Psyllid ID: psy6919
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 638 | 2.2.26 [Sep-21-2011] | |||||||
| P50747 | 726 | Biotin--protein ligase OS | yes | N/A | 0.465 | 0.409 | 0.372 | 2e-50 | |
| Q920N2 | 722 | Biotin--protein ligase OS | yes | N/A | 0.449 | 0.397 | 0.377 | 5e-50 | |
| O14353 | 631 | Biotin--protein ligase OS | yes | N/A | 0.415 | 0.419 | 0.307 | 4e-29 | |
| Q9VAI0 | 219 | Probable glucosamine 6-ph | no | N/A | 0.141 | 0.410 | 0.566 | 1e-25 | |
| P48445 | 690 | Biotin--protein ligase OS | yes | N/A | 0.407 | 0.376 | 0.275 | 4e-19 | |
| Q5RAL9 | 184 | Glucosamine 6-phosphate N | no | N/A | 0.136 | 0.472 | 0.517 | 1e-15 | |
| Q96EK6 | 184 | Glucosamine 6-phosphate N | no | N/A | 0.136 | 0.472 | 0.517 | 1e-15 | |
| Q9JK38 | 184 | Glucosamine 6-phosphate N | no | N/A | 0.136 | 0.472 | 0.517 | 1e-15 | |
| Q9LFU9 | 149 | Glucosamine 6-phosphate N | no | N/A | 0.137 | 0.590 | 0.393 | 6e-13 | |
| Q17427 | 165 | Glucosamine 6-phosphate N | no | N/A | 0.134 | 0.521 | 0.402 | 1e-12 |
| >sp|P50747|BPL1_HUMAN Biotin--protein ligase OS=Homo sapiens GN=HLCS PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 201 bits (510), Expect = 2e-50, Method: Compositional matrix adjust.
Identities = 124/333 (37%), Positives = 202/333 (60%), Gaps = 36/333 (10%)
Query: 323 RHLNTK---KLGQLMKKMELEFCQSAASRAP-SEAYMPILVN-EAPSD--FNVDEYYRHL 375
+H++++ K GQL L F S S + + +P++ N EA S FN++ Y ++L
Sbjct: 405 KHVDSEGEIKSGQL----SLRFVSSYVSEVEITPSCIPVVTNMEAFSSEHFNLEIYRQNL 460
Query: 376 NTKKLGQLVIYSGVMSSSHNVLDG-----PTLLHGLTVIPRQQTQGTGRSNNIWLSPPGC 430
TK+LG++++++ V ++ +LDG P + GL VI +QT+G GR N+WLSP GC
Sbjct: 461 QTKQLGKVILFAEVTPTTMRLLDGLMFQTPQEM-GLIVIAARQTEGKGRGGNVWLSPVGC 519
Query: 431 AMFSMQLHIDLKSQLGKHLPLIQHIVAISIVLAVKSFN--QDIDLGIKWPNDLYVNGNVK 488
A+ ++ + I L+SQLG+ +P +QH++++++V AV+S QDI+L +KWPND+Y + +K
Sbjct: 520 ALSTLLISIPLRSQLGQRIPFVQHLMSVAVVEAVRSIPEYQDINLRVKWPNDIYYSDLMK 579
Query: 489 LGGIIVTSSILS-TFESQMAVCNIGVGMNLDNSQPTTCLNSI---FSANPSSPL--LSYE 542
+GG++V S+++ TF IG G N+ NS PT C+N + ++ + L L +
Sbjct: 580 IGGVLVNSTLMGETF-----YILIGCGFNVTNSNPTICINDLITEYNKQHKAELKPLRAD 634
Query: 543 QYFALVFNHLEQLMEGDFDE----IYDLYYKHWLHNNVNVTVVSERGEAQQVKIIGIDDF 598
A V LE+L++ D+ + LYY++W+H+ V + S E +V I+G+DD
Sbjct: 635 YLIARVVTVLEKLIKEFQDKGPNSVLPLYYRYWVHSGQQVHLGS--AEGPKVSIVGLDDS 692
Query: 599 GFLNVRSEEGYIFSVRPDGNTFDMLNGLIAPKQ 631
GFL V E G + +V PDGN+FDML LI PK+
Sbjct: 693 GFLQVHQEGGEVVTVHPDGNSFDMLRNLILPKR 725
|
Post-translational modification of specific protein by attachment of biotin. Acts on various carboxylases such as acetyl-CoA-carboxylase, pyruvate carboxylase, propionyl CoA carboxylase, and 3-methylcrotonyl CoA carboxylase. Homo sapiens (taxid: 9606) EC: 6EC: .EC: 3EC: .EC: 4EC: .EC: 1EC: 5 |
| >sp|Q920N2|BPL1_MOUSE Biotin--protein ligase OS=Mus musculus GN=Hlcs PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O14353|BPL1_SCHPO Biotin--protein ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpl1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q9VAI0|GNA1_DROME Probable glucosamine 6-phosphate N-acetyltransferase OS=Drosophila melanogaster GN=CG1969 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P48445|BPL1_YEAST Biotin--protein ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RAL9|GNA1_PONAB Glucosamine 6-phosphate N-acetyltransferase OS=Pongo abelii GN=GNPNAT1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q96EK6|GNA1_HUMAN Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens GN=GNPNAT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9JK38|GNA1_MOUSE Glucosamine 6-phosphate N-acetyltransferase OS=Mus musculus GN=Gnpnat1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LFU9|GNA1_ARATH Glucosamine 6-phosphate N-acetyltransferase OS=Arabidopsis thaliana GN=GNA1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q17427|GNA1_CAEEL Glucosamine 6-phosphate N-acetyltransferase OS=Caenorhabditis elegans GN=gna-1 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 638 | ||||||
| 350420827 | 988 | PREDICTED: biotin--protein ligase-like [ | 0.459 | 0.296 | 0.488 | 1e-86 | |
| 380021701 | 939 | PREDICTED: LOW QUALITY PROTEIN: biotin-- | 0.459 | 0.312 | 0.478 | 2e-85 | |
| 328787781 | 803 | PREDICTED: biotin--protein ligase [Apis | 0.459 | 0.364 | 0.472 | 4e-83 | |
| 383857948 | 987 | PREDICTED: biotin--protein ligase-like [ | 0.456 | 0.294 | 0.475 | 1e-82 | |
| 193627250 | 1024 | PREDICTED: biotin--protein ligase-like [ | 0.460 | 0.287 | 0.495 | 2e-81 | |
| 345493341 | 995 | PREDICTED: biotin--protein ligase-like [ | 0.454 | 0.291 | 0.467 | 3e-80 | |
| 189238122 | 893 | PREDICTED: similar to CG14670 CG14670-PA | 0.454 | 0.324 | 0.460 | 4e-78 | |
| 194741716 | 1031 | GF17255 [Drosophila ananassae] gi|190626 | 0.456 | 0.282 | 0.457 | 1e-76 | |
| 195391972 | 1009 | GJ22700 [Drosophila virilis] gi|19415271 | 0.454 | 0.287 | 0.449 | 3e-76 | |
| 307199099 | 756 | Biotin--protein ligase [Harpegnathos sal | 0.459 | 0.387 | 0.455 | 5e-76 |
| >gi|350420827|ref|XP_003492639.1| PREDICTED: biotin--protein ligase-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 327 bits (838), Expect = 1e-86, Method: Compositional matrix adjust.
Identities = 151/309 (48%), Positives = 221/309 (71%), Gaps = 16/309 (5%)
Query: 334 MKKMELEFCQSAASRAPSEA-YMPILVNEAPSDFNVDEYYRHLNTKKLGQLVIYSGVMSS 392
M K+E++FC+S+ P+ A ++PI++++ P +F+ EY+ +L+TK+LG+LVIY +M+S
Sbjct: 684 MPKLEIQFCRSSTVPRPASALFLPIMIHQCPDNFSTVEYFENLSTKELGRLVIYVDIMTS 743
Query: 393 SHNVLDGPTLLHGLTVIPRQQTQGTGRSNNIWLSPPGCAMFSMQLHIDLKSQLGKHLPLI 452
S +V +G L HGL VI RQQTQG GRS NIWLSP G A+F++QLH+ + LG+ + ++
Sbjct: 744 SMDVFNGHQLGHGLAVIVRQQTQGRGRSKNIWLSPKGAALFTLQLHVPTDTILGRRISIL 803
Query: 453 QHIVAISIVLAVKSFN--QDIDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQMAVCN 510
QH+V+++I+ A KS + +DIDL +KWPND+Y NVK+GG+IV + IL S + +CN
Sbjct: 804 QHLVSVAIISAFKSLSGYEDIDLRLKWPNDIYAGNNVKIGGLIVETHIL----SDLNICN 859
Query: 511 IGVGMNLDNSQPTTCLNSIFSA-----NPSSPLLSYEQYFALVFNHLEQLME----GDFD 561
+GVG+NL N +PT C+N I + ++SYEQYFA+VFN +E+ + G+ D
Sbjct: 860 VGVGINLFNKEPTCCINDIVTTFNEIYQKKLEMISYEQYFAIVFNEIERWLNIVQSGNID 919
Query: 562 EIYDLYYKHWLHNNVNVTVVSERGEAQQVKIIGIDDFGFLNVRSEEGYIFSVRPDGNTFD 621
+ D YY +W+H + NVTV+S G +Q VKI+GIDD+G+L VR E+G +F+V PDGNTFD
Sbjct: 920 DFLDAYYTYWMHTDTNVTVLSASGVSQNVKILGIDDYGYLRVRGEDGTMFTVHPDGNTFD 979
Query: 622 MLNGLIAPK 630
L GLIAPK
Sbjct: 980 CLKGLIAPK 988
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380021701|ref|XP_003694696.1| PREDICTED: LOW QUALITY PROTEIN: biotin--protein ligase-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328787781|ref|XP_395226.3| PREDICTED: biotin--protein ligase [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383857948|ref|XP_003704465.1| PREDICTED: biotin--protein ligase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|193627250|ref|XP_001952712.1| PREDICTED: biotin--protein ligase-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345493341|ref|XP_001604369.2| PREDICTED: biotin--protein ligase-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|189238122|ref|XP_001814185.1| PREDICTED: similar to CG14670 CG14670-PA [Tribolium castaneum] gi|270008816|gb|EFA05264.1| hypothetical protein TcasGA2_TC015419 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194741716|ref|XP_001953333.1| GF17255 [Drosophila ananassae] gi|190626392|gb|EDV41916.1| GF17255 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195391972|ref|XP_002054633.1| GJ22700 [Drosophila virilis] gi|194152719|gb|EDW68153.1| GJ22700 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|307199099|gb|EFN79809.1| Biotin--protein ligase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 638 | ||||||
| FB|FBgn0037332 | 1041 | Hcs "Holocarboxylase synthetas | 0.452 | 0.277 | 0.441 | 2.1e-70 | |
| ZFIN|ZDB-GENE-030131-5333 | 840 | hlcs "holocarboxylase syntheta | 0.404 | 0.307 | 0.389 | 1.4e-56 | |
| UNIPROTKB|P50747 | 726 | HLCS "Biotin--protein ligase" | 0.470 | 0.413 | 0.363 | 6.9e-53 | |
| RGD|1565360 | 723 | Hlcs "holocarboxylase syntheta | 0.520 | 0.459 | 0.343 | 8.3e-51 | |
| UNIPROTKB|E2RDP8 | 724 | HLCS "Uncharacterized protein" | 0.452 | 0.399 | 0.376 | 1.7e-50 | |
| MGI|MGI:894646 | 722 | Hlcs "holocarboxylase syntheta | 0.517 | 0.457 | 0.346 | 2.8e-50 | |
| UNIPROTKB|E1C4U9 | 712 | HLCS "Uncharacterized protein" | 0.449 | 0.403 | 0.379 | 5.8e-50 | |
| UNIPROTKB|F1MJL3 | 732 | HLCS "Uncharacterized protein" | 0.452 | 0.394 | 0.386 | 1.4e-48 | |
| TAIR|locus:2029642 | 329 | HCS2 "holocarboxylase syntheta | 0.412 | 0.799 | 0.352 | 8.6e-45 | |
| UNIPROTKB|F1SGX0 | 248 | HLCS "Uncharacterized protein" | 0.347 | 0.895 | 0.418 | 2.4e-44 |
| FB|FBgn0037332 Hcs "Holocarboxylase synthetase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 716 (257.1 bits), Expect = 2.1e-70, P = 2.1e-70
Identities = 136/308 (44%), Positives = 203/308 (65%)
Query: 337 MELEFCQSAASRAP--SEAYMPILVNEAPSDFNVDEYYRHLNTKKLGQLVIYSGVMSSSH 394
+ ++FC + P + +PIL++ P DF+ +Y+ +L T+ +G+LVIY+ V+SSS
Sbjct: 737 LTMKFC-GKDDKPPVANNNVLPILIHSCPDDFSTVDYFDNLKTEHIGRLVIYAPVVSSSM 795
Query: 395 NVLDGPTLLHGLTVIPRQQTQGTGRSNNIWLSPPGCAMFSMQLHIDLKSQLGKHLPLIQH 454
++++ L+HGL V+P QQT G GR NN WLSPPGCAMFS+QLH+ + S L LPL+QH
Sbjct: 796 HLINNLELIHGLAVLPVQQTSGVGRRNNQWLSPPGCAMFSLQLHLTMDSALSSRLPLLQH 855
Query: 455 IVAISIVLAVKSFNQD--IDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQMAVCNIG 512
+V +IV +++S + +D+ IKWPND+Y NGN K+GG+++ + T + A+ NIG
Sbjct: 856 LVGTAIVNSLRSHEEYGVLDISIKWPNDIYANGNQKIGGLVINT----TLQGSQAIVNIG 911
Query: 513 VGMNLDNSQPTTCLNSIFSA------NPSSPLLSYEQYFALVFNHLEQLM----EGDFDE 562
G+NL+NS+PT C+N + N P+L YE A++FN +E+L+ GDFD
Sbjct: 912 SGINLNNSRPTVCINDLIREYNTRVPNNKLPILKYELLIAMIFNEIERLLGEVQNGDFDS 971
Query: 563 IYDLYYKHWLHNNVNVTVVSERGEAQQVKIIGIDDFGFLNVRSEEGYIFSVRPDGNTFDM 622
Y LYY WLH+ +V + ++ + ++ +I+GIDDFGFL V+ G I V+PDGN+FDM
Sbjct: 972 FYALYYSLWLHSGQSVKICLQKDQEKEAEIVGIDDFGFLEVKLPTGTIEIVQPDGNSFDM 1031
Query: 623 LNGLIAPK 630
L GLI PK
Sbjct: 1032 LKGLIIPK 1039
|
|
| ZFIN|ZDB-GENE-030131-5333 hlcs "holocarboxylase synthetase (biotin-(proprionyl-Coenzyme A-carboxylase (ATP-hydrolysing)) ligase)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P50747 HLCS "Biotin--protein ligase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1565360 Hlcs "holocarboxylase synthetase (biotin-(proprionyl-CoA-carboxylase (ATP-hydrolysing)) ligase)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDP8 HLCS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:894646 Hlcs "holocarboxylase synthetase (biotin- [propriony-Coenzyme A-carboxylase (ATP-hydrolysing)] ligase)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C4U9 HLCS "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MJL3 HLCS "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2029642 HCS2 "holocarboxylase synthetase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGX0 HLCS "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.3.1.181 | LOW CONFIDENCE prediction! |
| 3rd Layer | 2.3.1 | LOW CONFIDENCE prediction! |
| 3rd Layer | 6.3.4.9 | LOW CONFIDENCE prediction! |
| 3rd Layer | 6.3.4 | 0.691 |
| 3rd Layer | 6.3.4.15 | 0.737 |
| 3rd Layer | 6.3.4.10 | LOW CONFIDENCE prediction! |
| 3rd Layer | 6.3.4.11 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 638 | |||
| COG0340 | 238 | COG0340, BirA, Biotin-(acetyl-CoA carboxylase) lig | 1e-31 | |
| TIGR00121 | 237 | TIGR00121, birA_ligase, birA, biotin-[acetyl-CoA-c | 5e-25 | |
| PLN02706 | 150 | PLN02706, PLN02706, glucosamine 6-phosphate N-acet | 6e-25 | |
| PRK08330 | 236 | PRK08330, PRK08330, biotin--protein ligase; Provis | 7e-14 | |
| PRK11886 | 319 | PRK11886, PRK11886, bifunctional biotin--[acetyl-C | 2e-13 | |
| PTZ00330 | 147 | PTZ00330, PTZ00330, acetyltransferase; Provisional | 9e-13 | |
| pfam03099 | 124 | pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B prote | 3e-12 | |
| PRK08477 | 211 | PRK08477, PRK08477, biotin--protein ligase; Provis | 2e-10 | |
| PRK06955 | 300 | PRK06955, PRK06955, biotin--protein ligase; Provis | 1e-07 | |
| PTZ00276 | 245 | PTZ00276, PTZ00276, biotin/lipoate protein ligase; | 1e-07 | |
| PRK13325 | 592 | PRK13325, PRK13325, bifunctional biotin--[acetyl-C | 5e-07 | |
| pfam00583 | 80 | pfam00583, Acetyltransf_1, Acetyltransferase (GNAT | 2e-05 | |
| cd04301 | 65 | cd04301, NAT_SF, N-Acyltransferase superfamily: Va | 1e-04 | |
| PRK05935 | 190 | PRK05935, PRK05935, biotin--protein ligase; Provis | 2e-04 |
| >gnl|CDD|223417 COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] | Back alignment and domain information |
|---|
Score = 122 bits (309), Expect = 1e-31
Identities = 55/223 (24%), Positives = 87/223 (39%), Gaps = 12/223 (5%)
Query: 405 GLTVIPRQQTQGTGRSNNIWLSPPG-CAMFSMQLHIDLKSQLGKHLPLIQHIVAISIVLA 463
G V+ +QT G GR W SP G S+ L DL LP + + +++ A
Sbjct: 22 GTVVVAEEQTAGRGRRGRKWSSPKGGGLYMSLLLRPDLPPA---ELPSLSLVAGLAVAEA 78
Query: 464 VKSFNQDIDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQMAVCNIGVGMNLDNSQPT 523
++ F ID+ IKWPND+ +NG KL GI+V + V IG+ +N
Sbjct: 79 LRKFG--IDVRIKWPNDVLLNGK-KLAGILVEAVG-DENGLLAVVVGIGINVNNPPPDFE 134
Query: 524 TCLNSIFSANPSSPLLSYEQYFALVFNHLE----QLMEGDFDEIYDLYYKHWLHNNVNVT 579
S + E+ A + LE Q + F I + L V
Sbjct: 135 DIGQPATSLQEEGEEIDREELLAKLLKELEKYLRQFLREGFAPILARWRARSLSLGKEVR 194
Query: 580 VVSERGEAQQVKIIGIDDFGFLNVRSEEGYIFSVRPDGNTFDM 622
+ G GID+ G L + +++G + ++ +
Sbjct: 195 LTLGGGVIFGGIAKGIDEDGALLLETDDGEVQTIYSGEVSLRR 237
|
Length = 238 |
| >gnl|CDD|232834 TIGR00121, birA_ligase, birA, biotin-[acetyl-CoA-carboxylase] ligase region | Back alignment and domain information |
|---|
| >gnl|CDD|178308 PLN02706, PLN02706, glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|169384 PRK08330, PRK08330, biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237010 PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140351 PTZ00330, PTZ00330, acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217367 pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B protein ligase family | Back alignment and domain information |
|---|
| >gnl|CDD|236273 PRK08477, PRK08477, biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235896 PRK06955, PRK06955, biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140302 PTZ00276, PTZ00276, biotin/lipoate protein ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183976 PRK13325, PRK13325, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family | Back alignment and domain information |
|---|
| >gnl|CDD|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >gnl|CDD|235649 PRK05935, PRK05935, biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 638 | |||
| KOG1536|consensus | 649 | 100.0 | ||
| COG0340 | 238 | BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenz | 100.0 | |
| PRK06955 | 300 | biotin--protein ligase; Provisional | 100.0 | |
| TIGR00121 | 237 | birA_ligase birA, biotin-[acetyl-CoA-carboxylase] | 100.0 | |
| PRK08330 | 236 | biotin--protein ligase; Provisional | 100.0 | |
| PTZ00275 | 285 | biotin-acetyl-CoA-carboxylase ligase; Provisional | 100.0 | |
| PRK11886 | 319 | bifunctional biotin--[acetyl-CoA-carboxylase] synt | 100.0 | |
| PRK13325 | 592 | bifunctional biotin--[acetyl-CoA-carboxylase] liga | 100.0 | |
| PTZ00276 | 245 | biotin/lipoate protein ligase; Provisional | 100.0 | |
| PRK08477 | 211 | biotin--protein ligase; Provisional | 100.0 | |
| PRK05935 | 190 | biotin--protein ligase; Provisional | 100.0 | |
| PF03099 | 125 | BPL_LplA_LipB: Biotin/lipoate A/B protein ligase f | 99.83 | |
| KOG3396|consensus | 150 | 99.69 | ||
| PHA00673 | 154 | acetyltransferase domain containing protein | 99.52 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 99.44 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 99.32 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 99.26 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 99.22 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 99.1 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 99.09 | |
| KOG3139|consensus | 165 | 99.07 | ||
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 99.06 | |
| KOG3216|consensus | 163 | 99.05 | ||
| PF09825 | 367 | BPL_N: Biotin-protein ligase, N terminal; InterPro | 99.03 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 99.01 | |
| PHA01807 | 153 | hypothetical protein | 99.01 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 99.0 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 99.0 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 98.99 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 98.99 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 98.98 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 98.97 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 98.96 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 98.96 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 98.96 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 98.94 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 98.94 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 98.94 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 98.92 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 98.92 | |
| KOG3397|consensus | 225 | 98.85 | ||
| PLN02825 | 515 | amino-acid N-acetyltransferase | 98.83 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 98.83 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 98.78 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 98.78 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 98.75 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 98.73 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 98.73 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 98.72 | |
| COG1246 | 153 | ArgA N-acetylglutamate synthase and related acetyl | 98.7 | |
| COG3153 | 171 | Predicted acetyltransferase [General function pred | 98.69 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 98.66 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 98.66 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 98.64 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 98.63 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 98.62 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.59 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 98.59 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 98.57 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 98.56 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 98.52 | |
| KOG3234|consensus | 173 | 98.5 | ||
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 98.43 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 98.36 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 98.31 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 98.3 | |
| KOG3235|consensus | 193 | 98.29 | ||
| COG2153 | 155 | ElaA Predicted acyltransferase [General function p | 98.22 | |
| TIGR01211 | 522 | ELP3 histone acetyltransferase, ELP3 family. The S | 98.16 | |
| KOG2488|consensus | 202 | 98.16 | ||
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 98.04 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 98.02 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 97.92 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 97.88 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 97.69 | |
| KOG3138|consensus | 187 | 97.68 | ||
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 97.4 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 97.25 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 97.21 | |
| COG3981 | 174 | Predicted acetyltransferase [General function pred | 97.15 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 97.1 | |
| PF13480 | 142 | Acetyltransf_6: Acetyltransferase (GNAT) domain | 96.8 | |
| COG3053 | 352 | CitC Citrate lyase synthetase [Energy production a | 96.75 | |
| COG4552 | 389 | Eis Predicted acetyltransferase involved in intrac | 96.56 | |
| PF12746 | 265 | GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S | 96.38 | |
| KOG4144|consensus | 190 | 95.73 | ||
| COG3818 | 167 | Predicted acetyltransferase, GNAT superfamily [Gen | 95.5 | |
| PF06852 | 181 | DUF1248: Protein of unknown function (DUF1248); In | 95.19 | |
| KOG4135|consensus | 185 | 95.1 | ||
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 93.66 | |
| COG1243 | 515 | ELP3 Histone acetyltransferase [Transcription / Ch | 93.57 | |
| PRK13834 | 207 | putative autoinducer synthesis protein; Provisiona | 92.97 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 92.7 | |
| TIGR03694 | 241 | exosort_acyl putative PEP-CTERM/exosortase system- | 92.49 | |
| PF04377 | 128 | ATE_C: Arginine-tRNA-protein transferase, C termin | 92.01 | |
| PF04958 | 342 | AstA: Arginine N-succinyltransferase beta subunit; | 91.99 | |
| PF00765 | 182 | Autoind_synth: Autoinducer synthetase; InterPro: I | 91.9 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 91.46 | |
| PRK10456 | 344 | arginine succinyltransferase; Provisional | 90.53 | |
| COG3375 | 266 | Uncharacterized conserved protein [Function unknow | 90.44 | |
| TIGR03244 | 336 | arg_catab_AstA arginine N-succinyltransferase. In | 90.44 | |
| PF01853 | 188 | MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i | 90.35 | |
| KOG2535|consensus | 554 | 89.58 | ||
| PF01233 | 162 | NMT: Myristoyl-CoA:protein N-myristoyltransferase, | 89.44 | |
| TIGR03243 | 335 | arg_catab_AOST arginine and ornithine succinyltran | 89.36 | |
| TIGR03245 | 336 | arg_AOST_alph arginine/ornithine succinyltransfera | 88.83 | |
| PF08444 | 89 | Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt | 87.61 | |
| PLN03238 | 290 | probable histone acetyltransferase MYST; Provision | 86.76 | |
| PRK01305 | 240 | arginyl-tRNA-protein transferase; Provisional | 85.01 | |
| PRK14348 | 221 | lipoate-protein ligase B; Provisional | 84.54 | |
| TIGR03019 | 330 | pepcterm_femAB FemAB-related protein, PEP-CTERM sy | 84.22 | |
| KOG2696|consensus | 403 | 81.78 | ||
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 81.42 | |
| TIGR00545 | 324 | lipoyltrans lipoyltransferase and lipoate-protein | 80.74 | |
| PTZ00064 | 552 | histone acetyltransferase; Provisional | 80.52 | |
| PLN03239 | 351 | histone acetyltransferase; Provisional | 80.49 | |
| cd04264 | 99 | DUF619-NAGS DUF619 domain of various N-acetylgluta | 80.08 |
| >KOG1536|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-58 Score=491.16 Aligned_cols=412 Identities=31% Similarity=0.518 Sum_probs=296.3
Q ss_pred CCCCCcccccccccCCCCCCChHHHHHhhccCCcchHHHHHHhhhccceeEEecccccccccccchhhhhhhhhhhhhhc
Q psy6919 169 SRAPSEAYMPILVNEAPSDFNVDEYYRHLNTKKLGQLVIYSGVMSSSHNVLVSSQTSVSTLVGSSAIFIFLMVIRSQVLK 248 (638)
Q Consensus 169 ~~~~~~~~~~v~le~~p~~~~~~~~~~~L~~~~~~R~~il~~iL~~~Lgl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 248 (638)
.++++..+.+=..-+..+-..+...-++||.++..|++|+..+|+. .||.|+.++..+. .
T Consensus 216 ~tgph~e~~~n~~~~~~d~l~~~~~~~~lk~dek~Rl~fl~~v~t~-~gle~~~~t~~~~-------------------~ 275 (649)
T KOG1536|consen 216 LTGPHPEFTRNSTVRQVDVLVYEGGNDSLKSDEKHRLSFLLTVLTV-SGLEAPRSTNILS-------------------N 275 (649)
T ss_pred ecCCCHHHhhhhhhhccceeccCCCcchhhhhhhhheeeehhhhhh-cccccCCccceec-------------------C
Confidence 4667777766555555555566667889999999999999999997 9999987766532 3
Q ss_pred ccccccccccChhhhHHHHHH-HHHhcCccCcceeeecceeEEEeccccccCCCcccccccccCCCCCCchhhhhhhcch
Q psy6919 249 MVYTAGYLIGHPEAKTKLLDT-ARKLYTKKTQSVVQMKKMELEFCQSAASRAPSEAYMPILVNEAPSDFNVDEYYRHLNT 327 (638)
Q Consensus 249 ~~~~~~~~l~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 327 (638)
+..+..||+-.-..-..+-.. +...+.- ++ +...++..|+-.+. .++--+++ -+|+..|+.
T Consensus 276 p~l~n~~~~~n~~~~~r~~~k~~a~~l~~--d~---k~~~sl~~~~~~s~------------~tei~d~~-~~~~~~ld~ 337 (649)
T KOG1536|consen 276 PNLLNILLFRNLKPLKRLSEKLLASALEC--DS---KASCSLVLCGFSSA------------ETEIKDTN-KEFLKGLDN 337 (649)
T ss_pred chhhhhhhhcccchHHHHHHHHHHhhhcc--cc---ccCceeEEeecccc------------chhhhhhH-HHHHHhhhh
Confidence 334444444321111111111 1111111 11 12233334432210 00000111 111111111
Q ss_pred hhhhhhhhhhhhhhcccccCCCCCCCcccEEEecCCCCCCHHHHHHhcccccCCcEEEEecccCChhhhhcCC--CCC--
Q psy6919 328 KKLGQLMKKMELEFCQSAASRAPSEAYMPILVNEAPSDFNVDEYYRHLNTKKLGQLVIYSGVMSSSHNVLDGP--TLL-- 403 (638)
Q Consensus 328 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~L~t~~~G~~i~~~e~v~STn~~l~~~--~~~-- 403 (638)
..--=+.++.++.+.... .++. .++......+|+.+.|++.++++.+|+.++|.|+++|||+++... .+|
T Consensus 338 s~~~~k~~D~s~k~~i~~----~~E~--di~~~~~s~nFdl~lY~k~i~tk~~G~~ll~a~V~tST~~ild~n~s~lpse 411 (649)
T KOG1536|consen 338 SNSKLKSPDNSVKFVIIL----GSEE--DILVADDSPNFDLELYFKSINTKRFGRVLLWAPVLTSTMDILDHNFSELPSE 411 (649)
T ss_pred hhhhccCCCcceeEEEEe----cccc--ccccccCCCCcCHHHHHHHhhhhccCceEEEEeecchHHHHHhhhhhcCCcc
Confidence 100000000000000000 0000 111122456899999999999999999999999999999999874 355
Q ss_pred CccEEEeCcccccccCCCCcEEcCCCCceEEEEEeeCccccccCCcchHHHHHHHHHHHHHHhccC--CCcceeeecCcE
Q psy6919 404 HGLTVIPRQQTQGTGRSNNIWLSPPGCAMFSMQLHIDLKSQLGKHLPLIQHIVAISIVLAVKSFNQ--DIDLGIKWPNDL 481 (638)
Q Consensus 404 ~g~vViA~~QTaGRGR~gr~W~Sp~G~~~fSl~l~~~~~~~~~~~~~~l~~~~alAV~~aL~~~~~--~~~v~IKWPNDI 481 (638)
.|.+|+|+.||+||||+||.|+||.|+++||+.+..+..+.....++++++++.+|++++++..++ +++++|||||||
T Consensus 412 ~g~vvv~~~Q~sGRGRGgN~WlsP~G~~~~sf~ism~~ksr~~~~i~~~~~l~~~~~v~~~~~~pGy~dIpvrIKWPNDl 491 (649)
T KOG1536|consen 412 VGLVVVANIQTSGRGRGGNVWLSPKGCAMSSFTISMPLKSRVVPLIPFVQHLALVAVVEAVRYAPGYPDIPVRIKWPNDL 491 (649)
T ss_pred cceEEEEeEEeecccCCCCeeecCcceEeEEEEEEeecccccccchHHHHHHHHHHHHHHHhcCCCCCCCceeeecCccc
Confidence 899999999999999999999999999999999988776555677889999999999999988765 889999999999
Q ss_pred EEeCceeEEEEEeeeeecCCcCCCccEEEEEEeeecCCCCCCCccccccccC-----CCCCCCCHHHHHHHHHHHHHHH-
Q psy6919 482 YVNGNVKLGGIIVTSSILSTFESQMAVCNIGVGMNLDNSQPTTCLNSIFSAN-----PSSPLLSYEQYFALVFNHLEQL- 555 (638)
Q Consensus 482 y~~~~kKigGILvE~~~~~~~~~~~~~vVIGIGINvn~~~p~~~l~~l~~~~-----tsl~~i~r~~Lla~il~~le~l- 555 (638)
|+++..|||||||++++.++ .+.++|||||||.|..||+|||+++... +-...+.+|+|+|++++.||++
T Consensus 492 Y~~~~lKvgGiLv~st~r~n----~f~v~iGCGiNVtN~~PT~cLN~ll~~~n~e~~~~~l~~k~EkLiA~~~n~fe~~~ 567 (649)
T KOG1536|consen 492 YVNGYLKVGGILVTSTYRSN----KFNVSIGCGINVTNDGPTTCLNDLLDEMNEERNLLHLAIKAEKLIAAVFNKFEKYF 567 (649)
T ss_pred eeeeccccceEEEEeeecCc----eEEEEEeeeeEecCCCCceeHHHHHHhhchhhccccchhhHHHHHHHHHHHHHHHH
Confidence 99998999999999999988 8999999999999999999999987631 1123578999999999999987
Q ss_pred ---hcCCcHHHHHHHHHhhccCCCEEEEEECCccEEEEEEEeECCCCcEEEEec------CCeEEEEecCCeEEEcccCc
Q psy6919 556 ---MEGDFDEIYDLYYKHWLHNNVNVTVVSERGEAQQVKIIGIDDFGFLNVRSE------EGYIFSVRPDGNTFDMLNGL 626 (638)
Q Consensus 556 ---~~~g~~~~l~~y~~~~~~~G~~V~v~~~~g~~~~G~i~GIdd~G~Llv~~~------~G~~~~v~sgevSfd~~~~l 626 (638)
+++|++.+++.||+||+|.+|+|.+.+. | ..-++.|+||+|+|+++.. ++++..++||+|||||||||
T Consensus 568 k~f~d~G~~silp~YYeyWLHS~Q~V~L~d~-~--e~vii~~~dD~G~L~~~~~~~~~~~t~kv~~l~PDGNtFDmmknL 644 (649)
T KOG1536|consen 568 KLFMDQGPKSILPLYYEYWLHSNQRVILEDK-G--EAVIIGGTDDIGFLQVSGLLLAVGDTNKVYELHPDGNTFDMMKNL 644 (649)
T ss_pred HHHHhhCHHhHhHHHHHHHhccCcEEeccCC-C--cceEEeeeecccceeeehhcccCCCCCceEEEcCCCcHHHHHHHh
Confidence 6889999999999999999999998653 3 2345667799999999964 45899999999999999999
Q ss_pred ccccC
Q psy6919 627 IAPKQ 631 (638)
Q Consensus 627 i~~k~ 631 (638)
|.+|+
T Consensus 645 I~~K~ 649 (649)
T KOG1536|consen 645 IRHKY 649 (649)
T ss_pred hccCC
Confidence 99996
|
|
| >COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06955 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00121 birA_ligase birA, biotin-[acetyl-CoA-carboxylase] ligase region | Back alignment and domain information |
|---|
| >PRK08330 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PTZ00275 biotin-acetyl-CoA-carboxylase ligase; Provisional | Back alignment and domain information |
|---|
| >PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00276 biotin/lipoate protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08477 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05935 biotin--protein ligase; Provisional | Back alignment and domain information |
|---|
| >PF03099 BPL_LplA_LipB: Biotin/lipoate A/B protein ligase family This entry is just a subset of the Pfam family; InterPro: IPR004143 This domain is found in biotin protein ligase, lipoate-protein ligase A and B | Back alignment and domain information |
|---|
| >KOG3396|consensus | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >KOG3139|consensus | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >KOG3216|consensus | Back alignment and domain information |
|---|
| >PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >KOG3397|consensus | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3153 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3234|consensus | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >KOG3235|consensus | Back alignment and domain information |
|---|
| >COG2153 ElaA Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01211 ELP3 histone acetyltransferase, ELP3 family | Back alignment and domain information |
|---|
| >KOG2488|consensus | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3138|consensus | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >COG3981 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain | Back alignment and domain information |
|---|
| >COG3053 CitC Citrate lyase synthetase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B | Back alignment and domain information |
|---|
| >KOG4144|consensus | Back alignment and domain information |
|---|
| >COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans | Back alignment and domain information |
|---|
| >KOG4135|consensus | Back alignment and domain information |
|---|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK13834 putative autoinducer synthesis protein; Provisional | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
| >TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase | Back alignment and domain information |
|---|
| >PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein | Back alignment and domain information |
|---|
| >PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine | Back alignment and domain information |
|---|
| >PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10456 arginine succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG3375 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03244 arg_catab_AstA arginine N-succinyltransferase | Back alignment and domain information |
|---|
| >PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus | Back alignment and domain information |
|---|
| >KOG2535|consensus | Back alignment and domain information |
|---|
| >PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits | Back alignment and domain information |
|---|
| >TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit | Back alignment and domain information |
|---|
| >PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 | Back alignment and domain information |
|---|
| >PLN03238 probable histone acetyltransferase MYST; Provisional | Back alignment and domain information |
|---|
| >PRK01305 arginyl-tRNA-protein transferase; Provisional | Back alignment and domain information |
|---|
| >PRK14348 lipoate-protein ligase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated | Back alignment and domain information |
|---|
| >KOG2696|consensus | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >TIGR00545 lipoyltrans lipoyltransferase and lipoate-protein ligase | Back alignment and domain information |
|---|
| >PTZ00064 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03239 histone acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 638 | ||||
| 2huz_A | 184 | Crystal Structure Of Gnpnat1 Length = 184 | 5e-15 | ||
| 3cxp_A | 184 | Crystal Structure Of Human Glucosamine 6-Phosphate | 7e-15 | ||
| 1wnl_A | 235 | Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase | 1e-13 | ||
| 1wpy_A | 235 | Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase | 1e-13 | ||
| 2dve_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 2e-13 | ||
| 2djz_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 5e-13 | ||
| 2deq_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 6e-13 | ||
| 2dxu_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 9e-13 | ||
| 2dxt_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 1e-12 | ||
| 2e41_A | 235 | Crystal Structure Of Biotin Protein Ligase From Pyr | 4e-12 | ||
| 3t90_A | 149 | Crystal Structure Of Glucosamine-6-Phosphate N-Acet | 6e-10 | ||
| 4ag7_A | 165 | C. Elegans Glucosamine-6-Phosphate N-Acetyltransfer | 2e-08 | ||
| 1i21_A | 159 | Crystal Structure Of Yeast Gna1 Length = 159 | 2e-07 | ||
| 1i12_A | 160 | Crystal Structure Of Saccharomyces Cerevisiae Gna1 | 1e-06 | ||
| 1i1d_A | 161 | Crystal Structure Of Yeast Gna1 Bound To Coa And Gl | 1e-06 | ||
| 2vxk_A | 190 | Structural Comparison Between Aspergillus Fumigatus | 2e-06 | ||
| 3rir_A | 323 | Crystal Strucrture Of Biotin Protein Ligase From S. | 3e-06 | ||
| 3v7r_A | 329 | Crystal Structure Of Staphylococcus Aureus Biotin P | 3e-06 | ||
| 3v7c_A | 329 | Cystal Structure Of Sabpl In Complex With Inhibitor | 3e-06 | ||
| 4dq2_A | 328 | Structure Of Staphylococcus Aureus Biotin Protein L | 3e-06 | ||
| 2ej9_A | 237 | Crystal Structure Of Biotin Protein Ligase From Met | 5e-06 | ||
| 1hxd_A | 321 | Crystal Structure Of E. Coli Biotin Repressor With | 2e-04 |
| >pdb|2HUZ|A Chain A, Crystal Structure Of Gnpnat1 Length = 184 | Back alignment and structure |
|
| >pdb|3CXP|A Chain A, Crystal Structure Of Human Glucosamine 6-Phosphate N- Acetyltransferase 1 Mutant E156a Length = 184 | Back alignment and structure |
| >pdb|1WNL|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase) Ligase From Pyrococcus Horikoshii Ot3 In Complex With Adp Length = 235 | Back alignment and structure |
| >pdb|1WPY|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase) Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotin Length = 235 | Back alignment and structure |
| >pdb|2DVE|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, Mutation Arg51ala Length = 235 | Back alignment and structure |
| >pdb|2DJZ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-amp, K111a Mutation Length = 235 | Back alignment and structure |
| >pdb|2DEQ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111g Mutation Length = 235 | Back alignment and structure |
| >pdb|2DXU|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a Length = 235 | Back alignment and structure |
| >pdb|2DXT|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Atp And Biotin, Mutation D104a Length = 235 | Back alignment and structure |
| >pdb|2E41|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With The Reaction Product Analog Biotinol-5'-Amp, Mutations R48a And K111a Length = 235 | Back alignment and structure |
| >pdb|3T90|A Chain A, Crystal Structure Of Glucosamine-6-Phosphate N-Acetyltransferase From Arabidopsis Thaliana Length = 149 | Back alignment and structure |
| >pdb|4AG7|A Chain A, C. Elegans Glucosamine-6-Phosphate N-Acetyltransferase (Gna1): Coenzyme A Adduct Length = 165 | Back alignment and structure |
| >pdb|1I21|A Chain A, Crystal Structure Of Yeast Gna1 Length = 159 | Back alignment and structure |
| >pdb|1I12|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Gna1 Complexed With Accoa Length = 160 | Back alignment and structure |
| >pdb|1I1D|A Chain A, Crystal Structure Of Yeast Gna1 Bound To Coa And Glnac-6p Length = 161 | Back alignment and structure |
| >pdb|2VXK|A Chain A, Structural Comparison Between Aspergillus Fumigatus And Human Gna1 Length = 190 | Back alignment and structure |
| >pdb|3RIR|A Chain A, Crystal Strucrture Of Biotin Protein Ligase From S. Aureus Length = 323 | Back alignment and structure |
| >pdb|3V7R|A Chain A, Crystal Structure Of Staphylococcus Aureus Biotin Protein Ligase In Complex With Inhibitor Length = 329 | Back alignment and structure |
| >pdb|3V7C|A Chain A, Cystal Structure Of Sabpl In Complex With Inhibitor Length = 329 | Back alignment and structure |
| >pdb|4DQ2|A Chain A, Structure Of Staphylococcus Aureus Biotin Protein Ligase In Complex With Biotinol-5'-Amp Length = 328 | Back alignment and structure |
| >pdb|2EJ9|A Chain A, Crystal Structure Of Biotin Protein Ligase From Methanococcus Jannaschii Length = 237 | Back alignment and structure |
| >pdb|1HXD|A Chain A, Crystal Structure Of E. Coli Biotin Repressor With Bound Biotin Length = 321 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Length = 233 | Back alignment and structure |
|---|
Score = 121 bits (307), Expect = 1e-31
Identities = 48/219 (21%), Positives = 85/219 (38%), Gaps = 38/219 (17%)
Query: 404 HGLTVIPRQQTQGTGRSNNIWLSPPGCAMFSMQLHIDLKSQLGKHLPLIQHIVAISIVLA 463
+G ++ +QT+G GR WLS G FS L+ L + LPL ++ +S+ A
Sbjct: 25 YGTALVADRQTKGRGRLGRKWLSQEGGLYFSFLLNPKEFENLLQ-LPL---VLGLSVSEA 80
Query: 464 VKSFNQDIDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQMAVCNIGVGMNLDNS--- 520
++ +I +KWPND+Y K+ G++ E +G+G+N++
Sbjct: 81 LEEIT-EIPFSLKWPNDVYFQEK-KVSGVLC--------ELSKDKLIVGIGINVNQREIP 130
Query: 521 ----QPTTCLNSIFSANPSSPLLSYEQYFALVFNHLEQL----MEGDFDEIYDLYYKHWL 572
T L I + + V + + E F E L
Sbjct: 131 EEIKDRATTLYEITGKDWDRKEV-----LLKVLKRISENLKKFKEKSFKEFKGKIESKML 185
Query: 573 HNNVNVTVVSER---GEAQQVKIIGIDDFGFLNVRSEEG 608
+ V ++ E G+ +G+ + G + +EEG
Sbjct: 186 YLGEEVKLLGEGKITGKL-----VGLSEKGGALILTEEG 219
|
| >2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Length = 235 | Back alignment and structure |
|---|
| >2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Length = 237 | Back alignment and structure |
|---|
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 4dq2_A* Length = 323 | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A Length = 270 | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Length = 321 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149 | Back alignment and structure |
|---|
| >3bfm_A Biotin protein ligase-like protein of unknown FUN; structural genomics, joint center for structural genomics, J protein structure initiative; HET: 2PE; 1.70A {Silicibacter SP} Length = 235 | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150 | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150 | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157 | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172 | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164 | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180 | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138 | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166 | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166 | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145 | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 638 | |||
| 3rkx_A | 323 | Biotin-[acetyl-COA-carboxylase] ligase; biotin pro | 100.0 | |
| 2dxu_A | 235 | Biotin--[acetyl-COA-carboxylase] ligase; biotin bi | 100.0 | |
| 2eay_A | 233 | Biotin [acetyl-COA-carboxylase] ligase; biotin bio | 100.0 | |
| 3rux_A | 270 | BIRA bifunctional protein; biotin-protein ligase, | 100.0 | |
| 1bia_A | 321 | BIRA bifunctional protein; transcription regulatio | 100.0 | |
| 2ej9_A | 237 | Putative biotin ligase; biotin biosynthesis, monom | 100.0 | |
| 3bfm_A | 235 | Biotin protein ligase-like protein of unknown FUN; | 100.0 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 99.51 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 99.51 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 99.49 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 99.46 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 99.44 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 99.44 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 99.44 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 99.41 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 99.4 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 99.38 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 99.37 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 99.36 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 99.36 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 99.35 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 99.34 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 99.34 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 99.33 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 99.32 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 99.32 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 99.31 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 99.31 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 99.31 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 99.3 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 99.28 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 99.28 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 99.27 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 99.26 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 99.25 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 99.25 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 99.25 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 99.24 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 99.24 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 99.24 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 99.24 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 99.23 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 99.23 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 99.23 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 99.23 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 99.23 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 99.23 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 99.22 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 99.22 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 99.22 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 99.21 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 99.21 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 99.21 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 99.21 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 99.2 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 99.2 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 99.2 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 99.19 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 99.19 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 99.19 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 99.18 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 99.18 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 99.18 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 99.17 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 99.17 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 99.17 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 99.16 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 99.16 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 99.16 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 99.15 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 99.15 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 99.15 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 99.15 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 99.15 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 99.15 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 99.15 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 99.14 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 99.14 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 99.14 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 99.13 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 99.13 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 99.13 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 99.13 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 99.12 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 99.12 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 99.12 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 99.11 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 99.11 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 99.11 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 99.11 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 99.1 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 99.1 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 99.1 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 99.1 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 99.09 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 99.09 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 99.08 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 99.08 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 99.08 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 99.08 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 99.08 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 99.08 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 99.08 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 99.08 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 99.07 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 99.06 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 99.06 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 99.06 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 99.04 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 99.04 | |
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 99.04 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 99.03 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 99.01 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 99.01 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 98.99 | |
| 2d4p_A | 141 | Hypothetical protein TTHA1254; structural genomics | 98.98 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 98.98 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.98 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 98.98 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 98.98 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 98.98 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 98.98 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 98.98 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 98.97 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 98.97 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 98.96 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 98.96 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 98.95 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 98.94 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 98.94 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 98.94 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 98.92 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 98.92 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 98.91 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 98.91 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 98.89 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 98.89 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 98.88 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 98.87 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 98.84 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 98.84 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.83 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 98.82 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 98.81 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 98.81 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 98.8 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 98.8 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 98.78 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.76 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 98.74 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 98.69 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 98.69 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 98.64 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 98.62 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 98.62 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 98.59 | |
| 2ft0_A | 235 | TDP-fucosamine acetyltransferase; GNAT fold acetyl | 98.56 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 98.53 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 98.45 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 98.37 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 98.21 | |
| 1ro5_A | 201 | Autoinducer synthesis protein LASI; alpha-beta-alp | 98.12 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 97.99 | |
| 3p2h_A | 201 | AHL synthase; acyl-ACP binding, SAM binding, signa | 97.77 | |
| 1kzf_A | 230 | Acyl-homoserinelactone synthase ESAI; alpha-beta, | 97.66 | |
| 3shp_A | 176 | Putative acetyltransferase STHE_0691; PSI-biology, | 97.63 | |
| 1yle_A | 342 | Arginine N-succinyltransferase, alpha chain; struc | 97.51 | |
| 2qhs_A | 237 | Lipoyltransferase; globular protein; HET: OCA; 1.5 | 97.47 | |
| 3dns_A | 135 | Ribosomal-protein-alanine acetyltransferase; N-ter | 97.16 | |
| 1w66_A | 232 | Lipoyltransferase; lipoate-protein ligase B, lipoi | 95.11 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 94.42 | |
| 2c8m_A | 262 | Lipoate-protein ligase A; lipoylation; HET: LPA; 1 | 93.07 | |
| 2p0l_A | 288 | Lipoate-protein ligase A; PFAM, lopoate-protein li | 93.0 | |
| 2p5i_A | 288 | BH3822 protein; PFAM03099, structural genomics, PS | 92.99 | |
| 1vqz_A | 341 | Lipoate-protein ligase, putative; class II AARS an | 92.23 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 91.63 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 91.21 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 91.13 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 90.36 | |
| 4b14_A | 385 | Glycylpeptide N-tetradecanoyltransferase; malaria, | 89.64 | |
| 2ozu_A | 284 | Histone acetyltransferase MYST3; structural genomi | 87.99 | |
| 3a7r_A | 337 | Lipoate-protein ligase A; adenylate-forming enzyme | 87.44 | |
| 3to7_A | 276 | Histone acetyltransferase ESA1; MYST family; HET: | 86.68 | |
| 2ou2_A | 280 | Histone acetyltransferase htatip; structural genom | 86.45 | |
| 2pq8_A | 278 | Probable histone acetyltransferase MYST1; MOF, str | 86.11 | |
| 3iu1_A | 383 | Glycylpeptide N-tetradecanoyltransferase 1; N-myri | 85.46 | |
| 3gkr_A | 336 | FEMX; FEMX, peptidoglycan, hexapeptide, transferas | 84.09 | |
| 2wuu_A | 421 | N-myristoyltransferase; acyltransferase; HET: NHM; | 80.05 |
| >3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-55 Score=461.18 Aligned_cols=257 Identities=19% Similarity=0.255 Sum_probs=211.3
Q ss_pred CCCcccEEEecCCCCCCHHHHHHhcccccCCcEEEEecccCChhhhhcCC---CCCCccEEEeCcccccccCCCCcEEcC
Q psy6919 351 SEAYMPILVNEAPSDFNVDEYYRHLNTKKLGQLVIYSGVMSSSHNVLDGP---TLLHGLTVIPRQQTQGTGRSNNIWLSP 427 (638)
Q Consensus 351 ~~~~~~~~~~~~p~~~~~~~~~~~L~t~~~G~~i~~~e~v~STn~~l~~~---~~~~g~vViA~~QTaGRGR~gr~W~Sp 427 (638)
..++|.+. ..||.+++++|...|+|..+|+.++|+++++|||+++ +. +.++|++|+|++||+||||+||.|+||
T Consensus 54 ~~~GY~L~--~~~~~l~~~~i~~~l~~~~~g~~i~~~~~~~STn~~a-~~~~~g~~~g~vv~A~~QTaGRGR~GR~W~Sp 130 (323)
T 3rkx_A 54 NHKGHLLQ--QLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAA-KKSLVGNQSSFFILSDEQTKGRGRFNRHWSSS 130 (323)
T ss_dssp TTTEEEEE--ECCSSCCHHHHHHHHHTCSSCSEEEEEEEESCHHHHH-HHHTTTCCCCEEEEEEEEC------------C
T ss_pred CCCeEEEe--cCcccCCHHHHHhhcccccCCceEEEEcCCCCHHHHH-HHHhcCCCCCEEEEECcccCCCCCCCCeeeCC
Confidence 45788765 3689999999999999999999999999999999999 42 478999999999999999999999999
Q ss_pred CC-CceEEEEEeeCccccccCCcchHHHHHHHHHHHHHHhccCCCcceeeecCcEEEeCceeEEEEEeeeeecCCcCCCc
Q psy6919 428 PG-CAMFSMQLHIDLKSQLGKHLPLIQHIVAISIVLAVKSFNQDIDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQM 506 (638)
Q Consensus 428 ~G-~~~fSl~l~~~~~~~~~~~~~~l~~~~alAV~~aL~~~~~~~~v~IKWPNDIy~~~~kKigGILvE~~~~~~~~~~~ 506 (638)
+| ++|||++++|+.+. +.++.+++++|+||++||+++. +.+++||||||||+++ +|+||||+|+....+ ..
T Consensus 131 ~G~~L~~S~~l~p~~~~---~~~~~lsl~~avAv~~al~~~~-~~~~~iKWPNDI~~~g-kKl~GIL~E~~~~~~---~~ 202 (323)
T 3rkx_A 131 KGQGLWMSVVLRPNVAF---SMISKFNLFIALGIRDAIQHFS-QDEVKVKWPNDIYIDN-GKVCGFLTEMVANND---GI 202 (323)
T ss_dssp TTCEEEEEEEECCCCCT---TSGGGHHHHHHHHHHHHHHTTC-SSCEEEETTTEEEETT-EEEEEEEEEEEECSS---SE
T ss_pred CCCCEEEEEEecCCCCH---HHHHHHHHHHHHHHHHHHHHhc-CCceEEeCCCeEEECC-EEEEEEEeEeeeCCC---CC
Confidence 99 67999999987654 6789999999999999999987 5889999999999999 899999999987655 35
Q ss_pred cEEEEEEeeecCCCCCCCccccccccCCCC-----CCCCHHHHHHHHHHHHHHH----hcCCcHHHHHHHHHhhccCCCE
Q psy6919 507 AVCNIGVGMNLDNSQPTTCLNSIFSANPSS-----PLLSYEQYFALVFNHLEQL----MEGDFDEIYDLYYKHWLHNNVN 577 (638)
Q Consensus 507 ~~vVIGIGINvn~~~p~~~l~~l~~~~tsl-----~~i~r~~Lla~il~~le~l----~~~g~~~~l~~y~~~~~~~G~~ 577 (638)
.++|||||||||++. +.+..++...++++ ..++|++|++.++++|+.+ .+.+|..++++|++++.+.|++
T Consensus 203 ~~vViGIGiNv~~~~-~~~p~~l~~~atsL~~~~g~~~~r~~ll~~ll~~l~~~~~~~~~~g~~~~~~~~~~~~~~~g~~ 281 (323)
T 3rkx_A 203 EAIICGIGINLTQQL-ENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYNAASNIWNRT 281 (323)
T ss_dssp EEEEEEEEEECSCCG-GGSCTTTGGGBCCSGGGCSSCCCHHHHHHHHHHHHHHHHHHHHHSCGGGTHHHHHHTBSCSSSC
T ss_pred CEEEEEEEEEecCCc-ccCCcccCcceeeHhhhhCCCCCHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHHhhcCCE
Confidence 689999999999842 11222332334554 3689999999999999875 5679999999999999999999
Q ss_pred EEEEECCccEEEEEEEeECCCCcEEEEecCCeEEEEecCCeEE
Q psy6919 578 VTVVSERGEAQQVKIIGIDDFGFLNVRSEEGYIFSVRPDGNTF 620 (638)
Q Consensus 578 V~v~~~~g~~~~G~i~GIdd~G~Llv~~~~G~~~~v~sgevSf 620 (638)
|++..++ +.++|++.|||++|.|+|++++|+++.+.+||||+
T Consensus 282 V~v~~~~-~~~~G~~~gId~~G~Llv~~~~G~~~~~~sGevsl 323 (323)
T 3rkx_A 282 LLFTEND-KQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF 323 (323)
T ss_dssp EEEECC--CEEEEEEEEECTTSCEEEEETTSCEEEESSCEEEC
T ss_pred EEEEECC-eEEEEEEEEECCCCEEEEEECCCCEEEEEEeeEEC
Confidence 9998765 57899999999999999999999999999999985
|
| >2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... | Back alignment and structure |
|---|
| >2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* | Back alignment and structure |
|---|
| >3rux_A BIRA bifunctional protein; biotin-protein ligase, ligase-ligase inhibitor complex; HET: BS5; 1.70A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A 2cgh_A | Back alignment and structure |
|---|
| >1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* | Back alignment and structure |
|---|
| >2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3bfm_A Biotin protein ligase-like protein of unknown FUN; structural genomics, joint center for structural genomics, J protein structure initiative; HET: 2PE; 1.70A {Silicibacter SP} | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* | Back alignment and structure |
|---|
| >1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A | Back alignment and structure |
|---|
| >3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 | Back alignment and structure |
|---|
| >2qhs_A Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus} PDB: 2qht_A 2qhu_A 2qhv_A | Back alignment and structure |
|---|
| >3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1w66_A Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} SCOP: d.104.1.3 | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2c8m_A Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} SCOP: d.104.1.3 PDB: 2art_A* 2aru_A* 2c7i_A 2ars_A* 3r07_A | Back alignment and structure |
|---|
| >2p0l_A Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, 10425H, structural genomics, structure initiative, PSI-2; 2.04A {Streptococcus agalactiae} SCOP: d.104.1.3 | Back alignment and structure |
|---|
| >2p5i_A BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} SCOP: d.104.1.3 | Back alignment and structure |
|---|
| >1vqz_A Lipoate-protein ligase, putative; class II AARS and biotin synthetases fold, SUFE/NIFU fold, S genomics; HET: MSE; 1.99A {Streptococcus pneumoniae} SCOP: d.224.1.3 d.104.1.3 | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* | Back alignment and structure |
|---|
| >2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A | Back alignment and structure |
|---|
| >3a7r_A Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* | Back alignment and structure |
|---|
| >3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* | Back alignment and structure |
|---|
| >2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* | Back alignment and structure |
|---|
| >3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* | Back alignment and structure |
|---|
| >3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A | Back alignment and structure |
|---|
| >2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 638 | ||||
| d2zgwa2 | 188 | d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylas | 2e-17 | |
| d1biaa3 | 207 | d.104.1.2 (A:64-270) Biotin repressor/biotin holoe | 5e-10 | |
| d1z4ea1 | 150 | d.108.1.1 (A:4-153) Transcriptional regulator BH19 | 4e-04 | |
| d2jdca1 | 145 | d.108.1.1 (A:2-146) Probable acetyltransferase Yit | 0.001 |
| >d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 188 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Biotin holoenzyme synthetase domain: Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Score = 78.3 bits (192), Expect = 2e-17
Identities = 43/202 (21%), Positives = 77/202 (38%), Gaps = 22/202 (10%)
Query: 375 LNTKKLGQLVIYSGVMSSSHNVLDGPTLLHGLTVIPRQQTQGTGRSNNIWLSPPGCAMFS 434
L T +G+ VIY ++S++ L G ++ +QT G G N W SP G S
Sbjct: 4 LKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLS 63
Query: 435 MQLHIDLKSQLGKHLPLIQHIVAISIVLAVKSFNQDIDLGIKWPNDLYVNGNVKLGGIIV 494
+ L + + + + + + + ID IKWPND+ VN G
Sbjct: 64 IVLSPKVPQKDLPKIVFLGAVGVVETL-----KEFSIDGRIKWPNDVLVNYKAIAG---- 114
Query: 495 TSSILSTFESQMAVCNIGVGMNLDNSQPTTCLNSIFSANPSSPLLSYEQYFALVFNHLEQ 554
+L + V IG+ +N T + + + F + +L++
Sbjct: 115 ---VLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSE-----VPLLSVFRSLITNLDR 166
Query: 555 L----MEGDFDEIYDLYYKHWL 572
L ++ D I +L + +
Sbjct: 167 LYLNFLKNPMD-ILNLVRDNMI 187
|
| >d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} Length = 207 | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150 | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Length = 145 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 638 | |||
| d2zgwa2 | 188 | Biotin--[acetyl-CoA-carboxylase] ligase catalytic | 100.0 | |
| d1biaa3 | 207 | Biotin repressor/biotin holoenzyme synthetase, cat | 100.0 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 99.49 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 99.49 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 99.46 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 99.46 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 99.45 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 99.43 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 99.41 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 99.38 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 99.38 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 99.37 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 99.37 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 99.36 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 99.36 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 99.34 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 99.34 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.33 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 99.32 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 99.32 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 99.31 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 99.31 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 99.3 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 99.27 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 99.27 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 99.27 | |
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 99.26 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 99.25 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 99.25 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 99.25 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 99.24 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 99.23 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 99.23 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 99.21 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 99.2 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 99.2 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 99.2 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 99.18 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 99.14 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 99.13 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 99.12 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 99.08 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 99.07 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 99.01 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 98.9 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 98.89 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 98.76 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 98.75 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 98.73 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 98.72 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 98.65 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 98.64 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 98.61 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 98.6 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 98.58 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 98.55 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 98.52 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 98.44 | |
| d2zgwa1 | 47 | Biotin--[acetyl-CoA-carboxylase] ligase C-terminal | 98.12 | |
| d2fsra1 | 164 | Probable acetyltranferase Atu2435 {Agrobacterium t | 97.87 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 97.81 | |
| d1ro5a_ | 197 | Autoinducer synthesis protein LasI {Pseudomonas ae | 97.4 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 97.02 | |
| d1kzfa_ | 210 | Acyl-homoserinelactone synthase EsaI {Pantoea stew | 95.96 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 95.47 | |
| d1ylea1 | 338 | Arginine N-succinyltransferase, alpha chain, AstA | 95.27 | |
| d2p0la1 | 269 | Lipoate-protein ligase A {Streptococcus agalactiae | 95.03 | |
| d1vqza2 | 241 | LplA-like protein SP1160, N-terminal domain {Strep | 94.73 | |
| d1lrza3 | 182 | Methicillin resistance protein FemA {Staphylococcu | 93.62 | |
| d1iyka1 | 165 | N-myristoyl transferase, NMT {Yeast (Candida albic | 93.39 | |
| d1iica1 | 185 | N-myristoyl transferase, NMT {Baker's yeast (Sacch | 93.0 | |
| d1rxta1 | 141 | N-myristoyl transferase, NMT {Human (Homo sapiens) | 92.78 | |
| d2c8ma1 | 256 | Lipoate-protein ligase A {Thermoplasma acidophilum | 91.31 | |
| d1ne9a2 | 171 | Peptidyltransferase FemX {Weissella viridescens [T | 89.93 | |
| d2p5ia1 | 265 | Hypothetical protein BH3822 {Bacillus halodurans [ | 89.41 | |
| d2giva1 | 271 | Probable histone acetyltransferase MYST1 {Human (H | 88.68 | |
| d1x2ga2 | 246 | Two-domain LplA, N-terminal domain {Escherichia co | 88.53 | |
| d2ozua1 | 270 | Histone acetyltransferase MYST3 {Human (Homo sapie | 88.49 | |
| d1fy7a_ | 273 | Histone acetyltransferase ESA1 {Baker's yeast (Sac | 87.55 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 84.46 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 83.62 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 83.55 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 82.62 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 81.29 |
| >d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Class II aaRS and biotin synthetases superfamily: Class II aaRS and biotin synthetases family: Biotin holoenzyme synthetase domain: Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00 E-value=1.6e-42 Score=337.60 Aligned_cols=178 Identities=29% Similarity=0.497 Sum_probs=153.6
Q ss_pred cccccCCcEEEEecccCChhhhhcCCCCCCccEEEeCcccccccCCCCcEEcCCCCceEEEEEeeCccccccCCcchHHH
Q psy6919 375 LNTKKLGQLVIYSGVMSSSHNVLDGPTLLHGLTVIPRQQTQGTGRSNNIWLSPPGCAMFSMQLHIDLKSQLGKHLPLIQH 454 (638)
Q Consensus 375 L~t~~~G~~i~~~e~v~STn~~l~~~~~~~g~vViA~~QTaGRGR~gr~W~Sp~G~~~fSl~l~~~~~~~~~~~~~~l~~ 454 (638)
|+|+.+|++++|+++++|||+++++...++|++|+|++||+||||+||.|.||+|++|||++++++.+. ..++.+++
T Consensus 4 L~T~~iG~~i~~~~~v~STn~~a~~~~~~~~~vv~a~~Qt~GrGR~gr~W~sp~g~l~~S~~~~~~~~~---~~~~~l~~ 80 (188)
T d2zgwa2 4 LKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSPKVPQ---KDLPKIVF 80 (188)
T ss_dssp CCCSSTTSEEEEESSBSCHHHHHHHSCCCTTCEEEESCBSSCBCGGGCBCCCCTTSEEEEEEECCCSCT---TTGGGHHH
T ss_pred cchhhhCCeEEEeCcCCCHHHHHHhcCCCCCeEEEECccCCCCCCCCCCCcCCccccceEEEeecccch---hhhhhhhH
Confidence 789999999999999999999999877899999999999999999999999999999999999887654 46789999
Q ss_pred HHHHHHHHHHHhccCCCcceeeecCcEEEeCceeEEEEEeeeeecCCcCCCccEEEEEEeeecCCCCCC--Ccccccccc
Q psy6919 455 IVAISIVLAVKSFNQDIDLGIKWPNDLYVNGNVKLGGIIVTSSILSTFESQMAVCNIGVGMNLDNSQPT--TCLNSIFSA 532 (638)
Q Consensus 455 ~~alAV~~aL~~~~~~~~v~IKWPNDIy~~~~kKigGILvE~~~~~~~~~~~~~vVIGIGINvn~~~p~--~~l~~l~~~ 532 (638)
++|+||+++|+++ +.+++||||||||+++ +|+||||+|+. ...+|||||||+|++.|. +++....
T Consensus 81 ~~~~av~~~l~~~--~~~~~iKWPNDI~~~~-kKi~GILiE~~--------~~~~iiGiGiNvn~~~~~~atsl~~~~-- 147 (188)
T d2zgwa2 81 LGAVGVVETLKEF--SIDGRIKWPNDVLVNY-KAIAGVLVEGK--------GDKIVLGIGLNVNNKVPNGATSMKLEL-- 147 (188)
T ss_dssp HHHHHHHHHHHHT--TCCCEEETTTEEEETT-EEEEEEEEEES--------SSCEEEEEEECSSSCCCTTCCCHHHHH--
T ss_pred HHHHHHHHhhhhc--ccceeEEEcchheeCC-CceEEEEEecc--------cceEEEEEEeecCCCCCCCcccHHHHh--
Confidence 9999999999987 5789999999999999 89999999953 235899999999987553 3332221
Q ss_pred CCCCCCCCHHHHHHHHHHHHHHH----hcCCcHHHHHHHHHhhc
Q psy6919 533 NPSSPLLSYEQYFALVFNHLEQL----MEGDFDEIYDLYYKHWL 572 (638)
Q Consensus 533 ~tsl~~i~r~~Lla~il~~le~l----~~~g~~~~l~~y~~~~~ 572 (638)
...++++++++.+++.|+++ .+.++ ++++.|++.|+
T Consensus 148 ---~~~~~~~~l~~~l~~~l~~~~~~~~~~~~-~~~~~~~~~~l 187 (188)
T d2zgwa2 148 ---GSEVPLLSVFRSLITNLDRLYLNFLKNPM-DILNLVRDNMI 187 (188)
T ss_dssp ---SSCCCHHHHHHHHHHHHHHHHHHHHHCTT-HHHHHHHHTBC
T ss_pred ---CCCCCHHHHHHHHHHHHHHHHHHHHcCCh-HHHHHHHHhhc
Confidence 24689999999999999876 45677 48899998875
|
| >d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2zgwa1 b.34.1.1 (A:189-235) Biotin--[acetyl-CoA-carboxylase] ligase C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2p0la1 d.104.1.3 (A:4-272) Lipoate-protein ligase A {Streptococcus agalactiae [TaxId: 1311]} | Back information, alignment and structure |
|---|
| >d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c8ma1 d.104.1.3 (A:1-256) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} | Back information, alignment and structure |
|---|
| >d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|