_B* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 373
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-14
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 7e-14
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-13
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 9e-13
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-12
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 8e-12
d1zr9a167 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 1e-11
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-10
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-05
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 66.5 bits (162), Expect = 2e-14
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 2  KCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNL--EEAKEQFQLIQQAYEVLSNP 59
          +  ++ +G+   V  E +KK YRK  L  HPDK       + AK  F  +  A+    N 
Sbjct: 33 ETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQ 92

Query: 60 HERAFY 65
           ++  Y
Sbjct: 93 GQKPLY 98
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query373
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.86
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.78
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.74
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.65
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.63
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.63
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.55
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 99.08
d1zu1a255 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 97.3
d1zu1a172 dsRNA-binding protein ZFa (ZNF346, JAZ) {African c 95.75
d2vrda161 Spliceosomal protein U1C {Human (Homo sapiens) [Ta 95.45
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.26
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 91.79
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.32
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 91.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 91.21
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 90.95
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.76
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 89.11
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 88.91
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 88.74
d2cota238 Zinc finger and SCAN domain-containing protein 16, 87.79
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 87.49
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 87.21
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.03
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 86.8
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 84.62
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 83.39
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 82.74
d1fu9a_36 U-shaped transcription factor, different fingers { 81.68
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 80.68
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.61
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 80.2
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=2.6e-22  Score=153.76  Aligned_cols=69  Identities=41%  Similarity=0.795  Sum_probs=64.4

Q ss_pred             CCchhhcCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHHcCChhhhhhhhhchhh
Q psy6717           2 KCHYEVLGVPLNVNDEDLKKAYRKLALKWHPDKNPNNLEEAKEQFQLIQQAYEVLSNPHERAFYDKHKDV   71 (373)
Q Consensus         2 ~d~Y~iLgv~~~as~~eIKkaYrkl~l~~HPDk~~~~~~~a~~~f~~I~~Ay~vLsd~~~R~~YD~~~~~   71 (373)
                      +|||+||||+++||..+||+|||++++++|||+++++ +.+...|..|++||+||+||.+|..||.+|..
T Consensus         3 ~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~-~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           3 QDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD-KEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT-CHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC-hHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            6999999999999999999999999999999999865 46788999999999999999999999998754
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu1a2 g.37.1.4 (A:74-128) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1zu1a1 g.37.1.4 (A:2-73) dsRNA-binding protein ZFa (ZNF346, JAZ) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2vrda1 g.37.1.4 (A:1-61) Spliceosomal protein U1C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure