Psyllid ID: psy6910

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140-----
GHKRPNKLDNLTAGGTHWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKTVNMGNSSDYELNDNNGRESPPSYYNPYIGQGLKEIDPLLELDLGPLPPRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKVKDSPGKRIAPQARNTLVSTSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVNAPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKTSPPFRSKTPTEMYTRPKEIVARRPKTPLVDTRSRSKTPTENYSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPISGDDASSTTSVSAASHREYEEGGEHDEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAPTDNAAGIYSSDTSSNYWSRAIS
cccccccccccccccccccccEEEEEEEccccccccEEEcccccccccEEEEEcccccccccccccccccEEEEEccEEcccccHHHHHHHHHHccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHcccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccccEEEEEccccccccEEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHccccccEEEEEEEEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEccccccccEEEEEccccccccccccEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEccccccccccEEEEEccccHHHHccccccccEEEEEccEEcccccHHHHHHHHHccccccEEEEEEEEccccccccccccccccEEEEEEccccccccEEEEccccccccEEEEcccccHHccccccccccEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEcccccccccEEEEEEccccHHccccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccccccc
cccccccccHHHHccccccccEEEEEEEccccccccEEEEcccccccccEEEEEccccEEEcccccccccEEEEEcccccccccHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEcccccccccEcccEEEccHHHHHHHHHcccEEEEEEEccEEEEEccccccccccccccHHccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEcccccccccccHHcccccccHHccccccccccEEcccccccEEEEEcccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEcccccccccEEEEEEccccccccccccccccEEEEEcccEcccccHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEcccccEEEEEEcccccccccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEcEccccccEEEEEEccccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccEEEEEEcccccccEEEEEccccccEEEEEEccccHHHHHccccccEEEEEEccEEcccccHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEcccccccccEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccccccc
ghkrpnkldnltaggthwqdketpvtltvppdgslnfsvgggsdsgefAYVTNINKEKVKGAEKYLEEKAIILEIQGqkvagytrrDTIAWLNHCcrsgktltlrtVSSAYVTTDLRQFLntrfpkgsvdhdlqniirdnlylrtvpvttrtprdgelngvdytFLSIEEFKQLEKSGcllesglyegnhygtpkpvkepyvslpqnvnllpgahpssegkrkrnrsnveamasksiepdmktngfdnktvnmgnssdyelndnngresppsyynpyigqglkeidplleldlgplpprwekaytekGEVYFIdhnsstsswldprlCKFQkkledcsddelpygweriddpaygtyyIDHVnkqtqyenpvlqakhrdqgagpsemddnehkvkdspgkriapqarntlvstsnrsnndenyfftlnpdeliGERIHSSLVKSLRGlgftivggddskeEFLQIKsvvpngpaaleghlqtgDVLVYVNdkcvlgythhdmvsvfqsispgetvqlevcrgyplpfdpndpntevVTTVavnapdldngsdrhlymsandftdqsvksmpdlytsekmvklerpsstdlilesdseyltipivkgamgfgftiadsshgqkVKKILDRQrcknlaegdiLIEInnlnvrnmCHGEVVQVLKDCQRNLEANIIVQRSrlqhkktsppfrsktptemytrpkeivarrpktplvdtrsrsktptenysEYYINkelkdldinkniwdpqttnpgfmqsnysdsmsycggynvyqvnkrkestsfeheqplpsndmryippdnlglprvrptniksveYSDVMVITLLRQengfgfrivggteegsqvsighivpggaadldgrlctgdeivsvdnlsvlnsSHHHVVELMGKASVYGRVTLgirrkvmppaettsmmlgypydvtitrrenegFGFVIISSLNKagstigriiedspadrsgelhlgdhilavNHVDIMSLHHGEIVNLIKDsgycvtltigapisgddassttsvsaashreyeeggehdeQYHAIElsrgtrgfgfsirggreFQNMALFVLQIAengpaaldghlkvGDEIVeingintknmtHAEAIEIIRNGDSTVRLLIKrggsvvaptdnaagiyssdtssnywSRAIS
ghkrpnkldnltaggthwqdketpVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILeiqgqkvagyTRRDTIAWLNHCCRsgktltlrtvSSAYVTTDLRQFLNtrfpkgsvdhdlqniirdnlylrtvpvttrtprdgelngVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLpgahpssegkrkrnrsnveamasksiepdmktngfdnKTVNMGNSSDYELNDNNGRESPPSYYNPYIGQGLKEIDPLLELDLGPLPPRWEKAYTEKGEVYFIDHnsstsswldpRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKvkdspgkriapqarntlvstsnrsnndenYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVNAPDLDNGSDRHLYMSAndftdqsvkSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIvqrsrlqhkktsppfrsktptemytrpkeivarrpktplvdtrsrsktptenyseyyiNKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTsfeheqplpsndmryiPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKvmppaettsmmlgYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIgapisgddassTTSVSAASHREYEEGGEHDEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRggsvvaptdnaagiyssdtssnywsrais
GHKRPNKLDNLTAGGTHWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLrtvpvttrtprDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKTVNMGNSSDYELNDNNGRESPPSYYNPYIGQGLKEIdplleldlgplppRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKVKDSPGKRIAPQARNTLVSTSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPntevvttvavnaPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKTSPPFRSKTPTEMYTRPKEIVARRPKTPLVDTRSRSKTPTENYSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIvsvdnlsvlnssHHHVVELMGKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPISGDDassttsvsaasHREYEEGGEHDEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAPTDNAAGIYSSDTSSNYWSRAIS
*************************************************YVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGT*******************************************************************************YYNPYIGQGLKEIDPLLELDLGPLPPRWEKAYTEKGEVYFI*************LCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQT*******************************************************NYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVN**********************************************LILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQ**************************************************YSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQV****************************GLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIED******GELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPI*****************************HAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAPTDNAAGIY**************
**********************TPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVS***********************************************************************************************************************************************************************************************************************************************************************************************************************************LIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYP****************************************************************************IPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQ******************************************************YIN***********************************************************************************EYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVT***************************************************IIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVT**************************************IELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKR*****************************
GHKRPNKLDNLTAGGTHWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLPGA****************AMASKSIEPDMKTNGFDNKTVNMGNSSDYELNDNNGRESPPSYYNPYIGQGLKEIDPLLELDLGPLPPRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQA***********************GKRIAPQARNTLVSTSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVNAPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADS********ILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRS*************KTPTEMYTRPKEIVARR***************TENYSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPISG***********************DEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAPTDNAAGIYSSDTSSNYWSRAIS
********DNLT*GGTHWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQN***L*************************************************************************IDPLLELDLGPLPPRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHR**********************************************FTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPL********************************************************************SDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRS*****************************************************************************************************************************************VEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRK************GYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPI*************************DEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGG***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GHKRPNKLDNLTAGGTHWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKTVNMGNSSDYELNDNNGRESPPSYYNPYIGQGLKEIDPLLELDLGPLPPRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKVKDSPGKRIAPQARNTLVSTSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVNAPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKTSPPFRSKTPTEMYTRPKEIVARRPKTPLVDTRSRSKTPTENYSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPISGDDASSTTSVSAASHREYEEGGEHDEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAPTDNAAGIYSSDTSSNYWSRAIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1145 2.2.26 [Sep-21-2011]
Q9WVQ1 1275 Membrane-associated guany yes N/A 0.800 0.719 0.397 0.0
O88382 1277 Membrane-associated guany yes N/A 0.788 0.707 0.402 0.0
Q86UL8 1455 Membrane-associated guany yes N/A 0.801 0.630 0.398 0.0
Q6RHR9 1471 Membrane-associated guany no N/A 0.577 0.449 0.416 1e-141
Q4L1J41255 Membrane-associated guany no N/A 0.579 0.528 0.409 1e-139
Q96QZ7 1491 Membrane-associated guany no N/A 0.575 0.441 0.409 1e-138
Q9EQJ9 1476 Membrane-associated guany no N/A 0.544 0.422 0.408 1e-129
Q5F4881128 Membrane-associated guany no N/A 0.593 0.601 0.389 1e-129
Q9JK71 1470 Membrane-associated guany no N/A 0.544 0.423 0.408 1e-128
A1A5G41107 Membrane-associated guany no N/A 0.538 0.557 0.416 1e-127
>sp|Q9WVQ1|MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus GN=Magi2 PE=1 SV=2 Back     alignment and function desciption
 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1098 (39%), Positives = 592/1098 (53%), Gaps = 181/1098 (16%)

Query: 16   THWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKV--KGAEKYLEEKAIIL 73
            +HW  K     +   P+G L F + GG+++G+F Y+  +   KV  +   K + E+ ++L
Sbjct: 9    SHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEE-LLL 67

Query: 74   EIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSA-YVTTDLRQFLNTRFPKGSVDHD 132
            E+    VAG T RD +A + HC      L L+ V     V  DLR +LN RF KGSVDH+
Sbjct: 68   EVNETPVAGLTIRDVLAVIKHC---KDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHE 124

Query: 133  LQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYG 192
            LQ IIRDNLYLRTVP TTR  ++GE+ GVDY F+++EEF +LEKSG LLESG YE N+YG
Sbjct: 125  LQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYEDNYYG 184

Query: 193  TPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMK-------TNG 245
            TPKP  EP   L     +LPGA PS+EGKRKRN+S V  M   SIEP  +        NG
Sbjct: 185  TPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKS-VTNMEKASIEPPEEEEEERPVVNG 243

Query: 246  FDNKTVNMGNSSDYELNDNNGRESPPS--YYNPYIGQ---------GLKEIDPLLELDLG 294
              N  V    SS++E          PS  Y  P   Q           K   P    D  
Sbjct: 244  --NGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKPTKPEENEDSD 301

Query: 295  PLPPRWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAY 354
            PLP  WE AYTEKGEVYFIDHN+ T+SWLDPRL K  K  E+C ++ELPYGWE+IDDP Y
Sbjct: 302  PLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIY 361

Query: 355  GTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKVK--DSPGKRIAPQARNTLVS 412
            GTYY+DH+N++TQ+ENPVL+AK + Q      M   E   K   +PG R  P        
Sbjct: 362  GTYYVDHINRRTQFENPVLEAKRKLQQ---HNMPHTELGAKPLQAPGFREKP-------- 410

Query: 413  TSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNG 472
                        FT +  +L G  + ++L KS  G GFTI+GGD+  +EFLQ+KSV+P+G
Sbjct: 411  -----------LFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEP-DEFLQVKSVIPDG 458

Query: 473  PAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDP 532
            PAA +G ++TGDV+VY+N+ CVLG+TH D+V +FQS+  G++V L +CRGYPLPFDP DP
Sbjct: 459  PAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDP 518

Query: 533  NTEVVTTVAV---NAPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTD 589
               +V  +A+     P + NG  RH Y +  ++  ++ +S+PD+           P+   
Sbjct: 519  ANSMVPPLAIMERPPPVMVNG--RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQ 576

Query: 590  L-----------------ILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRC 632
            L                    + +E +T+ IVKGA GFGFTIADS  GQ+VK+ILD Q C
Sbjct: 577  LDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGC 636

Query: 633  KNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKTSPPFRSKT 692
              L EGD+++EIN  NV+N+ H EVV +LKDC    E ++I+ R        SP    KT
Sbjct: 637  PGLCEGDLIVEINQQNVQNLSHTEVVDILKDCPVGSETSLIIHRGGF----FSP---WKT 689

Query: 693  PTEMYTRPKEIVARRPKTPLVDTRSRSKTPTENYSEYYINKELKDLDINKNIWDPQTTNP 752
            P                 P++D      +P  + S   + + L                P
Sbjct: 690  P----------------KPMMDRWENQGSPQTSLSAPAVPQNL-------------PFPP 720

Query: 753  GFMQSNYSDSMSYCGGY--NVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPT 810
               +S++ DS         + Y++ ++  +     +Q  P    R    D+ G       
Sbjct: 721  ALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRM---DSSG------- 770

Query: 811  NIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEIV 870
                 +Y ++ V  L R E+GFGFRI+GG E G  + IG ++  G+AD DGRL  GDE+V
Sbjct: 771  ----PDYKELDV-HLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELV 825

Query: 871  SVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVM----------------------- 907
             VD + V   +H +V++LM  A+  G+V L +RRKV+                       
Sbjct: 826  YVDGIPVAGKTHRYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSP 885

Query: 908  -------------PPAETTSMMLGYP------YDVTITRRENEGFGFVIISSLNK--AGS 946
                          P+   S   G+        DV I R+ENEGFGFVIISSLN+  +G+
Sbjct: 886  RSDYATYSNSNHAAPSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGA 945

Query: 947  T------IGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTI 1000
            T      IGRII+ SPADR  +L +GD ILAVN   I+++ H +IV LIKD+G  VTL I
Sbjct: 946  TITVPHKIGRIIDGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRI 1005

Query: 1001 GAPISGDDASSTTSVSAA 1018
               I  ++ +S TS  ++
Sbjct: 1006 ---IPQEELNSPTSAPSS 1020
Seems to act as scaffold molecule at synaptic junctions by assembling neurotransmitter receptors and cell adhesion proteins. May play a role in regulating activin-mediated signaling in neuronal cells. Enhances the ability of PTEN to suppress AKT1 activation.
Mus musculus (taxid: 10090)
>sp|O88382|MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus GN=Magi2 PE=1 SV=1 Back     alignment and function description
>sp|Q86UL8|MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens GN=MAGI2 PE=1 SV=3 Back     alignment and function description
>sp|Q6RHR9|MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus GN=Magi1 PE=1 SV=1 Back     alignment and function description
>sp|Q4L1J4|MAGI1_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Rattus norvegicus GN=Magi1 PE=1 SV=1 Back     alignment and function description
>sp|Q96QZ7|MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens GN=MAGI1 PE=1 SV=3 Back     alignment and function description
>sp|Q9EQJ9|MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus GN=Magi3 PE=1 SV=2 Back     alignment and function description
>sp|Q5F488|MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus GN=MAGI3 PE=2 SV=1 Back     alignment and function description
>sp|Q9JK71|MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus GN=Magi3 PE=1 SV=2 Back     alignment and function description
>sp|A1A5G4|MAGI3_XENTR Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Xenopus tropicalis GN=magi3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1145
2420049801082 conserved hypothetical protein [Pediculu 0.857 0.907 0.547 0.0
3504252161010 PREDICTED: membrane-associated guanylate 0.727 0.824 0.534 0.0
3407092011010 PREDICTED: membrane-associated guanylate 0.727 0.824 0.533 0.0
3287922501010 PREDICTED: membrane-associated guanylate 0.721 0.817 0.536 0.0
3838648171009 PREDICTED: membrane-associated guanylate 0.727 0.825 0.531 0.0
328721990950 PREDICTED: membrane-associated guanylate 0.725 0.874 0.576 0.0
328721992966 PREDICTED: membrane-associated guanylate 0.705 0.836 0.584 0.0
3071945131006 Membrane-associated guanylate kinase, WW 0.711 0.810 0.525 0.0
3071827051004 Membrane-associated guanylate kinase, WW 0.711 0.811 0.523 0.0
3320231851061 Membrane-associated guanylate kinase, WW 0.705 0.761 0.53 0.0
>gi|242004980|ref|XP_002423353.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506383|gb|EEB10615.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1182 (54%), Positives = 783/1182 (66%), Gaps = 200/1182 (16%)

Query: 18   WQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQG 77
            W+  E  V L    +G+LNFS+ GGSD+GEFA V ++N+ K+      L E  IILE+QG
Sbjct: 24   WRRFENEVILAANENGTLNFSIEGGSDNGEFARVCDLNQSKINCKSGKLCEGDIILEVQG 83

Query: 78   QKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNII 137
            QKVAGYT+RD +AWLNHCC++G  + L+T+ S ++T DLR+FLNTRF KGS +HDLQNII
Sbjct: 84   QKVAGYTQRDVVAWLNHCCKNGNPVVLKTIPSGHITKDLREFLNTRFQKGSDNHDLQNII 143

Query: 138  RDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPV 197
            RDNLYLRTVPVTTR PR+GE+NG+DYTFL++EEF  L++SG LLESG++EGNHYGTPKP 
Sbjct: 144  RDNLYLRTVPVTTREPREGEINGLDYTFLTLEEFMVLDQSGNLLESGIFEGNHYGTPKPS 203

Query: 198  KEPYVSLPQ----NVNL---LPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKT 250
            KEP  S+PQ    N NL   +PGAHPSSEGKRKRNRSNVEAM+SK++EP          +
Sbjct: 204  KEPPTSIPQGNEANTNLNWFMPGAHPSSEGKRKRNRSNVEAMSSKNLEP---------PS 254

Query: 251  VNMGNSSDYELNDNNGRESPPSYYNPYIGQ--GLKEIDPLLELDLGPLPPRWEKAYTEKG 308
            V +  SS   ++D++   +  +   P +      +E       DLGPLP  WEKA+TEKG
Sbjct: 255  VEI-YSSATSVHDSSIPSTASTIRTPPLPNRDSSEESHNDFSSDLGPLPSNWEKAFTEKG 313

Query: 309  EVYFIDHNSSTSSWLDPRLCKFQKK-LEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQ 367
            E+YFIDHN+ TS WLDPRL KFQKK LE+C DDELPYGWE+I+DP    +Y +H  KQ  
Sbjct: 314  EIYFIDHNTGTSHWLDPRLSKFQKKSLEECLDDELPYGWEKIEDP----HYDEHPPKQNN 369

Query: 368  YENPVLQAKHRDQGAGPSEMDDNEHKVKDSPGKRIAPQARNTLVSTSNRSNNDENYFFTL 427
             E P                       K  PG                     E  FFT 
Sbjct: 370  LEPP-----------------------KHPPGSNFE----------------FEQPFFTK 390

Query: 428  NPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTGDVLV 487
            NP +L GER+ + L+KS RGLGFTIVGGD++ EEFLQIKSVVPNGPA L+G L+TGDVLV
Sbjct: 391  NPSKLQGERLTTVLIKSSRGLGFTIVGGDENVEEFLQIKSVVPNGPAWLDGKLKTGDVLV 450

Query: 488  YVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTVAVNAPD- 546
            YVN+ CVLG+THHDMVSVFQSISPGETV+L+VCRGYPLPFDPNDPNTEVVTT+AV+A D 
Sbjct: 451  YVNETCVLGFTHHDMVSVFQSISPGETVKLDVCRGYPLPFDPNDPNTEVVTTIAVSAHDS 510

Query: 547  ----LDNGSDR------------------HLYMSANDFTDQSVKSMPDLYTSEKMVKLER 584
                 DN  D                   H+   ++D  + SVKSMPDL +SE     + 
Sbjct: 511  IIGETDNYLDEDICGKIPENLFKSLVDSNHVRSGSDDILNNSVKSMPDLCSSEAEFFNDP 570

Query: 585  PSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKNLAEGDILIEI 644
            P+     +    E+L+I IVKG MGFGFTIADS++GQKVKKILD+ RCKNL EGDIL++I
Sbjct: 571  PA-----IPEKPEFLSISIVKGPMGFGFTIADSAYGQKVKKILDKLRCKNLMEGDILVKI 625

Query: 645  NNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKT---------SPP----FRSK 691
            N+ NVRNMCH EVVQVLKDC++N EA + VQR      K+           P    +RSK
Sbjct: 626  NSSNVRNMCHSEVVQVLKDCEKNQEAMVTVQRGSSSPTKSRTRKNDFTLQAPGIGLYRSK 685

Query: 692  TPT-EMY-TRPKEIVARRPKTPLVDTRSRSKTPTENYSEYYINKELKDLDINKNIWDPQT 749
            TPT ++Y T+ KEI+  RPKTP+VDTR RSKTP  N                        
Sbjct: 686  TPTADLYSTQQKEIMPNRPKTPIVDTRYRSKTPIFN------------------------ 721

Query: 750  TNPGFMQSNYSDSMSYCGGYNVYQVNKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRP 809
                   SN++D        N Y+                       +PP + G  R+  
Sbjct: 722  -------SNWADMK-----LNAYK-----------------------LPPISQGNGRMF- 745

Query: 810  TNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLCTGDEI 869
            T   + EY +  V++L+RQE GFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRL TGDEI
Sbjct: 746  TGTSNYEYLET-VVSLVRQETGFGFRIVGGTEEGSQVSIGHIVPGGAADLDGRLHTGDEI 804

Query: 870  VSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAE------TTSMMLGYPYDV 923
            +SVD  SV+N SHHHVV+LMGKA+V G VT+GIRR++    E      TTS    YPY V
Sbjct: 805  ISVDGQSVINVSHHHVVQLMGKAAVNGAVTIGIRRRIPIQQEIQHNAGTTST---YPYHV 861

Query: 924  TITRRENEGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHG 983
            T+TRRE+EGFGFVIISSLN+ GSTIGRII+ SPA+R G+LH+GDHILAVNH+DI+SLHHG
Sbjct: 862  TVTRREDEGFGFVIISSLNRCGSTIGRIIKGSPAERCGQLHVGDHILAVNHMDIISLHHG 921

Query: 984  EIVNLIKDSGYCVTLTIGAPISGDDASSTTSVSAASHREYEEGGEHD------------- 1030
            +IVNLIKDSGY VTLTIG P+  DD SS  S     H   E G E D             
Sbjct: 922  DIVNLIKDSGYSVTLTIGPPL--DDNSSNASQRVNKHNISESGVEDDPYLVNRPYGYSTR 979

Query: 1031 ---------EQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGD 1081
                     +QYHA+EL+RG+RGFGFSIRGG+EFQNM L+VLQIAENGPAA++  LK+GD
Sbjct: 980  ASKDGNGLEDQYHAVELNRGSRGFGFSIRGGKEFQNMPLYVLQIAENGPAAVNDKLKIGD 1039

Query: 1082 EIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGGSVVAP 1123
            +I+EINGINTKNMTHAEAIEIIR G  +VRLL++RG  V  P
Sbjct: 1040 QIIEINGINTKNMTHAEAIEIIRKGGPSVRLLVRRGEKVPPP 1081

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350425216|ref|XP_003494049.1| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709201|ref|XP_003393200.1| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328792250|ref|XP_393571.4| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383864817|ref|XP_003707874.1| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328721990|ref|XP_003247451.1| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328721992|ref|XP_003247452.1| PREDICTED: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307194513|gb|EFN76805.1| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307182705|gb|EFN69829.1| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023185|gb|EGI63441.1| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1145
MGI|MGI:1354953 1275 Magi2 "membrane associated gua 0.551 0.494 0.435 4e-202
RGD|621855 1277 Magi2 "membrane associated gua 0.356 0.319 0.420 1.4e-198
UNIPROTKB|O88382 1277 Magi2 "Membrane-associated gua 0.356 0.319 0.420 1.4e-198
UNIPROTKB|Q86UL8 1455 MAGI2 "Membrane-associated gua 0.356 0.280 0.422 6.8e-197
MGI|MGI:1203522 1471 Magi1 "membrane associated gua 0.303 0.236 0.434 3.4e-194
RGD|15860251255 Magi1 "membrane associated gua 0.303 0.277 0.426 8.6e-191
UNIPROTKB|Q96QZ7 1491 MAGI1 "Membrane-associated gua 0.303 0.233 0.420 8e-189
UNIPROTKB|Q5TCQ9 1506 MAGI3 "Membrane-associated gua 0.577 0.438 0.377 3.5e-172
UNIPROTKB|F1SBQ7 1468 MAGI3 "Uncharacterized protein 0.357 0.278 0.394 4.2e-171
UNIPROTKB|E1BM96 1474 MAGI3 "Uncharacterized protein 0.355 0.276 0.388 7.6e-168
MGI|MGI:1354953 Magi2 "membrane associated guanylate kinase, WW and PDZ domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 1303 (463.7 bits), Expect = 4.0e-202, Sum P(5) = 4.0e-202
 Identities = 306/702 (43%), Positives = 407/702 (57%)

Query:    16 THWQDKETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKV--KGAEKYLEEKAIIL 73
             +HW  K     +   P+G L F + GG+++G+F Y+  +   KV  +   K + E+ ++L
Sbjct:     9 SHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEE-LLL 67

Query:    74 EIQGQKVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSA-YVTTDLRQFLNTRFPKGSVDHD 132
             E+    VAG T RD +A + HC      L L+ V     V  DLR +LN RF KGSVDH+
Sbjct:    68 EVNETPVAGLTIRDVLAVIKHC---KDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHE 124

Query:   133 LQNIIRDNLYLXXXXXXXXXXXDGELNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYG 192
             LQ IIRDNLYL           +GE+ GVDY F+++EEF +LEKSG LLESG YE N+YG
Sbjct:   125 LQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYEDNYYG 184

Query:   193 TPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMK-------TNG 245
             TPKP  EP   L     +LPGA PS+EGKRKRN+S V  M   SIEP  +        NG
Sbjct:   185 TPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKS-VTNMEKASIEPPEEEEEERPVVNG 243

Query:   246 FDNKTVNMGNSSDYELNDNNGRESPPS--YYNPYIGQG--LKEIXXXXXXXXXXXXX--- 298
               N  V    SS++E          PS  Y  P   Q   LK+                 
Sbjct:   244 --NGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKPTKPEENEDSD 301

Query:   299 ----RWEKAYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAY 354
                  WE AYTEKGEVYFIDHN+ T+SWLDPRL K  K  E+C ++ELPYGWE+IDDP Y
Sbjct:   302 PLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDPIY 361

Query:   355 GTYYIDHVNKQTQYENPVLQAKHRDQGAGPSEMDDNEHKVKDSPGKRIAPQARNTLVSTS 414
             GTYY+DH+N++TQ+ENPVL+AK + Q      M   E   K  P +  AP  R       
Sbjct:   362 GTYYVDHINRRTQFENPVLEAKRKLQ---QHNMPHTELGAK--PLQ--APGFR------- 407

Query:   415 NRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPA 474
                   E   FT +  +L G  + ++L KS  G GFTI+GGD+  +EFLQ+KSV+P+GPA
Sbjct:   408 ------EKPLFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEP-DEFLQVKSVIPDGPA 460

Query:   475 ALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPXX 534
             A +G ++TGDV+VY+N+ CVLG+TH D+V +FQS+  G++V L +CRGYPLPFDP DP  
Sbjct:   461 AQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPAN 520

Query:   535 XXXXXXXXXX---PDLDNGSDRHLYMSANDFTDQSVKSMPDL-----YTSEKMV---KLE 583
                          P + NG  RH Y +  ++  ++ +S+PD+     ++   M    +L+
Sbjct:   521 SMVPPLAIMERPPPVMVNG--RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLD 578

Query:   584 R----PSSTDLILESDS-----EYLTIPIVKGAMGFGFTIADSSHGQKVKKILDRQRCKN 634
                  P   D +  + S     E +T+ IVKGA GFGFTIADS  GQ+VK+ILD Q C  
Sbjct:   579 GTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPG 638

Query:   635 LAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQR 676
             L EGD+++EIN  NV+N+ H EVV +LKDC    E ++I+ R
Sbjct:   639 LCEGDLIVEINQQNVQNLSHTEVVDILKDCPVGSETSLIIHR 680
GO:0002092 "positive regulation of receptor internalization" evidence=ISO
GO:0004871 "signal transducer activity" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO;IDA
GO:0005886 "plasma membrane" evidence=ISO;IDA
GO:0005923 "tight junction" evidence=ISO
GO:0007165 "signal transduction" evidence=IPI
GO:0008285 "negative regulation of cell proliferation" evidence=ISO
GO:0014069 "postsynaptic density" evidence=ISO
GO:0016020 "membrane" evidence=IEA
GO:0019902 "phosphatase binding" evidence=ISO
GO:0030054 "cell junction" evidence=IEA
GO:0030159 "receptor signaling complex scaffold activity" evidence=ISO;NAS
GO:0030165 "PDZ domain binding" evidence=ISO
GO:0030336 "negative regulation of cell migration" evidence=ISO
GO:0031697 "beta-1 adrenergic receptor binding" evidence=ISO
GO:0032403 "protein complex binding" evidence=ISO
GO:0032516 "positive regulation of phosphoprotein phosphatase activity" evidence=ISO
GO:0032926 "negative regulation of activin receptor signaling pathway" evidence=IDA
GO:0036057 "slit diaphragm" evidence=ISO
GO:0043005 "neuron projection" evidence=IEA
GO:0043113 "receptor clustering" evidence=ISO
GO:0043234 "protein complex" evidence=ISO
GO:0045202 "synapse" evidence=ISO
GO:0046332 "SMAD binding" evidence=IPI
GO:0048471 "perinuclear region of cytoplasm" evidence=ISO
GO:0051291 "protein heterooligomerization" evidence=ISO
GO:0051898 "negative regulation of protein kinase B signaling cascade" evidence=ISO
GO:0060395 "SMAD protein signal transduction" evidence=IDA
GO:0070699 "type II activin receptor binding" evidence=IPI
GO:0071850 "mitotic cell cycle arrest" evidence=ISO
RGD|621855 Magi2 "membrane associated guanylate kinase, WW and PDZ domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O88382 Magi2 "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q86UL8 MAGI2 "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1203522 Magi1 "membrane associated guanylate kinase, WW and PDZ domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1586025 Magi1 "membrane associated guanylate kinase, WW and PDZ domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96QZ7 MAGI1 "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TCQ9 MAGI3 "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBQ7 MAGI3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BM96 MAGI3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86UL8MAGI2_HUMANNo assigned EC number0.39890.80170.6309yesN/A
Q9WVQ1MAGI2_MOUSENo assigned EC number0.39700.80080.7192yesN/A
O88382MAGI2_RATNo assigned EC number0.40270.78860.7071yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.4LOW CONFIDENCE prediction!
4th Layer2.7.4.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1145
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 6e-23
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 6e-22
smart00072174 smart00072, GuKc, Guanylate kinase homologues 2e-19
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 5e-18
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-16
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 1e-16
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-16
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 3e-16
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 3e-16
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-15
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 1e-14
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 2e-14
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 7e-14
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-13
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 4e-12
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 5e-10
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 7e-10
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 3e-09
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-09
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 4e-09
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 7e-09
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-08
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 3e-08
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 4e-08
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-08
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 1e-07
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 2e-07
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 4e-07
pfam0039730 pfam00397, WW, WW domain 1e-06
smart0045633 smart00456, WW, Domain with 2 conserved Trp (W) re 2e-06
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 2e-06
cd0020131 cd00201, WW, Two conserved tryptophans domain; als 3e-06
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 3e-06
pfam0039730 pfam00397, WW, WW domain 4e-06
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 1e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 1e-05
pfam1318081 pfam13180, PDZ_2, PDZ domain 2e-05
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 4e-05
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 5e-05
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 9e-05
cd0099179 cd00991, PDZ_archaeal_metalloprotease, PDZ domain 1e-04
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 2e-04
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 0.001
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 0.001
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.001
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 0.002
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 0.003
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.004
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information 
 Score = 93.6 bits (233), Expect = 6e-23
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 2/83 (2%)

Query: 1036 IELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMT 1095
            +EL +G  G GFS+ GG++ +   + V  +    PAA  G L+VGD I+E+NG + + +T
Sbjct: 5    VELEKGGGGLGFSLVGGKD-EGGGVVVSSVVPGSPAAKAG-LRVGDVILEVNGTSVEGLT 62

Query: 1096 HAEAIEIIRNGDSTVRLLIKRGG 1118
            H EA+++++     V L + RGG
Sbjct: 63   HLEAVDLLKKAGGKVTLTVLRGG 85

Also called DHR (Dlg homologous region) or GLGF (relatively well conserved tetrapeptide in these domains). Some PDZs have been shown to bind C-terminal polypeptides; others appear to bind internal (non-C-terminal) polypeptides. Different PDZs possess different binding specificities. Length = 85
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|215899 pfam00397, WW, WW domain Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238491 cd00991, PDZ_archaeal_metalloprotease, PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1145
KOG3209|consensus984 100.0
KOG3209|consensus 984 100.0
KOG0609|consensus542 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 100.0
KOG3580|consensus 1027 99.97
PRK14737186 gmk guanylate kinase; Provisional 99.96
PLN02772398 guanylate kinase 99.94
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.93
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.93
KOG3580|consensus 1027 99.9
PRK14738206 gmk guanylate kinase; Provisional 99.88
KOG0707|consensus231 99.88
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.75
PRK00300205 gmk guanylate kinase; Provisional 99.72
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.7
KOG1891|consensus271 99.59
COG3709192 Uncharacterized component of phosphonate metabolis 99.53
KOG3605|consensus829 99.4
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.37
KOG3550|consensus207 99.36
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.34
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.33
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.32
KOG3605|consensus829 99.29
KOG3552|consensus 1298 99.29
PRK10139455 serine endoprotease; Provisional 99.29
PRK10942473 serine endoprotease; Provisional 99.28
KOG3550|consensus207 99.26
PRK10779 449 zinc metallopeptidase RseP; Provisional 99.26
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.24
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 99.18
PRK10139455 serine endoprotease; Provisional 99.17
KOG3549|consensus505 99.16
PRK10942473 serine endoprotease; Provisional 99.14
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 99.11
PRK10779449 zinc metallopeptidase RseP; Provisional 99.08
KOG3551|consensus506 99.04
KOG3549|consensus 505 98.99
KOG1892|consensus1629 98.95
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.89
KOG0708|consensus359 98.87
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.82
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.8
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.77
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.77
KOG3553|consensus124 98.76
KOG3606|consensus358 98.72
KOG3551|consensus 506 98.71
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.71
PRK08356195 hypothetical protein; Provisional 98.69
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.67
KOG3651|consensus429 98.65
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.64
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.63
KOG3553|consensus124 98.59
KOG3571|consensus626 98.58
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.56
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.5
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.49
KOG1892|consensus 1629 98.46
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.38
KOG1891|consensus271 98.36
KOG3651|consensus429 98.35
PF0039731 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp 98.34
KOG1421|consensus955 98.33
cd0020131 WW Two conserved tryptophans domain; also known as 98.28
KOG3938|consensus334 98.26
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.25
KOG3571|consensus 626 98.23
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.21
smart0045632 WW Domain with 2 conserved Trp (W) residues. Also 98.15
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.14
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.11
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.09
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.07
KOG3606|consensus358 98.04
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.01
KOG4371|consensus1332 98.0
cd0020131 WW Two conserved tryptophans domain; also known as 97.98
PRK11186667 carboxy-terminal protease; Provisional 97.95
KOG4371|consensus1332 97.95
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.94
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.93
KOG3552|consensus 1298 97.93
COG5104590 PRP40 Splicing factor [RNA processing and modifica 97.92
PLN00049389 carboxyl-terminal processing protease; Provisional 97.91
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.89
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.88
KOG3938|consensus334 97.8
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.79
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.76
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 97.75
PLN00049 389 carboxyl-terminal processing protease; Provisional 97.73
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 97.72
KOG3542|consensus1283 97.71
KOG3542|consensus 1283 97.7
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.56
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.49
KOG3259|consensus163 97.46
KOG0609|consensus 542 97.43
PRK11186 667 carboxy-terminal protease; Provisional 97.42
KOG0940|consensus358 97.36
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.23
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.18
KOG3834|consensus 462 97.16
PRK10898353 serine endoprotease; Provisional 97.14
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.06
PRK10898353 serine endoprotease; Provisional 97.02
KOG3834|consensus 462 96.96
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.85
KOG0606|consensus 1205 96.56
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 96.56
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.55
KOG3259|consensus163 96.54
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.46
KOG4407|consensus 1973 96.41
PRK09681276 putative type II secretion protein GspC; Provision 96.38
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.29
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.23
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 96.21
KOG4407|consensus 1973 96.16
KOG0606|consensus1205 96.13
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.01
KOG1421|consensus 955 95.75
KOG3129|consensus231 95.72
KOG1320|consensus473 95.6
KOG0155|consensus617 95.59
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 95.59
COG3480342 SdrC Predicted secreted protein containing a PDZ d 95.55
COG3031275 PulC Type II secretory pathway, component PulC [In 95.24
KOG3129|consensus231 95.1
PRK00098298 GTPase RsgA; Reviewed 95.06
COG3975558 Predicted protease with the C-terminal PDZ domain 95.03
KOG1738|consensus638 94.91
KOG3532|consensus 1051 94.89
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 94.7
PRK09681276 putative type II secretion protein GspC; Provision 94.48
COG0265347 DegQ Trypsin-like serine proteases, typically peri 94.36
COG0265347 DegQ Trypsin-like serine proteases, typically peri 94.24
KOG3532|consensus1051 93.96
KOG1738|consensus 638 93.38
COG3975558 Predicted protease with the C-terminal PDZ domain 92.96
COG3031275 PulC Type II secretory pathway, component PulC [In 92.94
KOG1320|consensus473 90.17
PRK00698205 tmk thymidylate kinase; Validated 89.53
COG5104590 PRP40 Splicing factor [RNA processing and modifica 89.45
COG5021872 HUL4 Ubiquitin-protein ligase [Posttranslational m 89.06
COG5021872 HUL4 Ubiquitin-protein ligase [Posttranslational m 88.16
PF1281278 PDZ_1: PDZ-like domain 86.36
PF1281278 PDZ_1: PDZ-like domain 84.01
KOG0940|consensus358 82.71
KOG4286|consensus966 80.27
>KOG3209|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.2e-126  Score=1072.30  Aligned_cols=922  Identities=45%  Similarity=0.699  Sum_probs=737.1

Q ss_pred             EecCCCHHHHHHHHHhhcCCCCcEEEEEecCCc-cCcccchhccccCCCCchHHHHhhhhccCcceeecccccCCCCCCC
Q psy6910          79 KVAGYTRRDTIAWLNHCCRSGKTLTLRTVSSAY-VTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGE  157 (1145)
Q Consensus        79 ~v~g~~~~~~~~~l~~~~~~~~~v~~~~~p~~~-~~~~~~~~~~l~f~k~~i~~~l~~~~~~~~~~~~v~~TTR~~r~~E  157 (1145)
                      .|.|++..++.-+|.+|   ...|+++.+-.+. -.+++++|+.+.|+|+.+++.|.+.++.++|.+.+++|||.++.+|
T Consensus         2 rV~~~~~~~vll~i~s~---~~al~~~~~~~~~~~~k~l~~f~~~~f~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~   78 (984)
T KOG3209|consen    2 RVKGLDACDVLLVISSC---KAALRTKYVIQGGYCSKDLRHFLNTRFQKGFVDHELQQSIRDNLYLFQVPCTTRRILEGE   78 (984)
T ss_pred             ccccccccceeeeecch---hhhhhhHHhhhcccccccchhhhhhhhhhccchhhhcccccccccccccccccccccccc
Confidence            57888999999999999   9999999888766 7889999999999999999999999999999999999999999999


Q ss_pred             cCCccEEEeCHHHHHHHHHcCCEEEEEEeCCcccCCCccchhhhhcCCCCceee-----ecCCCChhhhhhhhccccccc
Q psy6910         158 LNGVDYTFLSIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLL-----PGAHPSSEGKRKRNRSNVEAM  232 (1145)
Q Consensus       158 ~~g~~Y~fvs~~~f~~~~~~~~flE~~~~~g~~YGt~~~~i~~~~~~g~~~~~i-----l~~~~~~~~~~~~~~~~~~~~  232 (1145)
                      ++  ||.|.+...|..+...|-|+|++.|.+|||||++..-..+-.  +  +++     +....+++..+++.++|..+.
T Consensus        79 ~~--d~~fs~~~~~l~l~~~~~~l~~~~~~~~~ygtPkPp~~pa~~--~--~~~~d~~~~~~~~~~es~~kr~~sy~~m~  152 (984)
T KOG3209|consen   79 VP--DYSFSTVPIFLCLEVSGCLLEFGTYESNYYGTPKPPECPADD--D--MMLTDQELLLPPNSAESYRKRTKSYSIME  152 (984)
T ss_pred             cC--ccccccchhhheeeecceeecccCcccCCCCCCCCccccCcc--c--ceeecccccCCCcchhcccccCcceeehh
Confidence            99  999999999999999999999999999999999875544322  2  333     333456778888999998888


Q ss_pred             ceeEecCCChhhhhhhhhccCCC---CcccccccC---CC---CCCCCCCCCCCCCCCCCCC-CCccccCCCCCCCCcEE
Q psy6910         233 ASKSIEPDMKTNGFDNKTVNMGN---SSDYELNDN---NG---RESPPSYYNPYIGQGLKEI-DPLLELDLGPLPPRWEK  302 (1145)
Q Consensus       233 ~~ifi~pps~~~l~~rl~~rg~~---s~~~i~~~~---~~---~~~~~~~~~~~~~~~~~~~-~~~~~~~~~pLP~gWe~  302 (1145)
                       ..-|.+|..++-+.+-..++..   +.|..++.+   .|   ++.+|. ++++.. +.... ....++.++|||.+||+
T Consensus       153 -n~g~~~~eeeee~d~g~~n~~~~~~~~E~~e~s~~~s~~m~ssy~aPs-ts~s~~-~~~~~~~~~~e~~~gplp~nwem  229 (984)
T KOG3209|consen  153 -NAGITTPEEEEEEDPGWENGSGQNYSVEMEESSYPTSSDMPSSYFAPS-TSQSTT-PMDRYSPATQEDNLGPLPHNWEM  229 (984)
T ss_pred             -ccCCCCcccccccCccccccCCcccchhhhhccCCccCCCcccccccc-cCCCCC-cccccCccccccccCCCCccceE
Confidence             8889999877777677777665   444444222   22   222343 244431 11111 23456778999999999


Q ss_pred             EEccCCceEeeeCCCCceeccCCcchhcccccccCCCCCCCCCceeeeCCCCceEEEeCCCceeeCcCCccccccCCCCC
Q psy6910         303 AYTEKGEVYFIDHNSSTSSWLDPRLCKFQKKLEDCSDDELPYGWERIDDPAYGTYYIDHVNKQTQYENPVLQAKHRDQGA  382 (1145)
Q Consensus       303 ~~~~~Gr~yyidh~t~tT~W~~Pr~~~~~~~~~~~~~~~LP~gWe~~~~~~g~~yyinh~~k~t~~~~P~~~~~~~~~~~  382 (1145)
                      +++++|++|||||||+||+|+|||+.+.++.+..|..++||+||+...++.+..||++|.|+.|||+.|.+.+++..+..
T Consensus       230 ayte~gevyfiDhntkttswLdprl~kkaK~~eeckd~elPygWeki~dpiYg~yyvdHiN~~sq~enpvleakrk~Q~~  309 (984)
T KOG3209|consen  230 AYTEQGEVYFIDHNTKTTSWLDPRLTKKAKPPEECKDQELPYGWEKIEDPIYGTYYVDHINRKSQYENPVLEAKRKKQLR  309 (984)
T ss_pred             eEeecCeeEeeecccccceecChhhhcccCChhhcccccccccccccCCccceeEEecccchhhhhccchhhcccchhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988775543


Q ss_pred             CCCCCCCCCCc-ccCCCCcccCCCCCCCccccCCCCCCCCCCcccCCCCcCccceEEEEEEecccceeEEEecCCCC-CC
Q psy6910         383 GPSEMDDNEHK-VKDSPGKRIAPQARNTLVSTSNRSNNDENYFFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDS-KE  460 (1145)
Q Consensus       383 ~~~~~~p~~w~-~~~~~g~~~~~~h~~~~~s~~~~~~~~~~~~~~~~p~~~~g~~~~v~l~k~~~glG~~i~gg~~~-~~  460 (1145)
                      ...      |. ..+++-.    +|+.         -..+.|.||+||++++|+.+.+.|.|+..||||+|.||++. ++
T Consensus       310 ~~~------~~E~g~~p~~----~~p~---------~~q~Kp~fTrdPSqlkG~~ist~LvKg~~GFGfTliGGdd~~gD  370 (984)
T KOG3209|consen  310 GFD------QTETGTAPPQ----DHPS---------LIQGKPLFTRDPSQLKGELISTKLVKGYMGFGFTLIGGDDVRGD  370 (984)
T ss_pred             Ccc------ceeccCCCCC----cCch---------hhccCCcccCChHHhCCeEEEEEEeecccccceEEecCCcCCCC
Confidence            211      32 1111110    0000         14578899999999999999999999999999999999853 38


Q ss_pred             ccEEEEEeccCCcccccCCCCCCCEEEEECCEEcCCCCHHHHHHHHhcCCCCCeEEEEEEeCCCCCCCCCCCCCcceecc
Q psy6910         461 EFLQIKSVVPNGPAALEGHLQTGDVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNTEVVTTV  540 (1145)
Q Consensus       461 ~~i~V~~v~~~g~A~~~g~l~~GD~il~vNg~~~~~~~~~~~~~~l~~~~~g~~v~l~v~R~~~~~~~~~~~~~~~~~~~  540 (1145)
                      ++++|++|+++|||++||+|.+||+||.|||.|+.|+||+|||++|+.+|.|+.|.|++||+|++|++++++..+  +.+
T Consensus       371 efLqVKsvl~DGPAa~dGkle~GDviV~INg~cvlGhTHAqaV~~fqaiPvg~~V~L~lcRgyelp~dp~dp~~s--p~~  448 (984)
T KOG3209|consen  371 EFLQVKSVLKDGPAAQDGKLETGDVIVHINGECVLGHTHAQAVKRFQAIPVGQSVDLVLCRGYELPFDPEDPVGS--PRV  448 (984)
T ss_pred             ceeeeeecccCCchhhcCccccCcEEEEECCceeccccHHHHHHHhhccccCCeeeEEEecCccCCCCCcccCCC--Ccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999997554  233


Q ss_pred             cccCCCCCCCCCccccccCCcCCCCCCCCCCCCCCcccccccCCCCCccccccCCccEEEEEEecCCCCcceEEeccCCc
Q psy6910         541 AVNAPDLDNGSDRHLYMSANDFTDQSVKSMPDLYTSEKMVKLERPSSTDLILESDSEYLTIPIVKGAMGFGFTIADSSHG  620 (1145)
Q Consensus       541 ~~~~p~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~l~k~~~glG~~i~~~~~g  620 (1145)
                      ++.. ..        ..+    .+..+.++....+++.......++        .++++++.+.|++.||||+|+|++.|
T Consensus       449 ~iv~-~~--------P~~----~~~~~gp~v~~~~sss~~~a~~~~--------~~el~ti~i~kgpegfgftiADsPtg  507 (984)
T KOG3209|consen  449 AIVP-SW--------PDS----STDKGGPMVTGRPSSSTHLAQHDG--------PPELTTIKIVKGPEGFGFTIADSPTG  507 (984)
T ss_pred             cccc-CC--------CCC----CCCCCCCeeecCCCCccccccCCC--------CcccEEEeeecCCCCCCceeccCCCC
Confidence            3322 00        001    112222222222211111111111        27889999999999999999999999


Q ss_pred             ceEEEeecccccCCCCCCCEEEEECCEecCCCCHHHHHHHHhcCCCCceEEEEEEcCCCCCCCCCCCCCCCCCCcccCCC
Q psy6910         621 QKVKKILDRQRCKNLAEGDILIEINNLNVRNMCHGEVVQVLKDCQRNLEANIIVQRSRLQHKKTSPPFRSKTPTEMYTRP  700 (1145)
Q Consensus       621 ~~V~~i~~a~~~g~L~~GD~Il~INg~~v~~~s~~ea~~~Lk~~~~g~~v~L~v~R~~~~~p~~~~~~~~~~p~~~~~~~  700 (1145)
                      ++||+|.+..+|-+|++||.|++||+.+|++++|.+|++||++||.|..+.|+|.|++.+++.+.|.       +     
T Consensus       508 qrvK~ilDp~~c~gl~eGd~IVei~~rnvr~L~h~qvvdmlke~piG~r~~Llv~RGgp~s~~ktpk-------~-----  575 (984)
T KOG3209|consen  508 QRVKQILDPQDCPGLSEGDLIVEINERNVRALTHTQVVDMLKECPIGSRVHLLVKRGGPPSPSKTPK-------A-----  575 (984)
T ss_pred             CceeeecCcccCCCCCCCCeEEecccccccccchHHHHHHHHhccCCcceeEEEecCCCCCCCcCcc-------h-----
Confidence            9999999999999999999999999999999999999999999999999999999998776644322       1     


Q ss_pred             chhcccCCCCCcccccCCCCCC-CCCCccccccccccccccccCcCCCCCCCCCcccCCCCCC-----ccccCCcccccc
Q psy6910         701 KEIVARRPKTPLVDTRSRSKTP-TENYSEYYINKELKDLDINKNIWDPQTTNPGFMQSNYSDS-----MSYCGGYNVYQV  774 (1145)
Q Consensus       701 ~~~~~~~~~~p~~~~~~~s~~~-~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~s~~p~s-----~~~~~p~~~~~~  774 (1145)
                      ..++.             +..+ ..+.+++...      +.   ..+|..     .++..|++     +++|+|+..|. 
T Consensus       576 ~~r~~-------------~~~s~~~s~sap~i~------q~---~Pfpp~-----~rs~~pd~t~~~~qrkpdp~~~we-  627 (984)
T KOG3209|consen  576 ADRKE-------------NQGSNQMSSSAPLIP------QK---LPFPPT-----SRSEEPDNTRNTLQRKPDPTEEWE-  627 (984)
T ss_pred             hhhcc-------------CCCCccccccccccC------CC---CCCCCc-----ccccCCcccccccccCCChHHHhh-
Confidence            11111             0000 0111111000      00   002211     13333333     45899999998 


Q ss_pred             cccCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccceEEEEEEeecCCcccEEEccCCccCCceEEEEeCCC
Q psy6910         775 NKRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYSDVMVITLLRQENGFGFRIVGGTEEGSQVSIGHIVPG  854 (1145)
Q Consensus       775 ~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~L~k~~~glGf~l~gg~~~~~~i~V~~V~pg  854 (1145)
                         +|++++++++.+++.+.                  ..+. +.+.| .|.|...||||+|.||.+.+.+++|+.|++.
T Consensus       628 ---~Sraiyesr~~Ps~tsn------------------~~pd-k~ldV-~L~rkesGFGFRiLGG~ep~qpi~iG~Iv~l  684 (984)
T KOG3209|consen  628 ---KSRAIYESRMRPSSTSN------------------QKPD-KELDV-FLRRKESGFGFRILGGDEPGQPIYIGAIVPL  684 (984)
T ss_pred             ---hcccchhccCCCCCccc------------------cCCc-cceeE-EEEeeccccceEEecCCCCCCeeEEeeeeec
Confidence               89999999976333321                  1233 67888 9999999999999999999999999999999


Q ss_pred             ChhhhcCCCCCCCEEEEECCEecCCCCHHHHHHHHHhccCCCeEEEEEeeccCCCCcccc----cCCCCCeEEEEeccCC
Q psy6910         855 GAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELMGKASVYGRVTLGIRRKVMPPAETTS----MMLGYPYDVTITRREN  930 (1145)
Q Consensus       855 s~A~~~G~L~~GD~IlsVNG~~v~~~s~~~~~~~L~~~~~~~~v~L~v~r~~~~~~~~~~----~~~~~~~~V~l~r~~~  930 (1145)
                      |+|+.+|||+.||+|+.|+|++|.+.+|.+++.+|..++.++.|.|+|+|........++    .....+++|.++|+++
T Consensus       685 GaAe~DGRL~~gDElv~iDG~pV~GksH~~vv~Lm~~AArnghV~LtVRRkv~~~~~~rsp~~s~~~~~~yDV~lhR~EN  764 (984)
T KOG3209|consen  685 GAAEEDGRLREGDELVCIDGIPVEGKSHSEVVDLMEAAARNGHVNLTVRRKVRTGPARRSPRNSAAPSGPYDVVLHRKEN  764 (984)
T ss_pred             ccccccCcccCCCeEEEecCeeccCccHHHHHHHHHHHHhcCceEEEEeeeeeeccccCCcccccCCCCCeeeEEecccC
Confidence            999999999999999999999999999999999999999999999999998766533222    2345689999999999


Q ss_pred             CcccEEEeecCCCCCceEEEeCCCCcccccCCCCCCCEEEEECCeeecccCHHHHHHHHHcCCCEEEEEEeCCCCCCC--
Q psy6910         931 EGFGFVIISSLNKAGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAPISGDD-- 1008 (1145)
Q Consensus       931 ~~lG~~l~~~~~~~g~~I~~v~~gs~A~~~G~L~~GD~Il~VNG~~v~~~~~~~~~~~l~~~~~~v~L~v~r~~~~~~-- 1008 (1145)
                      ++|||.|.++.+..+.-|..|++||||++||+|++||+|++|||++|.+++|.+++.+||.+|..|+|+|..+.....  
T Consensus       765 eGFGFVi~sS~~kp~sgiGrIieGSPAdRCgkLkVGDrilAVNG~sI~~lsHadiv~LIKdaGlsVtLtIip~ee~~~~~  844 (984)
T KOG3209|consen  765 EGFGFVIMSSQNKPESGIGRIIEGSPADRCGKLKVGDRILAVNGQSILNLSHADIVSLIKDAGLSVTLTIIPPEEAGPPT  844 (984)
T ss_pred             CceeEEEEecccCCCCCccccccCChhHhhccccccceEEEecCeeeeccCchhHHHHHHhcCceEEEEEcChhccCCCC
Confidence            999999999888877779999999999999999999999999999999999999999999999999999954322211  


Q ss_pred             ---CCCCcccCccCC-----------C-------CCC---------CCCCCCcccEEEEeecCCcceeEEEEccCCcccc
Q psy6910        1009 ---ASSTTSVSAASH-----------R-------EYE---------EGGEHDEQYHAIELSRGTRGFGFSIRGGREFQNM 1058 (1145)
Q Consensus      1009 ---~~~~~s~~~~~~-----------~-------~~p---------~~~~~~~~~~~v~l~k~~~~lG~sl~gg~~~~~~ 1058 (1145)
                         +...+++..+.+           +       +.|         .....+..+++|+|+++..+|||+|+||.++ +|
T Consensus       845 ~~~sa~~~s~~t~~~~~~q~~glp~~~~s~~~~~pqpdt~~~~~~~~r~~qn~~~~~VelErG~kGFGFSiRGGrey-nM  923 (984)
T KOG3209|consen  845 SMTSAEKQSPFTQNGPYEQQYGLPGPRPSVYEEHPQPDTFQGLSINDRMSQNGDLYTVELERGAKGFGFSIRGGREY-NM  923 (984)
T ss_pred             CCcchhhcCcccccCCHhHccCCCCCCccccccCCCCccccceeccccccccCCeeEEEeeccccccceEeeccccc-cc
Confidence               111222222211           0       011         1234577899999999999999999999887 99


Q ss_pred             cEEEEEEcCCChhcccCCCCCCCEEEEECCEEcCCCCHHHHHHHHHcCCCeEEEEEEeCC
Q psy6910        1059 ALFVLQIAENGPAALDGHLKVGDEIVEINGINTKNMTHAEAIEIIRNGDSTVRLLIKRGG 1118 (1145)
Q Consensus      1059 ~v~V~~V~~gg~A~~~G~L~~GD~Il~ING~~v~~~s~~eav~~lk~~~~~v~L~v~R~~ 1118 (1145)
                      ++||.++.++|||.++||+++||+|++|||+++++|+|+.|+++||+.+..|.|.++|+.
T Consensus       924 ~LfVLRlAeDGPA~rdGrm~VGDqi~eINGesTkgmtH~rAIelIk~gg~~vll~Lr~g~  983 (984)
T KOG3209|consen  924 DLFVLRLAEDGPAIRDGRMRVGDQITEINGESTKGMTHDRAIELIKQGGRRVLLLLRRGT  983 (984)
T ss_pred             ceEEEEeccCCCccccCceeecceEEEecCcccCCCcHHHHHHHHHhCCeEEEEEeccCC
Confidence            999999999999999999999999999999999999999999999998888888887753

>KOG3209|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG1891|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>smart00456 WW Domain with 2 conserved Trp (W) residues Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG4371|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>KOG3259|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG0155|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>COG5104 PRP40 Splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5021 HUL4 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG0940|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1145
2kpk_A129 Magi-1 Pdz1 Length = 129 7e-36
2kpk_A129 Magi-1 Pdz1 Length = 129 6e-07
1ueq_A123 Solution Structure Of The First Pdz Domain Of Human 1e-31
1ueq_A123 Solution Structure Of The First Pdz Domain Of Human 5e-06
2i04_A85 X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The 1e-24
2i04_A85 X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The 9e-07
2r4h_B112 Crystal Structure Of A C1190s Mutant Of The 6th Pdz 2e-24
1wfv_A103 Solution Structure Of The Fifth Pdz Domain Of Human 1e-23
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 2e-22
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-13
2xkx_A 721 Single Particle Analysis Of Psd-95 In Negative Stai 4e-12
1ujv_A96 Solution Structure Of The Second Pdz Domain Of Huma 4e-20
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 6e-19
3soe_A113 Crystal Structure Of The 3rd Pdz Domain Of The Huma 2e-15
3bpu_A88 Crystal Structure Of The 3rd Pdz Domain Of Human Me 4e-15
2q9v_A90 Crystal Structure Of The C890s Mutant Of The 4th Pd 6e-15
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 5e-13
3gsl_A196 Crystal Structure Of Psd-95 Tandem Pdz Domains 1 An 1e-10
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 6e-13
2ka9_A189 Solution Structure Of Psd-95 Pdz12 Complexed With C 1e-10
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 1e-12
3zrt_A199 Crystal Structure Of Human Psd-95 Pdz1-2 Length = 1 1e-10
2yse_A60 Solution Structure Of The Second Ww Domain From The 2e-12
2dm8_A116 Solution Structure Of The Eighth Pdz Domain Of Huma 2e-12
1uep_A103 Solution Structure Of The Third Pdz Domain Of Human 6e-12
3rl7_B107 Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc L 8e-12
2jik_A101 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 9e-12
2eno_A120 Solution Structure Of The Pdz Domain From Human Syn 1e-11
2jin_A102 Crystal Structure Of Pdz Domain Of Synaptojanin-2 B 1e-11
1zok_A93 Pdz1 Domain Of Synapse Associated Protein 97 Length 2e-11
2opg_A98 The Crystal Structure Of The 10th Pdz Domain Of Mpd 2e-11
2qt5_A200 Crystal Structure Of Grip1 Pdz12 In Complex With Th 3e-11
2djt_A104 Solution Structures Of The Pdz Domain Of Human Unna 3e-11
1rgr_A99 Cyclic Peptides Targeting Pdz Domains Of Psd-95: St 1e-10
1kef_A93 Pdz1 Of Sap90 Length = 93 1e-10
1iu0_A91 The First Pdz Domain Of Psd-95 Length = 91 2e-10
2daz_A124 Solution Structure Of The 7th Pdz Domain Of Inad-Li 2e-10
2wl7_A102 Crystal Structure Of The Psd93 Pdz1 Domain Length = 4e-10
2fne_A117 The Crystal Structure Of The 13th Pdz Domain Of Mpd 3e-09
1wha_A105 Solution Structure Of The Second Pdz Domain Of Huma 6e-09
2awx_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 7e-09
4amh_A106 Influence Of Circular Permutation On The Folding Pa 1e-08
2zaj_A49 Solution Structure Of The Short-Isoform Of The Seco 1e-08
2awu_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-08
2aww_A105 Synapse Associated Protein 97 Pdz2 Domain Variant C 1e-08
3rl8_A105 Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc L 2e-08
2g2l_A105 Crystal Structure Of The Second Pdz Domain Of Sap97 2e-08
2byg_A117 2nd Pdz Domain Of Discs Large Homologue 2 Length = 2e-08
3i4w_A104 Crystal Structure Of The Third Pdz Domain Of Psd-95 3e-08
4g69_A100 Structure Of The Human Discs Large 1 Pdz2 - Adenoma 3e-08
1tp3_A119 Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv 3e-08
2dkr_A93 Solution Structure Of The Pdz Domain From Human Lin 4e-08
3k82_A98 Crystal Structure Of The Third Pdz Domain Of Psd-95 4e-08
1be9_A119 The Third Pdz Domain From The Synaptic Protein Psd- 5e-08
2x7z_A99 Crystal Structure Of The Sap97 Pdz2 I342w C378a Mut 5e-08
3jxt_A104 Crystal Structure Of The Third Pdz Domain Of Sap-10 6e-08
1qlc_A95 Solution Structure Of The Second Pdz Domain Of Post 6e-08
2oqs_A97 Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV 6e-08
2fe5_A94 The Crystal Structure Of The Second Pdz Domain Of H 6e-08
2i0l_A84 X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The 6e-08
1um7_A113 Solution Structure Of The Third Pdz Domain Of Synap 7e-08
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 1e-07
1x6d_A119 Solution Structures Of The Pdz Domain Of Human Inte 3e-06
2ysd_A57 Solution Structure Of The First Ww Domain From The 1e-07
2iwn_A97 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz 2e-07
2he2_A102 Crystal Structure Of The 3rd Pdz Domain Of Human Di 3e-07
2w4f_A97 Crystal Structure Of The First Pdz Domain Of Human 3e-07
1x5q_A110 Solution Structure Of The First Pdz Domain Of Scrib 4e-07
2iwo_A120 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 4e-07
2dlu_A111 Solution Structure Of The Second Pdz Domain Of Huma 4e-07
2pa1_A87 Structure Of The Pdz Domain Of Human Pdlim2 Bound T 5e-07
3pdz_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-07
2i1n_A102 Crystal Structure Of The 1st Pdz Domain Of Human Dl 6e-07
3pdv_A89 Structure Of The Pdlim2 Pdz Domain In Complex With 6e-07
2o2t_A117 The Crystal Structure Of The 1st Pdz Domain Of Mpdz 6e-07
1d5g_A96 Solution Structure Of The Pdz2 Domain From Human Ph 6e-07
1wif_A126 The Solution Structure Of Rsgi Ruh-020, A Pdz Domai 7e-07
2kxq_A90 Solution Structure Of Smurf2 Ww2 And Ww3 Bound To S 8e-07
1vj6_A102 Pdz2 From Ptp-Bl In Complex With The C-Terminal Lig 8e-07
2fn5_A94 Nmr Structure Of The Neurabin Pdz Domain (502-594) 8e-07
3hvq_C170 Crystal Structure Of A Complex Between Protein Phos 8e-07
3k1r_A192 Structure Of Harmonin Npdz1 In Complex With The Sam 8e-07
2ehr_A117 Solution Structure Of The Sixth Pdz Domain Of Human 1e-06
1gm1_A94 Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 1e-06
1um1_A110 Solution Structure Of Rsgi Ruh-007, Pdz Domain In H 1e-06
2ogp_A97 Solution Structure Of The Second Pdz Domain Of Par- 2e-06
1wf8_A107 Solution Structure Of The Pdz Domain Of Spinophilin 2e-06
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 2e-06
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 3e-06
2kom_A121 Solution Structure Of Humar Par-3b Pdz2 (Residues 4 6e-06
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 3e-06
2koj_A111 Solution Structure Of Mouse Par-3 Pdz2 (Residues 45 4e-06
3egh_C170 Crystal Structure Of A Complex Between Protein Phos 4e-06
3egg_C170 Crystal Structure Of A Complex Between Protein Phos 4e-06
2g5m_B113 Spinophilin Pdz Domain Length = 113 5e-06
1vb7_A94 Solution Structure Of The Pdz Domain Of Pdz And Lim 6e-06
2rrm_A100 Interplay Between Phosphatidyl-Inositol-Phosphates 8e-06
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 1e-05
2uzc_A88 Structure Of Human Pdlim5 In Complex With The C-Ter 1e-05
1q7x_A108 Solution Structure Of The Alternatively Spliced Pdz 1e-05
4f8k_A109 Molecular Analysis Of The Interaction Between The P 1e-05
2edz_A114 Solution Structures Of The Pdz Domain Of Mus Muscul 1e-05
1wf7_A103 Solution Structure Of The Pdz Domain Of Enigma Homo 2e-05
1uhp_A107 Solution Structure Of Rsgi Ruh-005, A Pdz Domain In 2e-05
3ngh_A106 Molecular Analysis Of The Interaction Of The Hdl Re 2e-05
1ozi_A99 The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Len 2e-05
2k1z_A104 Solution Structure Of Par-3 Pdz3 Length = 104 2e-05
1uju_A111 Solution Structure Of The Fourth Pdz Domain Of Huma 2e-05
1ihj_A98 Crystal Structure Of The N-Terminal Pdz Domain Of I 2e-05
2koh_A111 Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve 2e-05
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 2e-05
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 3e-05
2d92_A108 Solution Structure Of The Fifth Pdz Domain Of Inad- 3e-05
1tk7_A88 Nmr Structure Of Ww Domains (Ww3-4) From Suppressor 3e-05
2yuy_A126 Solution Structure Of Pdz Domain Of Rho Gtpase Acti 3e-05
2dwv_A49 Solution Structure Of The Second Ww Domain From Mou 3e-05
2pku_A87 Solution Structure Of Pick1 Pdz In Complex With The 4e-05
2gzv_A114 The Cystal Structure Of The Pdz Domain Of Human Pic 4e-05
2h2c_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Der 4e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 4e-05
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 4e-05
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 5e-05
1pdr_A99 Crystal Structure Of The Third Pdz Domain From The 3e-04
3hpk_A125 Oxidized Dimeric Pick1 Pdz In Complex With The Carb 5e-05
2h2b_A107 Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-der 5e-05
2csj_A117 Solution Structure Of N-Terminal Pdz Domain From Mo 5e-05
3hpm_A111 Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex W 6e-05
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 6e-05
2i0i_A85 X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The 1e-04
2h3m_A97 Crystal Structure Of Zo-1 Pdz1 Length = 97 7e-05
2jil_A97 Crystal Structure Of 2nd Pdz Domain Of Glutamate Re 7e-05
1rgw_A85 Solution Structure Of Zasp's Pdz Domain Length = 85 7e-05
1wjl_A90 Solution Structure Of Pdz Domain Of Mouse Cypher Pr 8e-05
2law_A38 Structure Of The Second Ww Domain From Human Yap In 9e-05
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 9e-05
4e34_A87 Crystal Structure Of Cftr Associated Ligand (Cal) P 1e-04
2dc2_A103 Solution Structure Of Pdz Domain Length = 103 1e-04
2ltv_A36 Yap Ww2 In Complex With A Smad7 Derived Peptide Len 1e-04
2l4j_A46 Yap Ww2 Length = 46 1e-04
1p1d_A196 Structural Insights Into The Inter-Domain Chaperoni 1e-04
1n7e_A97 Crystal Structure Of The Sixth Pdz Domain Of Grip1 2e-04
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 2e-04
2pnt_A98 Crystal Structure Of The Pdz Domain Of Human Grasp 2e-04
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 2e-04
3diw_A124 C-Terminal Beta-Catenin Bound Tip-1 Structure Lengt 2e-04
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 2e-04
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 2e-04
2kg2_A124 Solution Structure Of A Pdz Protein Length = 124 2e-04
2ego_A96 Crystal Structure Of Tamalin Pdz Domain Length = 96 2e-04
2vrf_A95 Crystal Structure Of The Human Beta-2-Syntrophin Pd 3e-04
3gj9_A124 Crystal Structure Of Tip-1 In Complex With C-Termin 3e-04
3dj3_A113 Crystal Structure Of C-Terminal Truncated Tip-1 (6- 3e-04
2kv8_A83 Solution Structure Ofrgs12 Pdz Domain Length = 83 3e-04
1t2m_A101 Solution Structure Of The Pdz Domain Of Af-6 Length 3e-04
2ain_A93 Solution Structure Of The Af-6 Pdz Domain Complexed 3e-04
2vz5_A139 Structure Of The Pdz Domain Of Tax1 (Human T-Cell L 3e-04
1z87_A263 Solution Structure Of The Split Ph-Pdz Supramodule 3e-04
1xz9_A101 Structure Of Af-6 Pdz Domain Length = 101 3e-04
3axa_A106 Crystal Structure Of Afadin Pdz Domain In Complex W 3e-04
2lob_A112 Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Re 4e-04
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 4e-04
4e3b_A102 Crystal Structure Of Tax-Interacting Protein-1 (Tip 4e-04
3sfj_A104 Crystal Structure Of Tax-Interacting Protein-1 (Tip 4e-04
2qbw_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 6e-04
3ch8_A195 The Crystal Structure Of Pdz-Fibronectin Fusion Pro 6e-04
2edp_A100 Solution Structure Of The Pdz Domain From Human Shr 6e-04
1q3o_A109 Crystal Structure Of The Shank Pdz-ligand Complex R 7e-04
2z17_A104 Crystal Sturcture Of Pdz Domain From Human Pleckstr 7e-04
1gky_A187 Refined Structure Of The Complex Between Guanylate 8e-04
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 8e-04
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 8e-04
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 8e-04
3qjm_A115 Structural Flexibility Of Shank Pdz Domain Is Impor 8e-04
>pdb|2KPK|A Chain A, Magi-1 Pdz1 Length = 129 Back     alignment and structure 
Iteration: 1

 Score =  149 bits (377), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 88/109 (80%), Gaps = 1/109 (0%)
Query: 424 FFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTG 483
           FFT NP EL G+ IH+ L KS RG GFT+VGGD+  +EFLQIKS+V +GPAAL+G ++TG
Sbjct: 7   FFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEP-DEFLQIKSLVLDGPAALDGKMETG 65
Query: 484 DVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDP 532
           DV+V VND CVLG+TH  +V +FQSI  G +V LE+CRGYPLPFDP+DP
Sbjct: 66  DVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDP 114
>pdb|2KPK|A Chain A, Magi-1 Pdz1 Length = 129 Back     alignment and structure
>pdb|1UEQ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 123 Back     alignment and structure
>pdb|1UEQ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 123 Back     alignment and structure
>pdb|2I04|A Chain A, X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2I04|A Chain A, X-Ray Crystal Structure Of Magi-1 Pdz1 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2R4H|B Chain B, Crystal Structure Of A C1190s Mutant Of The 6th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 112 Back     alignment and structure
>pdb|1WFV|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|1UJV|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Membrane Associated Guanylate Kinase Inverted-2 (Magi-2) Length = 96 Back     alignment and structure
>pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>pdb|3SOE|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of The Human Membrane- Associated Guanylate Kinase, Ww And Pdz Domain-Containing Protein 3 (Magi3) Length = 113 Back     alignment and structure
>pdb|3BPU|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Membrane Associated Guanylate Kinase, C677s And C709s Double Mutant Length = 88 Back     alignment and structure
>pdb|2Q9V|A Chain A, Crystal Structure Of The C890s Mutant Of The 4th Pdz Domain Of Human Membrane Associated Guanylate Kinase Length = 90 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|3GSL|A Chain A, Crystal Structure Of Psd-95 Tandem Pdz Domains 1 And 2 Length = 196 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|2KA9|A Chain A, Solution Structure Of Psd-95 Pdz12 Complexed With Cypin Peptide Length = 189 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|3ZRT|A Chain A, Crystal Structure Of Human Psd-95 Pdz1-2 Length = 199 Back     alignment and structure
>pdb|2YSE|A Chain A, Solution Structure Of The Second Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain- Containing Protein 1. Magi-1 Length = 60 Back     alignment and structure
>pdb|2DM8|A Chain A, Solution Structure Of The Eighth Pdz Domain Of Human Inad- Like Protein Length = 116 Back     alignment and structure
>pdb|1UEP|A Chain A, Solution Structure Of The Third Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 103 Back     alignment and structure
>pdb|3RL7|B Chain B, Crytal Structure Of Hdlg1-Pdz1 Complexed With Apc Length = 107 Back     alignment and structure
>pdb|2JIK|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 101 Back     alignment and structure
>pdb|2ENO|A Chain A, Solution Structure Of The Pdz Domain From Human Synaptojanin 2 Binding Protein Length = 120 Back     alignment and structure
>pdb|2JIN|A Chain A, Crystal Structure Of Pdz Domain Of Synaptojanin-2 Binding Protein Length = 102 Back     alignment and structure
>pdb|1ZOK|A Chain A, Pdz1 Domain Of Synapse Associated Protein 97 Length = 93 Back     alignment and structure
>pdb|2OPG|A Chain A, The Crystal Structure Of The 10th Pdz Domain Of Mpdz Length = 98 Back     alignment and structure
>pdb|2QT5|A Chain A, Crystal Structure Of Grip1 Pdz12 In Complex With The Fras1 Peptide Length = 200 Back     alignment and structure
>pdb|2DJT|A Chain A, Solution Structures Of The Pdz Domain Of Human Unnamed Protein Product Length = 104 Back     alignment and structure
>pdb|1RGR|A Chain A, Cyclic Peptides Targeting Pdz Domains Of Psd-95: Structural Basis For Enhanced Affinity And Enzymatic Stability Length = 99 Back     alignment and structure
>pdb|1KEF|A Chain A, Pdz1 Of Sap90 Length = 93 Back     alignment and structure
>pdb|1IU0|A Chain A, The First Pdz Domain Of Psd-95 Length = 91 Back     alignment and structure
>pdb|2DAZ|A Chain A, Solution Structure Of The 7th Pdz Domain Of Inad-Like Protein Length = 124 Back     alignment and structure
>pdb|2WL7|A Chain A, Crystal Structure Of The Psd93 Pdz1 Domain Length = 102 Back     alignment and structure
>pdb|2FNE|A Chain A, The Crystal Structure Of The 13th Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|1WHA|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 105 Back     alignment and structure
>pdb|2AWX|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378s Length = 105 Back     alignment and structure
>pdb|4AMH|A Chain A, Influence Of Circular Permutation On The Folding Pathway Of A Pdz Domain Length = 106 Back     alignment and structure
>pdb|2ZAJ|A Chain A, Solution Structure Of The Short-Isoform Of The Second Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain-Containing Protein 1 (Magi-1) Length = 49 Back     alignment and structure
>pdb|2AWU|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g Length = 105 Back     alignment and structure
>pdb|2AWW|A Chain A, Synapse Associated Protein 97 Pdz2 Domain Variant C378g With C-Terminal Glur-A Peptide Length = 105 Back     alignment and structure
>pdb|3RL8|A Chain A, Crytal Structure Of Hdlg1-Pdz2 Complexed With Apc Length = 105 Back     alignment and structure
>pdb|2G2L|A Chain A, Crystal Structure Of The Second Pdz Domain Of Sap97 In Complex With A Glur-A C-Terminal Peptide Length = 105 Back     alignment and structure
>pdb|2BYG|A Chain A, 2nd Pdz Domain Of Discs Large Homologue 2 Length = 117 Back     alignment and structure
>pdb|3I4W|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 104 Back     alignment and structure
>pdb|4G69|A Chain A, Structure Of The Human Discs Large 1 Pdz2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Length = 100 Back     alignment and structure
>pdb|1TP3|A Chain A, Pdz3 Domain Of Psd-95 Protein Complexed With Kketpv Peptide Ligand Length = 119 Back     alignment and structure
>pdb|2DKR|A Chain A, Solution Structure Of The Pdz Domain From Human Lin-7 Homolog B Length = 93 Back     alignment and structure
>pdb|3K82|A Chain A, Crystal Structure Of The Third Pdz Domain Of Psd-95 Length = 98 Back     alignment and structure
>pdb|1BE9|A Chain A, The Third Pdz Domain From The Synaptic Protein Psd-95 In Complex With A C-Terminal Peptide Derived From Cript. Length = 119 Back     alignment and structure
>pdb|2X7Z|A Chain A, Crystal Structure Of The Sap97 Pdz2 I342w C378a Mutant Protein Domain Length = 99 Back     alignment and structure
>pdb|3JXT|A Chain A, Crystal Structure Of The Third Pdz Domain Of Sap-102 In Complex With A Fluorogenic Peptide-Based Ligand Length = 104 Back     alignment and structure
>pdb|1QLC|A Chain A, Solution Structure Of The Second Pdz Domain Of Postsynaptic Density-95 Length = 95 Back     alignment and structure
>pdb|2OQS|A Chain A, Structure Of The HdlgSAP97 PDZ2 IN COMPLEX WITH HPV-18 Papillomavirus E6 Peptide Length = 97 Back     alignment and structure
>pdb|2FE5|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Dlg3 Length = 94 Back     alignment and structure
>pdb|2I0L|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz2 Bound To The C- Terminal Peptide Of Hpv18 E6. Length = 84 Back     alignment and structure
>pdb|1UM7|A Chain A, Solution Structure Of The Third Pdz Domain Of Synapse- Associated Protein 102 Length = 113 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|1X6D|A Chain A, Solution Structures Of The Pdz Domain Of Human Interleukin- 16 Length = 119 Back     alignment and structure
>pdb|2YSD|A Chain A, Solution Structure Of The First Ww Domain From The Human Membrane-Associated Guanylate Kinase, Ww And Pdz Domain- Containing Protein 1. Magi-1 Length = 57 Back     alignment and structure
>pdb|2IWN|A Chain A, 3rd Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 97 Back     alignment and structure
>pdb|2HE2|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Human Discs Large Homologue 2, Dlg2 Length = 102 Back     alignment and structure
>pdb|2W4F|A Chain A, Crystal Structure Of The First Pdz Domain Of Human Scrib1 Length = 97 Back     alignment and structure
>pdb|1X5Q|A Chain A, Solution Structure Of The First Pdz Domain Of Scribble Homolog Protein (Hscrib) Length = 110 Back     alignment and structure
>pdb|2IWO|A Chain A, 12th Pdz Domain Of Multiple Pdz Domain Protein Mpdz (Casp Target) Length = 120 Back     alignment and structure
>pdb|2DLU|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Inad- Like Protein Length = 111 Back     alignment and structure
>pdb|2PA1|A Chain A, Structure Of The Pdz Domain Of Human Pdlim2 Bound To A C-Terminal Extension From Human Beta-Tropomyosin Length = 87 Back     alignment and structure
>pdb|3PDZ|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Length = 96 Back     alignment and structure
>pdb|2I1N|A Chain A, Crystal Structure Of The 1st Pdz Domain Of Human Dlg3 Length = 102 Back     alignment and structure
>pdb|3PDV|A Chain A, Structure Of The Pdlim2 Pdz Domain In Complex With The C-Terminal 6- Peptide Extension Of Ns1 Length = 89 Back     alignment and structure
>pdb|2O2T|A Chain A, The Crystal Structure Of The 1st Pdz Domain Of Mpdz Length = 117 Back     alignment and structure
>pdb|1D5G|A Chain A, Solution Structure Of The Pdz2 Domain From Human Phosphatase Hptp1e Complexed With A Peptide Length = 96 Back     alignment and structure
>pdb|1WIF|A Chain A, The Solution Structure Of Rsgi Ruh-020, A Pdz Domain Of Hypothetical Protein From Mouse Length = 126 Back     alignment and structure
>pdb|2KXQ|A Chain A, Solution Structure Of Smurf2 Ww2 And Ww3 Bound To Smad7 Py Motif Containing Peptide Length = 90 Back     alignment and structure
>pdb|1VJ6|A Chain A, Pdz2 From Ptp-Bl In Complex With The C-Terminal Ligand From The Apc Protein Length = 102 Back     alignment and structure
>pdb|2FN5|A Chain A, Nmr Structure Of The Neurabin Pdz Domain (502-594) Length = 94 Back     alignment and structure
>pdb|3HVQ|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Neurabin Length = 170 Back     alignment and structure
>pdb|3K1R|A Chain A, Structure Of Harmonin Npdz1 In Complex With The Sam-Pbm Of Sans Length = 192 Back     alignment and structure
>pdb|2EHR|A Chain A, Solution Structure Of The Sixth Pdz Domain Of Human Inad- Like Protein Length = 117 Back     alignment and structure
>pdb|1GM1|A Chain A, Second Pdz Domain (Pdz2) Of Ptp-Bl Length = 94 Back     alignment and structure
>pdb|1UM1|A Chain A, Solution Structure Of Rsgi Ruh-007, Pdz Domain In Human Cdna Length = 110 Back     alignment and structure
>pdb|2OGP|A Chain A, Solution Structure Of The Second Pdz Domain Of Par-3 Length = 97 Back     alignment and structure
>pdb|1WF8|A Chain A, Solution Structure Of The Pdz Domain Of SpinophilinNEURABINII PROTEIN Length = 107 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2KOM|A Chain A, Solution Structure Of Humar Par-3b Pdz2 (Residues 451-549) Length = 121 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|2KOJ|A Chain A, Solution Structure Of Mouse Par-3 Pdz2 (Residues 450-558) Length = 111 Back     alignment and structure
>pdb|3EGH|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1), The Pp1 Binding And Pdz Domains Of Spinophilin And The Small Natural Molecular Toxin Nodularin-R Length = 170 Back     alignment and structure
>pdb|3EGG|C Chain C, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 170 Back     alignment and structure
>pdb|2G5M|B Chain B, Spinophilin Pdz Domain Length = 113 Back     alignment and structure
>pdb|1VB7|A Chain A, Solution Structure Of The Pdz Domain Of Pdz And Lim Domain 2 Length = 94 Back     alignment and structure
>pdb|2RRM|A Chain A, Interplay Between Phosphatidyl-Inositol-Phosphates And Claudins Upon Binding To The 1st Pdz Domain Of Zonula Occludens 1 Length = 100 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|2UZC|A Chain A, Structure Of Human Pdlim5 In Complex With The C-Terminal Peptide Of Human Alpha-Actinin-1 Length = 88 Back     alignment and structure
>pdb|1Q7X|A Chain A, Solution Structure Of The Alternatively Spliced Pdz2 Domain (Pdz2b) Of Ptp-Bas (Hptp1e) Length = 108 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure
>pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 Back     alignment and structure
>pdb|1WF7|A Chain A, Solution Structure Of The Pdz Domain Of Enigma Homologue Protein Length = 103 Back     alignment and structure
>pdb|1UHP|A Chain A, Solution Structure Of Rsgi Ruh-005, A Pdz Domain In Human Cdna, Kiaa1095 Length = 107 Back     alignment and structure
>pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 Back     alignment and structure
>pdb|1OZI|A Chain A, The Alternatively Spliced Pdz2 Domain Of Ptp-Bl Length = 99 Back     alignment and structure
>pdb|2K1Z|A Chain A, Solution Structure Of Par-3 Pdz3 Length = 104 Back     alignment and structure
>pdb|1UJU|A Chain A, Solution Structure Of The Fourth Pdz Domain Of Human Scribble (Kiaa0147 Protein) Length = 111 Back     alignment and structure
>pdb|1IHJ|A Chain A, Crystal Structure Of The N-Terminal Pdz Domain Of Inad In Complex With A Norpa C-Terminal Peptide Length = 98 Back     alignment and structure
>pdb|2KOH|A Chain A, Nmr Structure Of Mouse Par3-Pdz3 In Complex With Ve-Cadherin C-Terminus Length = 111 Back     alignment and structure
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|2D92|A Chain A, Solution Structure Of The Fifth Pdz Domain Of Inad-Like Protein Length = 108 Back     alignment and structure
>pdb|1TK7|A Chain A, Nmr Structure Of Ww Domains (Ww3-4) From Suppressor Of Deltex Length = 88 Back     alignment and structure
>pdb|2YUY|A Chain A, Solution Structure Of Pdz Domain Of Rho Gtpase Activating Protein 21 Length = 126 Back     alignment and structure
>pdb|2DWV|A Chain A, Solution Structure Of The Second Ww Domain From Mouse Salvador Homolog 1 Protein (Mww45) Length = 49 Back     alignment and structure
>pdb|2PKU|A Chain A, Solution Structure Of Pick1 Pdz In Complex With The Carboxyl Tail Peptide Of Glur2 Length = 87 Back     alignment and structure
>pdb|2GZV|A Chain A, The Cystal Structure Of The Pdz Domain Of Human Pick1 (Casp Target) Length = 114 Back     alignment and structure
>pdb|2H2C|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-Derived Ligand (Wrrttwv) Length = 107 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|1PDR|A Chain A, Crystal Structure Of The Third Pdz Domain From The Human Homolog Of Discs Large Protein Length = 99 Back     alignment and structure
>pdb|3HPK|A Chain A, Oxidized Dimeric Pick1 Pdz In Complex With The Carboxyl Tail Of Glur2 Length = 125 Back     alignment and structure
>pdb|2H2B|A Chain A, Crystal Structure Of Zo-1 Pdz1 Bound To A Phage-derived Ligand (wrrttyl) Length = 107 Back     alignment and structure
>pdb|2CSJ|A Chain A, Solution Structure Of N-Terminal Pdz Domain From Mouse Tjp2 Length = 117 Back     alignment and structure
>pdb|3HPM|A Chain A, Oxidized Dimeric Pick1 Pdz C46g Mutant In Complex With The C Tail Peptide Of Glur2 Length = 111 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2I0I|A Chain A, X-Ray Crystal Structure Of Sap97 Pdz3 Bound To The C- Terminal Peptide Of Hpv18 E6 Length = 85 Back     alignment and structure
>pdb|2H3M|A Chain A, Crystal Structure Of Zo-1 Pdz1 Length = 97 Back     alignment and structure
>pdb|2JIL|A Chain A, Crystal Structure Of 2nd Pdz Domain Of Glutamate Receptor Interacting Protein-1 (Grip1) Length = 97 Back     alignment and structure
>pdb|1RGW|A Chain A, Solution Structure Of Zasp's Pdz Domain Length = 85 Back     alignment and structure
>pdb|1WJL|A Chain A, Solution Structure Of Pdz Domain Of Mouse Cypher Protein Length = 90 Back     alignment and structure
>pdb|2LAW|A Chain A, Structure Of The Second Ww Domain From Human Yap In Complex With A Human Smad1 Derived Peptide Length = 38 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|4E34|A Chain A, Crystal Structure Of Cftr Associated Ligand (Cal) Pdz Domain Bound To Ical36 (Ansrwptsii) Peptide Length = 87 Back     alignment and structure
>pdb|2DC2|A Chain A, Solution Structure Of Pdz Domain Length = 103 Back     alignment and structure
>pdb|2LTV|A Chain A, Yap Ww2 In Complex With A Smad7 Derived Peptide Length = 36 Back     alignment and structure
>pdb|2L4J|A Chain A, Yap Ww2 Length = 46 Back     alignment and structure
>pdb|1P1D|A Chain A, Structural Insights Into The Inter-Domain Chaperoning Of Tandem Pdz Domains In Glutamate Receptor Interacting Proteins Length = 196 Back     alignment and structure
>pdb|1N7E|A Chain A, Crystal Structure Of The Sixth Pdz Domain Of Grip1 Length = 97 Back     alignment and structure
>pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>pdb|2PNT|A Chain A, Crystal Structure Of The Pdz Domain Of Human Grasp (Grp1) In Complex With The C-Terminal Peptide Of The Metabotropic Glutamate Receptor Type 1 Length = 98 Back     alignment and structure
>pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>pdb|3DIW|A Chain A, C-Terminal Beta-Catenin Bound Tip-1 Structure Length = 124 Back     alignment and structure
>pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>pdb|2KG2|A Chain A, Solution Structure Of A Pdz Protein Length = 124 Back     alignment and structure
>pdb|2EGO|A Chain A, Crystal Structure Of Tamalin Pdz Domain Length = 96 Back     alignment and structure
>pdb|2VRF|A Chain A, Crystal Structure Of The Human Beta-2-Syntrophin Pdz Domain Length = 95 Back     alignment and structure
>pdb|3GJ9|A Chain A, Crystal Structure Of Tip-1 In Complex With C-Terminal Of Kir2.3 Length = 124 Back     alignment and structure
>pdb|3DJ3|A Chain A, Crystal Structure Of C-Terminal Truncated Tip-1 (6-113) Length = 113 Back     alignment and structure
>pdb|2KV8|A Chain A, Solution Structure Ofrgs12 Pdz Domain Length = 83 Back     alignment and structure
>pdb|1T2M|A Chain A, Solution Structure Of The Pdz Domain Of Af-6 Length = 101 Back     alignment and structure
>pdb|2AIN|A Chain A, Solution Structure Of The Af-6 Pdz Domain Complexed With The C-Terminal Peptide From The Bcr Protein Length = 93 Back     alignment and structure
>pdb|2VZ5|A Chain A, Structure Of The Pdz Domain Of Tax1 (Human T-Cell Leukemia Virus Type I) Binding Protein 3 Length = 139 Back     alignment and structure
>pdb|1Z87|A Chain A, Solution Structure Of The Split Ph-Pdz Supramodule Of Alpha- Syntrophin Length = 263 Back     alignment and structure
>pdb|1XZ9|A Chain A, Structure Of Af-6 Pdz Domain Length = 101 Back     alignment and structure
>pdb|3AXA|A Chain A, Crystal Structure Of Afadin Pdz Domain In Complex With The C-Terminal Peptide From Nectin-3 Length = 106 Back     alignment and structure
>pdb|2LOB|A Chain A, Pdz Domain Of Cal (Cystic Fibrosis Transmembrane Regulator-Associated Ligand) Length = 112 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|4E3B|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36-L (Ansrwptsil) Peptide Length = 102 Back     alignment and structure
>pdb|3SFJ|A Chain A, Crystal Structure Of Tax-Interacting Protein-1 (Tip-1) Pdz Domain Bound To Ical36 Inhibitor Peptide Length = 104 Back     alignment and structure
>pdb|2QBW|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|3CH8|A Chain A, The Crystal Structure Of Pdz-Fibronectin Fusion Protein Length = 195 Back     alignment and structure
>pdb|2EDP|A Chain A, Solution Structure Of The Pdz Domain From Human Shroom Family Member 4 Length = 100 Back     alignment and structure
>pdb|1Q3O|A Chain A, Crystal Structure Of The Shank Pdz-ligand Complex Reveals A Class I Pdz Interaction And A Novel Pdz-pdz Dimerization Length = 109 Back     alignment and structure
>pdb|2Z17|A Chain A, Crystal Sturcture Of Pdz Domain From Human Pleckstrin Homology, Sec7 Length = 104 Back     alignment and structure
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|3QJM|A Chain A, Structural Flexibility Of Shank Pdz Domain Is Important For Its Binding To Different Ligands Length = 115 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1145
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-55
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-28
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-24
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 7e-21
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 1e-19
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-17
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-13
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-11
2xkx_A721 Disks large homolog 4; structural protein, scaffol 2e-08
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-50
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 6e-49
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 7e-22
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-17
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 6e-15
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-07
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-47
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-45
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-21
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 5e-17
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 5e-14
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 5e-14
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 4e-09
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 1e-08
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 6e-46
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-43
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-25
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-15
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 3e-11
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 4e-08
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-42
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 4e-33
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-11
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-09
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-42
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 5e-27
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 4e-24
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 4e-16
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 4e-14
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 8e-04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 2e-40
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-28
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 3e-24
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 7e-14
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 6e-13
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 8e-04
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-36
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-24
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-21
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-15
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-34
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 3e-25
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-20
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 7e-14
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 3e-34
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 4e-24
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-16
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 9e-16
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-13
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-33
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 1e-23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 2e-17
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 5e-16
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 8e-14
2djt_A104 Unnamed protein product; PDZ domain, structural ge 4e-33
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-22
2djt_A104 Unnamed protein product; PDZ domain, structural ge 4e-19
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-17
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-13
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 7e-33
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-19
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 7e-18
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-16
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 2e-11
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-32
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 1e-20
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 3e-20
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 3e-16
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 2e-12
2fne_A117 Multiple PDZ domain protein; structural protein, s 1e-32
2fne_A117 Multiple PDZ domain protein; structural protein, s 8e-20
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-19
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-15
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-13
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-32
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 3e-22
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-18
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 9e-15
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 3e-12
2awx_A105 Synapse associated protein 97; membrane protein, s 3e-32
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-19
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-19
2awx_A105 Synapse associated protein 97; membrane protein, s 8e-14
2awx_A105 Synapse associated protein 97; membrane protein, s 4e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-32
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-20
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-20
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-16
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 3e-10
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-32
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 3e-26
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 4e-23
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-14
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 6e-13
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 4e-32
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 9e-22
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 3e-21
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-15
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 4e-12
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 5e-32
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 7e-20
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-18
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-14
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 2e-11
2opg_A98 Multiple PDZ domain protein; structural protein, s 5e-32
2opg_A98 Multiple PDZ domain protein; structural protein, s 6e-21
2opg_A98 Multiple PDZ domain protein; structural protein, s 6e-20
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-15
2opg_A98 Multiple PDZ domain protein; structural protein, s 5e-11
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 6e-32
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 3e-25
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 8e-19
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-16
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 9e-13
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 6e-32
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 1e-27
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-22
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-14
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 8e-14
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 9e-32
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 9e-07
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 1e-31
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-19
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-18
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 8e-15
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 8e-12
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-31
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-20
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 8e-19
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 9e-15
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 1e-12
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-31
2byg_A117 Channel associated protein of synapse-110; DLG2, P 4e-19
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-18
2byg_A117 Channel associated protein of synapse-110; DLG2, P 6e-13
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 3e-31
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 5e-28
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-22
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-14
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 5e-14
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-31
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-20
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-20
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-15
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-12
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 5e-31
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 3e-27
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-25
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-13
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 7e-13
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-04
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-31
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 7e-19
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 4e-17
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 6e-14
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 8e-11
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-30
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 6e-24
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-19
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 2e-14
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-13
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-30
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 1e-24
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-22
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-13
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 4e-13
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 2e-30
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 6e-18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-16
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-14
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 1e-11
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-30
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-20
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 9e-18
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-17
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 2e-12
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-30
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-19
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 9e-19
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 1e-14
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-10
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 4e-30
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-22
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 6e-19
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 1e-17
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 1e-11
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 4e-30
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 1e-18
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 8e-16
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 5e-13
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-09
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 4e-30
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-19
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 4e-19
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 1e-14
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 5e-10
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 5e-30
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 6e-21
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-18
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 3e-17
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-12
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 5e-30
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-25
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-18
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 8e-16
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 7e-12
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-30
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 7e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 8e-19
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-10
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 6e-30
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-23
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 5e-18
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-17
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 9e-12
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 9e-30
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 7e-20
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 1e-18
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-15
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-10
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 1e-29
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 9e-20
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 6e-18
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-15
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 4e-04
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-29
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-19
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-18
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-17
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 8e-12
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-29
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 6e-17
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 9e-12
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-11
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 2e-29
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 3e-10
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 4e-07
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-29
2eeh_A100 PDZ domain-containing protein 7; structural genomi 4e-19
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-13
2eeh_A100 PDZ domain-containing protein 7; structural genomi 7e-12
2eeh_A100 PDZ domain-containing protein 7; structural genomi 2e-06
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 6e-29
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 1e-16
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 7e-14
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-11
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 9e-10
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-28
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-19
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-15
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-09
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-28
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 4e-17
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 5e-16
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-15
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-10
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-28
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-28
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-16
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 5e-11
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-06
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-04
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-28
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 4e-22
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 8e-16
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 3e-14
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 9e-12
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-28
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 5e-17
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 2e-14
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 8e-13
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-09
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-28
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 1e-21
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-21
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 1e-15
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 3e-12
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-28
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 2e-20
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 7e-17
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-16
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 3e-10
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-28
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 1e-20
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 1e-17
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-15
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 8e-10
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 2e-28
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 4e-17
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-15
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 6e-13
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 8e-10
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-28
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-19
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-18
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-15
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-28
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-27
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-14
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 8e-11
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 1e-07
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 8e-05
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-04
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-28
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 3e-18
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-12
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 6e-12
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 9e-09
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 5e-28
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-17
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 9e-16
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 4e-12
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-10
3k1r_A192 Harmonin; protein-protein complex, alternative spl 5e-28
3k1r_A192 Harmonin; protein-protein complex, alternative spl 8e-20
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-14
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-12
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-07
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 7e-28
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-18
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-17
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 1e-12
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 5e-08
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 7e-28
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-20
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-18
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 7e-16
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-08
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 9e-28
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-16
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 4e-14
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 1e-11
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 2e-09
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-27
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 7e-17
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-14
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-12
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 9e-10
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 1e-27
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 4e-20
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 3e-18
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 4e-16
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-08
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 1e-04
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-27
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-18
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 2e-17
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 7e-14
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 9e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-27
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-24
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-20
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-16
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 2e-09
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-27
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-19
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 3e-19
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-14
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-09
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 3e-27
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-16
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 4e-14
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-12
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 6e-11
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 3e-27
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 4e-24
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-22
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 3e-12
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-10
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-27
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-18
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-17
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 6e-15
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-08
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-27
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 6e-19
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 4e-16
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 8e-16
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 8e-10
2o2t_A117 Multiple PDZ domain protein; structural protein, s 7e-27
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-18
2o2t_A117 Multiple PDZ domain protein; structural protein, s 8e-17
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-15
2o2t_A117 Multiple PDZ domain protein; structural protein, s 9e-08
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 9e-27
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-22
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 4e-22
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-15
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 5e-10
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 1e-26
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-19
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 6e-13
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-10
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 8e-08
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-26
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 6e-20
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 5e-17
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 1e-15
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-07
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 2e-26
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 2e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-11
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-26
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 3e-26
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 3e-18
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-15
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-10
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-26
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 6e-17
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 2e-16
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 1e-10
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-26
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-22
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-21
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 5e-15
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 5e-09
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 6e-26
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 3e-21
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 6e-18
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-16
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 2e-08
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 6e-26
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-19
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 7e-13
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 5e-10
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-07
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 7e-26
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-20
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 1e-18
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 7e-16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 9e-09
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 9e-26
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-17
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 8e-14
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 9e-11
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 2e-07
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-25
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-22
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 2e-18
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 7e-17
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 3e-13
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-25
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-19
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-16
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 2e-13
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-09
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-25
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 5e-23
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-20
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 6e-17
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 8e-10
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-25
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-21
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-18
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 3e-17
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-11
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 3e-25
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 4e-17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 5e-17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 6e-13
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-07
2v90_A96 PDZ domain-containing protein 3; membrane, protein 8e-25
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-18
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-15
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-12
2v90_A96 PDZ domain-containing protein 3; membrane, protein 1e-09
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-24
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 4e-16
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-13
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 3e-11
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-07
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-24
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-21
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 3e-17
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 4e-12
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 1e-06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 3e-24
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-20
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-15
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-13
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 5e-10
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 3e-24
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-19
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 8e-14
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 4e-12
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 2e-09
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-24
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-17
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 7e-15
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-13
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 2e-08
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 3e-24
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-18
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-17
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-15
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-09
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 5e-24
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-23
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 3e-20
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 8e-12
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 4e-09
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 6e-24
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-15
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-14
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 2e-13
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 9e-11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 7e-24
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 8e-14
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 9e-13
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 1e-07
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 7e-24
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-23
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 7e-16
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 4e-11
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-08
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 1e-23
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 4e-20
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-16
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-13
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 8e-08
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-23
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-16
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-14
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 4e-14
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-09
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-23
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 1e-18
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 8e-16
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 6e-13
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 9e-11
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-23
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 2e-21
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 3e-17
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-10
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-07
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-23
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 1e-15
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 6e-15
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 6e-12
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-08
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-23
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-23
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-20
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-14
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-09
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-23
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-20
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 3e-15
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-13
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-10
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-23
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 5e-16
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-15
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-13
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-12
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-23
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 1e-20
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-19
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-15
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 6e-11
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 3e-23
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 2e-22
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 2e-20
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-16
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 1e-11
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-23
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-22
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 8e-20
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-16
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-08
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 3e-23
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-13
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 7e-12
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-10
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 8e-06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 4e-23
2eei_A106 PDZ domain-containing protein 1; regulatory factor 6e-20
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-15
2eei_A106 PDZ domain-containing protein 1; regulatory factor 3e-12
2eei_A106 PDZ domain-containing protein 1; regulatory factor 7e-10
2ego_A96 General receptor for phosphoinositides 1- associat 5e-23
2ego_A96 General receptor for phosphoinositides 1- associat 1e-21
2ego_A96 General receptor for phosphoinositides 1- associat 2e-12
2ego_A96 General receptor for phosphoinositides 1- associat 6e-11
2ego_A96 General receptor for phosphoinositides 1- associat 2e-07
2d90_A102 PDZ domain containing protein 1; structural genomi 6e-23
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-21
2d90_A102 PDZ domain containing protein 1; structural genomi 1e-15
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-11
2d90_A102 PDZ domain containing protein 1; structural genomi 4e-11
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 6e-23
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-19
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 1e-12
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 2e-09
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 1e-05
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-22
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 1e-15
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 6e-13
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 2e-11
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-09
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-22
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-22
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-19
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-14
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-09
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-22
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-21
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-17
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 1e-13
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 4e-08
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 1e-22
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-17
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-14
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 7e-12
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-22
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-17
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-14
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-11
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-07
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-22
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-19
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 1e-18
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 9e-16
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 8e-12
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-22
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-22
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 7e-16
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 1e-12
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 6e-11
3khf_A99 Microtubule-associated serine/threonine-protein ki 3e-22
3khf_A99 Microtubule-associated serine/threonine-protein ki 6e-18
3khf_A99 Microtubule-associated serine/threonine-protein ki 3e-13
3khf_A99 Microtubule-associated serine/threonine-protein ki 7e-11
3khf_A99 Microtubule-associated serine/threonine-protein ki 9e-08
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-22
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 3e-13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 4e-13
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 5e-07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-22
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-21
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 6e-15
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-12
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-10
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-22
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-19
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 3e-14
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 3e-12
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-09
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-21
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-20
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 1e-19
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 7e-16
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 4e-11
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-21
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 5e-20
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 5e-17
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-15
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 1e-07
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-21
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 8e-15
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 7e-14
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-11
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-21
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-19
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-17
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 3e-12
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 7e-08
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-21
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 8e-20
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-18
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 1e-12
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 3e-10
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-20
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-18
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 2e-13
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 4e-09
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 8e-07
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 3e-20
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 3e-18
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 2e-13
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 8e-11
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 1e-09
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 4e-20
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 5e-19
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 1e-10
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 2e-10
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-06
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 6e-20
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-17
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-15
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 2e-12
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 7e-20
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-19
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 4e-11
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 1e-10
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 6e-06
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 9e-20
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-18
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-16
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 4e-10
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-19
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-15
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 7e-14
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 5e-09
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-04
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-19
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-13
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 3e-11
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 1e-08
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 7e-04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-19
2eaq_A90 LIM domain only protein 7; conserved hypothetical 3e-18
2eaq_A90 LIM domain only protein 7; conserved hypothetical 6e-15
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-12
2eaq_A90 LIM domain only protein 7; conserved hypothetical 2e-09
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-19
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-14
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-12
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-11
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 8e-09
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 3e-19
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 8e-18
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-14
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-09
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 5e-08
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-19
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-16
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 7e-12
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 6e-07
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 6e-19
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-18
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 8e-16
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 4e-15
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-10
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 7e-19
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-14
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 4e-13
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 7e-13
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 2e-08
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-18
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 8e-14
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-11
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-08
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 4e-04
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-18
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-14
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 3e-09
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 2e-08
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 5e-18
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 1e-17
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 3e-17
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 3e-17
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 4e-17
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 3e-07
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 7e-17
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 2e-16
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 3e-16
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 5e-16
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 8e-16
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-15
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 4e-12
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 6e-07
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 1e-05
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 9e-16
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 1e-15
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 9e-09
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 2e-15
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 2e-09
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 2e-15
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 4e-08
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 2e-15
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 3e-15
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 6e-10
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 3e-15
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 2e-10
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 3e-15
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 5e-15
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 2e-10
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 5e-15
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 3e-13
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-07
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-06
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 5e-15
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 9e-11
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 6e-15
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 2e-09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 7e-15
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 5e-08
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 8e-07
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 7e-15
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 2e-09
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 7e-15
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 8e-06
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 8e-15
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 6e-09
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 9e-15
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 3e-09
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 1e-14
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 3e-09
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-14
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 1e-10
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 9e-10
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-09
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 3e-14
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng 2e-10
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 4e-14
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 6e-14
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 9e-10
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 8e-14
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 5e-10
1ymz_A43 CC45; artificial protein, computational design, un 1e-13
1ymz_A43 CC45; artificial protein, computational design, un 4e-10
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 1e-13
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 1e-08
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 1e-13
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 2e-13
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 3e-08
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 2e-13
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 2e-10
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 2e-13
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 9e-09
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 4e-13
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 2e-09
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 1e-12
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 1e-12
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-07
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 2e-06
1kjw_A295 Postsynaptic density protein 95; protein-protein i 1e-12
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 1e-12
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 3e-12
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 2e-11
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 3e-12
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 6e-05
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-10
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-10
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-09
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 6e-09
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-09
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-05
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 4e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-09
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-06
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 6e-04
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 2e-09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 4e-06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 7e-04
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 2e-09
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 1e-06
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-09
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 6e-09
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 4e-08
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-07
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 6e-09
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 5e-06
2jxw_A75 WW domain-binding protein 4; WW domain containing 1e-08
2jxw_A75 WW domain-binding protein 4; WW domain containing 5e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-07
2hga_A125 Conserved protein MTH1368; GFT structural genomics 2e-05
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 5e-07
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-05
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 2e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 3e-06
2kl1_A94 YLBL protein; structure genomics, structural genom 2e-05
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 3e-06
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 3e-06
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 1e-05
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 5e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 6e-06
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 2e-05
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 9e-06
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 9e-06
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 9e-06
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 4e-04
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 1e-05
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 4e-05
3olm_A429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 2e-05
3k50_A 403 Putative S41 protease; structural genomics, joint 5e-05
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 6e-05
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 3e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 8e-05
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 2e-04
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 2e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 2e-04
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 3e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 4e-04
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 5e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 6e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 7e-04
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 8e-04
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
 Score =  205 bits (522), Expect = 2e-55
 Identities = 97/388 (25%), Positives = 158/388 (40%), Gaps = 60/388 (15%)

Query: 776  KRKESTSFEHEQPLPSNDMRYIPPDNLGLPRVRPTNIKSVEYS-DVMVITLLRQENGFGF 834
            + +++   +H      N     P          P  +   E   +   ITL R  +G GF
Sbjct: 15   QDEDTPPLKHSPAHLPNQANSPPVIVNTDTLEAPGYVNGTEGEMEYEEITLERGNSGLGF 74

Query: 835  RIVGGTE-----EGSQVSIGHIVPGGAADLDGRLCTGDEIVSVDNLSVLNSSHHHVVELM 889
             I GGT+     +   + I  I+PGGAA  DGRL   D I+ V+ + V   +H   VE +
Sbjct: 75   SIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEAL 134

Query: 890  GKASVYGRVTLGIRRKVMPPAETTSMMLGYPYDVTITRRENEGFGFVIISSL------NK 943
             +A     V L + R+  P  +   + L          +  +G GF I   +        
Sbjct: 135  KEAG--SIVRLYVMRRKPPAEKVMEIKL---------IKGPKGLGFSIAGGVGNQHIPGD 183

Query: 944  AGSTIGRIIEDSPADRSGELHLGDHILAVNHVDIMSLHHGEIVNLIKDSGYCVTLTIGAP 1003
                + +IIE   A + G L +GD ILAVN V +  + H + V  +K++   V L +  P
Sbjct: 184  NSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKP 243

Query: 1004 I----------------------------SGDDASSTTSVSAASHREYEEGGEH------ 1029
                                         S       T+++  S R Y    +       
Sbjct: 244  SNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEED 303

Query: 1030 -DEQYHAIELSRGTRGFGFSIRGGREFQNMALFVLQIAENGPAALDGHLKVGDEIVEING 1088
               +   I + RG+ G GF+I GG +     +F+  I   GPA L G L+ GD+I+ +NG
Sbjct: 304  IPREPRRIVIHRGSTGLGFNIVGGED--GEGIFISFILAGGPADLSGELRKGDQILSVNG 361

Query: 1089 INTKNMTHAEAIEIIRNGDSTVRLLIKR 1116
            ++ +N +H +A   ++N   TV ++ + 
Sbjct: 362  VDLRNASHEQAAIALKNAGQTVTIIAQY 389
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Length = 429 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 39 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 55 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1145
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.97
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.97
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 99.94
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.92
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.91
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.9
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.88
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.88
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.88
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.87
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.86
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.84
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.84
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.83
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.83
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.83
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.82
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.81
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.8
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.76
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.74
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.71
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.71
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.7
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.68
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.67
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.65
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.65
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.64
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 99.63
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.62
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 99.57
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.57
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 99.53
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.51
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.51
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.48
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.47
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.47
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.47
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.46
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.44
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.44
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.43
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.43
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.43
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.42
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.42
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.42
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.42
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.41
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.41
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.41
2awx_A105 Synapse associated protein 97; membrane protein, s 99.4
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.4
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.4
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.39
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.39
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.39
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.39
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.39
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.39
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.39
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.38
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.38
2jxw_A75 WW domain-binding protein 4; WW domain containing 99.37
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.37
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.37
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.36
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.36
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.35
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.35
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.35
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.35
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.35
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.35
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.34
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.34
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.34
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.34
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.34
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.34
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.34
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.34
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.33
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.33
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.33
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.33
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.33
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.33
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.32
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.32
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.32
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.32
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.32
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.32
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.32
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.32
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.32
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.31
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.31
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.31
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.31
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.31
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.31
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.31
2awx_A105 Synapse associated protein 97; membrane protein, s 99.31
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.31
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.31
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.31
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.3
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.3
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.3
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 99.3
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.3
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.3
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.3
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.29
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.29
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.29
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.29
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.29
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.29
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.29
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.29
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.29
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.29
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.29
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.29
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 99.29
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.28
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.28
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.28
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.28
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.28
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.28
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.28
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.28
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.28
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.28
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.28
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.28
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.28
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.28
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.28
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.28
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.27
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.27
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.27
2kxq_A90 E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG 99.27
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.27
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.27
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.27
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.27
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.27
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 99.27
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.27
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.27
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.27
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.26
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.26
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 99.26
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.26
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.26
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.26
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.26
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.26
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.26
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.26
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.26
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.26
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.26
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.25
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.25
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.25
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.25
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.25
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.25
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.25
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.25
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 99.25
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.25
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.25
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.25
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.24
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 99.24
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.24
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.24
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.24
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.24
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.24
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.24
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.24
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.24
2ego_A96 General receptor for phosphoinositides 1- associat 99.24
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.24
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.24
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.23
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.23
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.23
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.23
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.23
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.23
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.23
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.23
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.23
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 99.23
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 99.23
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 99.23
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.23
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.22
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.22
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.22
2ego_A96 General receptor for phosphoinositides 1- associat 99.22
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.22
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.21
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.21
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.21
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.21
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.21
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.2
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 99.2
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.2
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.2
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.2
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.2
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.2
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.2
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.2
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.2
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.2
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.2
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.19
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.19
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.19
2d90_A102 PDZ domain containing protein 1; structural genomi 99.19
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.19
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.19
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.19
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.19
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.19
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 99.19
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 99.19
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.18
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.18
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.18
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.18
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.18
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.18
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.18
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.18
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.18
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 99.17
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.17
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 99.17
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 99.17
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.17
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.16
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.16
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.16
2d90_A102 PDZ domain containing protein 1; structural genomi 99.16
1tk7_A88 CG4244-PB; WW domain, notch, signaling protein; NM 99.16
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.16
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.16
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.16
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.16
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.15
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.15
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.14
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.14
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.14
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.13
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 99.13
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.13
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.13
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.12
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.12
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.12
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 99.12
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.11
2dwv_A49 Salvador homolog 1 protein; WW domain, dimer, stru 99.11
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.11
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.11
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.1
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.1
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.1
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.1
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.1
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.1
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.1
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.1
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.1
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.1
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.09
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.09
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.09
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.09
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.09
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.08
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.08
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.08
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.08
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.08
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.07
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.07
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.07
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.07
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.07
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.07
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.07
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.07
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.06
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.06
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.06
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.06
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 99.05
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.05
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.04
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.04
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.04
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.04
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.03
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.03
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 99.03
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.03
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.02
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.02
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.02
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.02
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.02
4dey_A337 Voltage-dependent L-type calcium channel subunit; 99.02
2ysd_A57 Membrane-associated guanylate kinase, WW and PDZ d 99.02
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.01
3l4h_A109 E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d 99.0
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.0
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.99
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.99
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 98.99
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.99
2law_A38 Yorkie homolog; YAP, SMAD1, CDK, signal transducti 98.99
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.99
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.54
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.53
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.98
2ysg_A40 Syntaxin-binding protein 4; synip, STXBP4, WW doma 98.98
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.97
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.97
2djy_A42 SMAD ubiquitination regulatory factor 2; beta shee 98.97
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.96
2ysf_A40 E3 ubiquitin-protein ligase itchy homolog; AIP4, N 98.96
1ymz_A43 CC45; artificial protein, computational design, un 98.96
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.95
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.95
2l4j_A46 YES-associated protein 2 (YAP2); WW domain, medaka 98.95
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.94
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.94
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.94
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.93
2ez5_W46 Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma 98.93
2zaj_A49 Membrane-associated guanylate kinase, WW and PDZ d 98.93
2yse_A60 Membrane-associated guanylate kinase, WW and PDZ d 98.93
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.93
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.92
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.92
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.92
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.92
2ysb_A49 Salvador homolog 1 protein; WW domain, structural 98.92
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.91
1wr7_A41 NEDD4-2; all-beta, ligase; NMR {Mus musculus} 98.91
1wr3_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.9
1wmv_A54 WWOX, WW domain containing oxidoreductase; all-bet 98.89
3kfv_A308 Tight junction protein ZO-3; structural genomics c 98.89
2jmf_A53 E3 ubiquitin-protein ligase suppressor of deltex; 98.89
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.89
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.89
2kyk_A39 E3 ubiquitin-protein ligase itchy homolog; LMP2A, 98.88
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.88
1i5h_W50 Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, 98.88
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.88
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.88
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.87
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.87
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.87
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.86
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.85
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.85
1wr4_A36 Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M 98.84
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.84
2dmv_A43 Itchy homolog E3 ubiquitin protein ligase; WW doma 98.82
2kpz_A49 E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV 98.82
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.8
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.79
1e0m_A37 Wwprototype; SH3 prototype, protein design, de nov 98.78
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.77
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.76
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.74
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 98.73
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 98.73
1ymz_A43 CC45; artificial protein, computational design, un 98.73
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.71
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.7
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.69
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.66
2ysh_A40 GAS-7, growth-arrest-specific protein 7; WW domain 98.65
2ho2_A38 Fe65 protein, amyloid beta A4 protein-binding fami 98.65
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.61
1jmq_A46 YAP65, 65 kDa YES-associated protein; polyproline 98.58
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.56
2l5f_A92 PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA 98.52
2ysc_A39 Amyloid beta A4 precursor protein-binding family B 98.48
3olm_A429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 98.47
1o6w_A75 PRP40, PRE-mRNA processing protein PRP40; WW domai 98.46
2jv4_A54 Peptidyl-prolyl CIS/trans isomerase; ppiase domain 98.38
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 98.36
2e45_A55 Fe65 protein, amyloid beta A4 precursor protein-bi 98.29
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.27
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 98.27
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.25
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.22
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.22
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.18
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.18
2kl1_A94 YLBL protein; structure genomics, structural genom 98.18
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.16
2jxw_A75 WW domain-binding protein 4; WW domain containing 98.16
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.15
2kl1_A94 YLBL protein; structure genomics, structural genom 98.14
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.12
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.1
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.08
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.05
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 98.03
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.03
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.0
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.0
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 97.98
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 97.97
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.96
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 97.87
2jx8_A52 Hpcif1, phosphorylated CTD-interacting factor 1; p 97.86
3k50_A403 Putative S41 protease; structural genomics, joint 97.82
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 97.81
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.79
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.79
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.78
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.78
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.78
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.78
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.77
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 97.77
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 97.75
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.75
3olm_A429 E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S 97.72
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.71
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.7
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.69
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 97.64
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.64
2ysi_A40 Transcription elongation regulator 1; Ca150, FBP28 97.61
3k50_A 403 Putative S41 protease; structural genomics, joint 97.6
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.52
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.46
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.36
1ywi_A41 Formin-binding protein 3; WW domain, class II, pro 97.33
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.3
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.22
1e0l_A37 Formin binding protein; SH3 domain, WW domain, FBP 97.21
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.19
1e0n_A27 Hypothetical protein; YJQ8WW domain, WW domain, sa 97.15
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.84
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.82
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.71
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 96.69
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.61
2dk7_A73 Transcription elongation regulator 1; structural g 96.36
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 96.06
1k32_A 1045 Tricorn protease; protein degradation, substrate g 95.91
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.6
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 95.07
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 94.81
2dk7_A73 Transcription elongation regulator 1; structural g 94.72
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 94.55
2dk1_A50 WW domain-binding protein 4; WBP-4, formin- bindin 94.45
3tlx_A243 Adenylate kinase 2; structural genomics, structura 90.75
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 90.71
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 90.51
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 90.14
3le4_A79 Microprocessor complex subunit DGCR8; WW motif, di 88.4
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 88.16
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 86.84
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 84.58
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=6e-33  Score=348.46  Aligned_cols=232  Identities=19%  Similarity=0.275  Sum_probs=190.9

Q ss_pred             ceEeEEEeCCCCCCCceeeeccccCCCceEEEEecCCccccccCCCCCCcEEEeeCCEEecCCCHHHHHHHHHhhcCCCC
Q psy6910          21 KETPVTLTVPPDGSLNFSVGGGSDSGEFAYVTNINKEKVKGAEKYLEEKAIILEIQGQKVAGYTRRDTIAWLNHCCRSGK  100 (1145)
Q Consensus        21 ~v~~~~~~~~~~g~~~~~i~gg~e~g~~~~v~~i~~~~~~~~sg~l~~GD~i~evng~~v~g~~~~~~~~~l~~~~~~~~  100 (1145)
                      .++.|.|.+.. +.|||+|.|+.+ +.-++|.+|.+|+.|++.|.|++||+|++|||++|.+++.+|+.++|+++   .+
T Consensus       307 ~~~~v~l~~~~-~~lG~~i~~~~~-~~gv~V~~V~~gs~A~~aG~L~~GD~Il~VNg~~v~~~~~~e~~~~l~~~---~~  381 (721)
T 2xkx_A          307 EPRRIVIHRGS-TGLGFNIVGGED-GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNA---GQ  381 (721)
T ss_pred             ceEEEEEEECC-CCccEEEeccCC-CCCeEEEEeCCCChHHhcCCCccCCEEEEECCEECCCCCHHHHHHHHHhc---CC
Confidence            57778888764 569999998755 34578999999999999999999999999999999999999999999998   89


Q ss_pred             cEEEEEecCCc----------------------------cC--------cccchh----------ccccCCCCchHHH--
Q psy6910         101 TLTLRTVSSAY----------------------------VT--------TDLRQF----------LNTRFPKGSVDHD--  132 (1145)
Q Consensus       101 ~v~~~~~p~~~----------------------------~~--------~~~~~~----------~~l~f~k~~i~~~--  132 (1145)
                      .|+|++.....                            .+        +-+-+|          .||+|+||+|++.  
T Consensus       382 ~v~L~v~r~~~~~~~~~~~~~~~~~~~~~~s~~~g~~~~~~~~~~~~~vrAl~dy~~~~d~~~p~~~LsF~~GDil~v~~  461 (721)
T 2xkx_A          382 TVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVID  461 (721)
T ss_pred             eEEEEEEeCchhhhhhhhhhhhhhhhcccccccCCccccccccccceeEEEeeccCcCCCCCCccccccccCCCEEEEee
Confidence            99998863210                            00        011122          3599999999641  


Q ss_pred             --------------------------------------------------------------------------------
Q psy6910         133 --------------------------------------------------------------------------------  132 (1145)
Q Consensus       133 --------------------------------------------------------------------------------  132 (1145)
                                                                                                      
T Consensus       462 ~~~~~WW~a~~~~~~~~~~~~G~iPs~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~Ye~V~~~~~~~~r~vvl~GP~K  541 (721)
T 2xkx_A          462 AGDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTK  541 (721)
T ss_pred             cCCCCeEEEEECCCCCccCccceeecHHHHHHHHhhhcccccccCcchhhcccccCCCceeeecccCCCCCEEEEECCCH
Confidence                                                                                            


Q ss_pred             ------HhhhhccCcceeecccccCCCCCCCcCCccEEEe-CHHHHHHHHHcCCEEEEEEeCCcccCCCccchhhhhcCC
Q psy6910         133 ------LQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFL-SIEEFKQLEKSGCLLESGLYEGNHYGTPKPVKEPYVSLP  205 (1145)
Q Consensus       133 ------l~~~~~~~~~~~~v~~TTR~~r~~E~~g~~Y~fv-s~~~f~~~~~~~~flE~~~~~g~~YGt~~~~i~~~~~~g  205 (1145)
                            |++. .++.|.++|+||||+||+||++|+||||| |+++|++++++|+||||++|+||||||++++|+.++++|
T Consensus       542 ~tl~~~L~~~-~~~~~~~~vs~TTR~~r~gE~~G~dY~Fv~s~~~f~~~i~~~~flE~~~~~g~~YGt~~~~v~~~~~~g  620 (721)
T 2xkx_A          542 DRANDDLLSE-FPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIRAHKFIEAGQYNSHLYGTSVQSVREVAEQG  620 (721)
T ss_pred             HHHHHHHHHh-CccceeecccccccCCCCCccCCceeEEecCHHHHHHHHhcCCceEEEEECCccceeeHHHHHHHHHCC
Confidence                  1122 23458889999999999999999999999 999999999999999999999999999999999999997


Q ss_pred             CCceeeecCCCChhhhhhhhcccccccceeEecCCChhhhhhhhhccCCCCcccccccCCC
Q psy6910         206 QNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKTVNMGNSSDYELNDNNG  266 (1145)
Q Consensus       206 ~~~~~il~~~~~~~~~~~~~~~~~~~~~~ifi~pps~~~l~~rl~~rg~~s~~~i~~~~~~  266 (1145)
                      +  +||||+++  +++++++....+++ +|||.|||+++|++ |++|+++  ++|++|+.+
T Consensus       621 ~--~~ildi~~--~~~~~l~~~~~~p~-~ifi~pps~~~L~~-l~~R~t~--~~~~~rl~~  673 (721)
T 2xkx_A          621 K--HCILDVSA--NAVRRLQAAHLHPI-AIFIRPRSLENVLE-INKRITE--EQARKAFDR  673 (721)
T ss_pred             C--cEEEeCCH--HHHHHHHhcccCCE-EEEEeCCcHHHHHH-HhccCCH--HHHHHHHHH
Confidence            7  99999877  56666654444447 89999999999999 9888854  578877754
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Back     alignment and structure
>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Back     alignment and structure
>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Back     alignment and structure
>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Back     alignment and structure
>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Back     alignment and structure
>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Back     alignment and structure
>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1145
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-32
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-23
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 7e-21
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-14
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-12
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-05
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-24
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-18
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-15
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-14
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-11
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 0.003
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 4e-24
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 5e-20
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 1e-17
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-17
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 8e-11
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 0.003
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 5e-24
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 8e-16
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 3e-15
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 9e-14
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 4e-09
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-23
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-19
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 6e-16
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 9e-14
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 5e-13
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-23
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 7e-15
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 9e-15
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 1e-14
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 8e-10
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 4e-23
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 7e-17
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-16
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-14
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 4e-10
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 5e-23
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 3e-17
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 1e-15
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 6e-15
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 1e-10
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-22
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-14
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 3e-13
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-12
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 2e-08
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 1e-04
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-22
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 7e-18
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 2e-16
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 7e-14
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-07
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 0.002
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 6e-22
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 2e-17
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 3e-16
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-15
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 6e-09
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 7e-22
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 3e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 4e-15
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 5e-14
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 6e-09
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 9e-22
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-16
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-15
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 1e-14
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-08
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 3e-04
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-21
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 3e-16
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 1e-15
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-14
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 5e-07
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-21
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 4e-19
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 2e-16
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 8e-14
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 9e-08
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 0.002
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-21
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 3e-16
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-15
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 3e-15
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 6e-10
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-21
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-21
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-17
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-14
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-11
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-04
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-21
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 2e-12
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 5e-11
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 8e-11
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-07
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-21
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 1e-16
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-13
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 9e-12
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-08
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-21
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 4e-14
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-13
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 2e-12
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 1e-09
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 6e-21
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-16
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 1e-16
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 5e-13
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-10
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-07
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 6e-21
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-17
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-14
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-12
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 8e-11
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 7e-21
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 4e-15
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-14
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 9e-14
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 1e-08
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 7e-21
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-15
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-14
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-13
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-08
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 9e-21
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-14
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-13
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-13
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-07
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-20
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 2e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 5e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 8e-09
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-20
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 2e-20
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-15
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 5e-11
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 1e-06
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 9e-04
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-20
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-13
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-11
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-11
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-06
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-20
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-16
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-15
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 3e-11
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 7e-10
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.001
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 3e-20
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-17
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-16
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 4e-15
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-06
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 2e-04
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 5e-20
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 5e-16
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 5e-15
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-14
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-08
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 1e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-20
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-16
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 4e-15
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-14
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-07
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 0.001
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-20
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-16
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-14
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-13
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-07
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-19
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 3e-15
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 5e-15
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-13
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 3e-08
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-19
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-18
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-17
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-15
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 9e-12
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-19
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-16
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-13
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-11
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-06
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 0.003
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-19
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-13
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 7e-12
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 6e-09
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-06
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 5e-19
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 5e-16
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 7e-16
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-13
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 8e-10
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 0.001
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 6e-19
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 8e-15
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 7e-14
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-13
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 9e-07
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 7e-04
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 7e-19
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-16
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 3e-16
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-13
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-09
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-19
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-15
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-13
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-11
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-07
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 1e-18
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-17
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 3e-16
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 8e-14
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 5e-09
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 1e-04
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 1e-18
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 7e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 7e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-18
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-18
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 3e-12
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-11
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-08
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 2e-06
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-18
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-12
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 1e-11
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 6e-11
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-06
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 3e-04
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-18
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 7e-15
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 8e-14
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 4e-13
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 3e-08
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 3e-18
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-12
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 2e-11
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-05
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 5e-18
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 1e-13
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 7e-13
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-12
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 3e-05
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 6e-18
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 6e-16
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 5e-11
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 6e-11
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 3e-04
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-17
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-15
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-13
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 1e-10
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-07
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-05
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-17
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-13
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-13
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-11
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-06
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 7e-17
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-15
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 2e-14
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-13
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-07
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-16
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 3e-14
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 5e-14
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 1e-12
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 2e-06
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-06
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-16
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-15
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-12
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 3e-12
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 1e-05
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-15
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-14
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 4e-11
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-10
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 7e-07
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-15
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 1e-14
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-13
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-11
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-07
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 2e-15
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 6e-13
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-11
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 1e-09
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 3e-05
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 7e-05
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 3e-15
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 2e-14
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 4e-12
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 5e-11
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 3e-04
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-15
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-12
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 1e-11
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-10
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 9e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 6e-14
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-12
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-11
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-10
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-04
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 8e-14
d1tk7a145 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) 1e-10
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 3e-13
d1i5hw_50 b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain 6e-11
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 3e-13
d2jmfa133 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII 1e-09
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 2e-12
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 2e-10
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 5e-07
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 6e-12
d1jmqa_46 b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens 7e-11
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 2e-09
d1pina134 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho 4e-07
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 3e-09
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 1e-08
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 2e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 1e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 2e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 3e-05
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 0.002
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 5e-06
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 0.002
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 1e-05
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 1e-04
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 9e-05
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-04
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-04
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 0.001
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 0.001
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  118 bits (298), Expect = 5e-32
 Identities = 61/111 (54%), Positives = 84/111 (75%), Gaps = 1/111 (0%)

Query: 424 FFTLNPDELIGERIHSSLVKSLRGLGFTIVGGDDSKEEFLQIKSVVPNGPAALEGHLQTG 483
            FT +  +L G  + ++L KS  G GFTI+GGD+  E FLQ+KSV+P+GPAA +G ++TG
Sbjct: 8   LFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDE-FLQVKSVIPDGPAAQDGKMETG 66

Query: 484 DVLVYVNDKCVLGYTHHDMVSVFQSISPGETVQLEVCRGYPLPFDPNDPNT 534
           DV+VY+N+ CVLG+TH D+V +FQS+  G++V L +CRGYPLPFDP DP  
Sbjct: 67  DVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPAN 117
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1145
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.96
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.91
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.91
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.91
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.9
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.9
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.82
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.71
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.69
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.69
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.68
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.67
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.66
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.66
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.65
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.65
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.64
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.62
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.61
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.61
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.61
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.6
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.59
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.59
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.59
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.58
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.58
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.58
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.57
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.57
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.56
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.56
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.56
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.55
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.55
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.55
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.55
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.55
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.54
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.54
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.54
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.54
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.54
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.53
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.53
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.53
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.53
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.52
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.52
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.52
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.52
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.52
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.52
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.51
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.51
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.51
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.51
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.51
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.5
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.5
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.5
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.5
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.49
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.49
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.49
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.49
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.48
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.48
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.48
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.48
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.48
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.48
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.48
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.47
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.47
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.46
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.46
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.46
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.46
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.45
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.45
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.44
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.44
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.44
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.44
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.44
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.43
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.43
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.42
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.42
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.41
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.41
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.41
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.4
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.38
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.38
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.37
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.37
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.37
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.36
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.35
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.34
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.34
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.34
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.34
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.33
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.32
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.32
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.32
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.3
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.26
d2jmfa133 Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr 99.24
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.23
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.23
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.19
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.13
d1tk7a145 Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso 99.08
d1i5hw_50 Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n 99.06
d1jmqa_46 Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 99.0
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 98.97
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.79
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.74
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.67
d1pina134 Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId 98.66
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.51
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.49
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.41
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.36
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.29
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 98.25
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.17
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.17
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.14
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.11
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.1
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.09
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.02
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.01
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 98.01
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 98.0
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 97.99
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 97.9
d2rm0w137 Formin binding protein FBP28 domain {Domestic mous 97.8
d1o6wa246 Splicing factor prp40 {Baker's yeast (Saccharomyce 97.65
d1o6wa129 Splicing factor prp40 {Baker's yeast (Saccharomyce 97.51
d1ywia128 Huntingtin-interacting protein HYPA/FBP11 {Human ( 97.49
d2ho2a133 Amyloid beta A4 precursor protein-binding family B 97.46
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 97.32
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 97.2
d2dk1a138 WW domain-binding protein 4, WBP4 {Human (Homo sap 96.66
d1eg3a338 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 92.23
d2ysca126 Amyloid beta A4 precursor protein-binding family B 91.76
d2ysca126 Amyloid beta A4 precursor protein-binding family B 86.79
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=1e-30  Score=275.39  Aligned_cols=150  Identities=23%  Similarity=0.201  Sum_probs=139.3

Q ss_pred             CCcEEEEEecCCccCcccchhccccCCCCchHHHHhhhhccCcceeecccccCCCCCCCcCCccEEEeCHHHHHHHHHcC
Q psy6910          99 GKTLTLRTVSSAYVTTDLRQFLNTRFPKGSVDHDLQNIIRDNLYLRTVPVTTRTPRDGELNGVDYTFLSIEEFKQLEKSG  178 (1145)
Q Consensus        99 ~~~v~~~~~p~~~~~~~~~~~~~l~f~k~~i~~~l~~~~~~~~~~~~v~~TTR~~r~~E~~g~~Y~fvs~~~f~~~~~~~  178 (1145)
                      +|.|.+.++||+++             |++|.+.|++.++...|.++|+||||+||+||++|+||||||+++|++|+++|
T Consensus         1 ~G~livi~GPSG~G-------------K~tl~~~L~~~~p~~~~~~~is~TTR~~R~~E~~G~dY~Fvs~~~F~~~i~~g   67 (205)
T d1s96a_           1 QGTLYIVSAPSGAG-------------KSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRD   67 (205)
T ss_dssp             CCCEEEEECCTTSC-------------HHHHHHHHHHHSCTTTEEECCCEECSCCCTTCCBTTTBEECCHHHHHHHHHTT
T ss_pred             CCeEEEEECCCCCC-------------HHHHHHHHHhhCCccCceEEEEEeccCCCccccccccceeecHHHHHHHhhhh
Confidence            58899999999997             88999999998532357789999999999999999999999999999999999


Q ss_pred             CEEEEEEeCCcccCCCccchhhhhcCCCCceeeecCCCChhhhhhhhcccccccceeEecCCChhhhhhhhhccCCCCcc
Q psy6910         179 CLLESGLYEGNHYGTPKPVKEPYVSLPQNVNLLPGAHPSSEGKRKRNRSNVEAMASKSIEPDMKTNGFDNKTVNMGNSSD  258 (1145)
Q Consensus       179 ~flE~~~~~g~~YGt~~~~i~~~~~~g~~~~~il~~~~~~~~~~~~~~~~~~~~~~ifi~pps~~~l~~rl~~rg~~s~~  258 (1145)
                      +|+||++|+||+|||++++|+.++++|+  +||+|+++  +++..+++.+++++ +|||.||+.++|++||++||+++++
T Consensus        68 ~flE~~~~~g~~YGt~~~~v~~~~~~g~--~~ildid~--~g~~~lk~~~~~~~-~ifi~pps~~~l~~RL~~Rg~~~~~  142 (205)
T d1s96a_          68 AFLEHAEVFGNYYGTSREAIEQVLATGV--DVFLDIDW--QGAQQIRQKMPHAR-SIFILPPSKIELDRRLRGRGQDSEE  142 (205)
T ss_dssp             CEEEEEEETTEEEEEEHHHHHHHHTTTC--EEEEECCH--HHHHHHHHHCTTCE-EEEEECSSHHHHHHHHHTTSCSCHH
T ss_pred             hheeEEEECCceeccccchHHHHHhcCC--ceeecCcH--HHHHHHHhhhcccc-eeeeeccchHHHHHHHHhcCCchHH
Confidence            9999999999999999999999999988  99999777  78899999999998 9999999999999999999999999


Q ss_pred             cccccCCC
Q psy6910         259 YELNDNNG  266 (1145)
Q Consensus       259 ~i~~~~~~  266 (1145)
                      .|++|+.+
T Consensus       143 ~i~~Rl~~  150 (205)
T d1s96a_         143 VIAKRMAQ  150 (205)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99987753
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure