Psyllid ID: psy695
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| 194745067 | 666 | GF16459 [Drosophila ananassae] gi|190628 | 0.705 | 0.226 | 0.459 | 5e-32 | |
| 195175085 | 664 | GL14083 [Drosophila persimilis] gi|19411 | 0.691 | 0.222 | 0.449 | 1e-31 | |
| 443718167 | 656 | hypothetical protein CAPTEDRAFT_225710 [ | 0.658 | 0.214 | 0.461 | 3e-31 | |
| 195479011 | 664 | GE16015 [Drosophila yakuba] gi|194188256 | 0.691 | 0.222 | 0.468 | 4e-31 | |
| 198456442 | 282 | GA24005 [Drosophila pseudoobscura pseudo | 0.691 | 0.524 | 0.443 | 4e-31 | |
| 195553723 | 665 | GD24677 [Drosophila simulans] gi|1942027 | 0.668 | 0.215 | 0.477 | 2e-30 | |
| 195355443 | 665 | GM22521 [Drosophila sechellia] gi|194129 | 0.668 | 0.215 | 0.477 | 2e-30 | |
| 242009305 | 575 | Arginyl-tRNA synthetase, putative [Pedic | 0.663 | 0.246 | 0.450 | 3e-30 | |
| 18859963 | 665 | Arginyl-tRNA synthetase [Drosophila mela | 0.668 | 0.215 | 0.477 | 3e-30 | |
| 156383395 | 588 | predicted protein [Nematostella vectensi | 0.640 | 0.232 | 0.432 | 5e-30 |
| >gi|194745067|ref|XP_001955014.1| GF16459 [Drosophila ananassae] gi|190628051|gb|EDV43575.1| GF16459 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Score = 143 bits (360), Expect = 5e-32, Method: Compositional matrix adjust.
Identities = 74/161 (45%), Positives = 106/161 (65%), Gaps = 10/161 (6%)
Query: 2 NVPVSDRMSVRDYLSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCK 61
++ V + S+ ++L VF A+ +AFPE D S+A N KFGD+QCN+AM L K
Sbjct: 71 SIEVQENSSITEHLHFVFAQAIALAFPEYKDTPVSIAPVNSASA-KFGDYQCNNAMKLAK 129
Query: 62 IFKDKGEKKNPFDIAQSIASVVTSELATNPSLAKVIDKIEVAKPGFVNVFLSRVYAGEQI 121
K+KG K+P DIA +E+ N ++ +I+K+EVA GFVNVFLS+ YA + +
Sbjct: 130 QLKEKGINKSPGDIA--------TEIQRNCPVSPLIEKLEVAGAGFVNVFLSKNYASQAL 181
Query: 122 KDIIVNGVQPPTLNKKLRVLVDFSSPNIAKEMHVGHLSRSL 162
++ NGV+PP + K+ RVL+DFSSPNIAK+MHVGHL ++
Sbjct: 182 SGLLRNGVKPPPVPKR-RVLIDFSSPNIAKQMHVGHLRSTI 221
|
Source: Drosophila ananassae Species: Drosophila ananassae Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195175085|ref|XP_002028293.1| GL14083 [Drosophila persimilis] gi|194117430|gb|EDW39473.1| GL14083 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|443718167|gb|ELU08912.1| hypothetical protein CAPTEDRAFT_225710 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|195479011|ref|XP_002100732.1| GE16015 [Drosophila yakuba] gi|194188256|gb|EDX01840.1| GE16015 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|198456442|ref|XP_002136329.1| GA24005 [Drosophila pseudoobscura pseudoobscura] gi|198142680|gb|EDY71404.1| GA24005 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195553723|ref|XP_002076727.1| GD24677 [Drosophila simulans] gi|194202717|gb|EDX16293.1| GD24677 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195355443|ref|XP_002044201.1| GM22521 [Drosophila sechellia] gi|194129490|gb|EDW51533.1| GM22521 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|242009305|ref|XP_002425430.1| Arginyl-tRNA synthetase, putative [Pediculus humanus corporis] gi|212509247|gb|EEB12692.1| Arginyl-tRNA synthetase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|18859963|ref|NP_573081.1| Arginyl-tRNA synthetase [Drosophila melanogaster] gi|20178140|sp|Q9VXN4.1|SYRC_DROME RecName: Full=Probable arginine--tRNA ligase, cytoplasmic; AltName: Full=Arginyl-tRNA synthetase; Short=ArgRS gi|7293140|gb|AAF48524.1| Arginyl-tRNA synthetase [Drosophila melanogaster] gi|17944966|gb|AAL48546.1| RE02962p [Drosophila melanogaster] gi|220947778|gb|ACL86432.1| Aats-arg-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|156383395|ref|XP_001632819.1| predicted protein [Nematostella vectensis] gi|156219881|gb|EDO40756.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 214 | ||||||
| UNIPROTKB|P54136 | 660 | RARS "Arginine--tRNA ligase, c | 0.700 | 0.227 | 0.422 | 2.4e-29 | |
| FB|FBgn0027093 | 665 | Aats-arg "Arginyl-tRNA synthet | 0.668 | 0.215 | 0.477 | 4e-29 | |
| MGI|MGI:1914297 | 660 | Rars "arginyl-tRNA synthetase" | 0.691 | 0.224 | 0.427 | 1.4e-28 | |
| ZFIN|ZDB-GENE-030131-9014 | 661 | rars "arginyl-tRNA synthetase" | 0.705 | 0.228 | 0.413 | 2.3e-28 | |
| UNIPROTKB|F1NFP5 | 608 | RARS "Arginine--tRNA ligase, c | 0.686 | 0.241 | 0.402 | 7.8e-28 | |
| UNIPROTKB|Q5ZM11 | 661 | RARS "Arginine--tRNA ligase, c | 0.686 | 0.222 | 0.408 | 7.9e-28 | |
| UNIPROTKB|A7YW98 | 660 | RARS "Arginine--tRNA ligase, c | 0.700 | 0.227 | 0.391 | 1.7e-27 | |
| UNIPROTKB|J9P440 | 643 | RARS "Uncharacterized protein" | 0.691 | 0.230 | 0.396 | 2.6e-27 | |
| UNIPROTKB|E2QRR5 | 660 | RARS "Uncharacterized protein" | 0.691 | 0.224 | 0.396 | 2.8e-27 | |
| RGD|1309215 | 660 | Rars "arginyl-tRNA synthetase" | 0.691 | 0.224 | 0.402 | 2.8e-27 |
| UNIPROTKB|P54136 RARS "Arginine--tRNA ligase, cytoplasmic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 333 (122.3 bits), Expect = 2.4e-29, P = 2.4e-29
Identities = 68/161 (42%), Positives = 103/161 (63%)
Query: 2 NVPVSDRMSVRDYLSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCK 61
N P + +++ L +VF HA++ A+P+L + V + + KFGD+QCN AM + +
Sbjct: 67 NKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQA---KFGDYQCNSAMGISQ 123
Query: 62 IFKDKGEKKNPFDIAQSIASVVTSELATNPSLAKVIDKIEVAKPGFVNVFLSRVYAGEQI 121
+ K K +K NP +IA++I T L N + I+K+E+A PGF+NV L + + EQ+
Sbjct: 124 MLKTKEQKVNPREIAENI----TKHLPDN----ECIEKVEIAGPGFINVHLRKDFVSEQL 175
Query: 122 KDIIVNGVQPPTLNKKLRVLVDFSSPNIAKEMHVGHLSRSL 162
++VNGVQ P L + +V+VDFSSPNIAKEMHVGHL ++
Sbjct: 176 TSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTI 216
|
|
| FB|FBgn0027093 Aats-arg "Arginyl-tRNA synthetase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914297 Rars "arginyl-tRNA synthetase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9014 rars "arginyl-tRNA synthetase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NFP5 RARS "Arginine--tRNA ligase, cytoplasmic" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZM11 RARS "Arginine--tRNA ligase, cytoplasmic" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7YW98 RARS "Arginine--tRNA ligase, cytoplasmic" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P440 RARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QRR5 RARS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1309215 Rars "arginyl-tRNA synthetase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 214 | |||
| PLN02286 | 576 | PLN02286, PLN02286, arginine-tRNA ligase | 8e-34 | |
| PRK01611 | 507 | PRK01611, argS, arginyl-tRNA synthetase; Reviewed | 5e-29 | |
| COG0018 | 577 | COG0018, ArgS, Arginyl-tRNA synthetase [Translatio | 3e-26 | |
| TIGR00456 | 566 | TIGR00456, argS, arginyl-tRNA synthetase | 3e-15 | |
| pfam03485 | 84 | pfam03485, Arg_tRNA_synt_N, Arginyl tRNA synthetas | 5e-15 | |
| smart01016 | 85 | smart01016, Arg_tRNA_synt_N, Arginyl tRNA syntheta | 3e-13 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-12 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 6e-11 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-10 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 3e-09 | |
| pfam00750 | 345 | pfam00750, tRNA-synt_1d, tRNA synthetases class I | 4e-09 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 2e-08 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 4e-08 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 9e-08 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 2e-07 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 2e-07 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 3e-07 | |
| PRK12451 | 562 | PRK12451, PRK12451, arginyl-tRNA synthetase; Revie | 6e-07 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 6e-07 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 7e-07 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 1e-06 | |
| pfam00183 | 529 | pfam00183, HSP90, Hsp90 protein | 1e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-06 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 1e-06 | |
| cd00671 | 212 | cd00671, ArgRS_core, catalytic core domain of argi | 1e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 3e-06 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-06 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 5e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-06 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 6e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 7e-06 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 7e-06 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 8e-06 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 8e-06 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 8e-06 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 9e-06 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 1e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 1e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 1e-05 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 1e-05 | |
| pfam03066 | 146 | pfam03066, Nucleoplasmin, Nucleoplasmin | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 2e-05 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 2e-05 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 2e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 3e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 3e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 3e-05 | |
| pfam11831 | 363 | pfam11831, Myb_Cef, pre-mRNA splicing factor compo | 3e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 4e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 4e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 4e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 4e-05 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 4e-05 | |
| pfam11861 | 154 | pfam11861, DUF3381, Domain of unknown function (DU | 5e-05 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 5e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 6e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 6e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-05 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 6e-05 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 7e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 7e-05 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 7e-05 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 7e-05 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 8e-05 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 1e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 1e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 1e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 1e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 1e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 1e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 1e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 2e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 2e-04 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 2e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 2e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 2e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 2e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 2e-04 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 3e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 3e-04 | |
| pfam04615 | 728 | pfam04615, Utp14, Utp14 protein | 3e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 4e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 4e-04 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 4e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 4e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 4e-04 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 4e-04 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 4e-04 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 4e-04 | |
| pfam05340 | 565 | pfam05340, DUF740, Protein of unknown function (DU | 4e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 4e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 5e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 5e-04 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 5e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 5e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 5e-04 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 5e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 5e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 6e-04 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 6e-04 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 6e-04 | |
| pfam05764 | 238 | pfam05764, YL1, YL1 nuclear protein | 6e-04 | |
| pfam07767 | 387 | pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | 6e-04 | |
| PTZ00248 | 319 | PTZ00248, PTZ00248, eukaryotic translation initiat | 7e-04 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 7e-04 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 7e-04 | |
| cd11486 | 635 | cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporte | 7e-04 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 7e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 8e-04 | |
| pfam08553 | 794 | pfam08553, VID27, VID27 cytoplasmic protein | 8e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 8e-04 | |
| PRK04019 | 330 | PRK04019, rplP0, acidic ribosomal protein P0; Vali | 8e-04 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 8e-04 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 8e-04 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 8e-04 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 8e-04 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.001 | |
| pfam04712 | 481 | pfam04712, Radial_spoke, Radial spokehead-like pro | 0.001 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.001 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.001 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.001 | |
| PRK14715 | 1627 | PRK14715, PRK14715, DNA polymerase II large subuni | 0.001 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.001 | |
| pfam05758 | 832 | pfam05758, Ycf1, Ycf1 | 0.001 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| pfam04147 | 809 | pfam04147, Nop14, Nop14-like family | 0.002 | |
| PRK04195 | 482 | PRK04195, PRK04195, replication factor C large sub | 0.002 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.002 | |
| pfam03985 | 431 | pfam03985, Paf1, Paf1 | 0.002 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| PRK05299 | 258 | PRK05299, rpsB, 30S ribosomal protein S2; Provisio | 0.002 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.002 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.002 | |
| pfam05793 | 528 | pfam05793, TFIIF_alpha, Transcription initiation f | 0.002 | |
| pfam10446 | 449 | pfam10446, DUF2457, Protein of unknown function (D | 0.002 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.002 | |
| pfam07133 | 164 | pfam07133, Merozoite_SPAM, Merozoite surface prote | 0.002 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.002 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.002 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.002 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.002 | |
| pfam12253 | 76 | pfam12253, CAF1A, Chromatin assembly factor 1 subu | 0.002 | |
| pfam05327 | 554 | pfam05327, RRN3, RNA polymerase I specific transcr | 0.002 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.002 | |
| pfam02459 | 548 | pfam02459, Adeno_terminal, Adenoviral DNA terminal | 0.003 | |
| pfam14181 | 155 | pfam14181, YqfQ, YqfQ-like protein | 0.003 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.003 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.003 | |
| pfam03896 | 281 | pfam03896, TRAP_alpha, Translocon-associated prote | 0.003 | |
| PRK05658 | 619 | PRK05658, PRK05658, RNA polymerase sigma factor Rp | 0.003 | |
| pfam11081 | 172 | pfam11081, DUF2890, Protein of unknown function (D | 0.003 | |
| PRK14140 | 191 | PRK14140, PRK14140, heat shock protein GrpE; Provi | 0.003 | |
| COG4499 | 434 | COG4499, COG4499, Predicted membrane protein [Func | 0.003 | |
| pfam04546 | 211 | pfam04546, Sigma70_ner, Sigma-70, non-essential re | 0.003 | |
| pfam05285 | 317 | pfam05285, SDA1, SDA1 | 0.003 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.003 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.003 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.003 | |
| TIGR00570 | 309 | TIGR00570, cdk7, CDK-activating kinase assembly fa | 0.003 | |
| pfam08229 | 196 | pfam08229, SHR3_chaperone, ER membrane protein SH3 | 0.003 | |
| pfam09026 | 101 | pfam09026, Cenp-B_dimeris, Centromere protein B di | 0.003 | |
| pfam03344 | 715 | pfam03344, Daxx, Daxx Family | 0.004 | |
| pfam02724 | 583 | pfam02724, CDC45, CDC45-like protein | 0.004 | |
| pfam11705 | 221 | pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polym | 0.004 | |
| PTZ00415 | 2849 | PTZ00415, PTZ00415, transmission-blocking target a | 0.004 | |
| pfam07946 | 322 | pfam07946, DUF1682, Protein of unknown function (D | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| PRK12329 | 449 | PRK12329, nusA, transcription elongation factor Nu | 0.004 | |
| pfam09184 | 285 | pfam09184, PPP4R2, PPP4R2 | 0.004 | |
| COG1614 | 470 | COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthas | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| pfam11748 | 115 | pfam11748, DUF3306, Protein of unknown function (D | 0.004 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.004 | |
| PRK06402 | 106 | PRK06402, rpl12p, 50S ribosomal protein L12P; Revi | 0.004 |
| >gnl|CDD|215160 PLN02286, PLN02286, arginine-tRNA ligase | Back alignment and domain information |
|---|
Score = 126 bits (318), Expect = 8e-34
Identities = 64/151 (42%), Positives = 89/151 (58%), Gaps = 18/151 (11%)
Query: 15 LSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCKIFKDKG-EKKNPF 73
L+ +F ++++ P+ VA+ KFGD+QCN+AM L K KG KNP
Sbjct: 3 LAKLFEASLRLTVPDEPSVEPLVAACTNP---KFGDYQCNNAMGLWSKLKGKGTSFKNPR 59
Query: 74 DIAQSI-ASVVTSELATNPSLAKVIDKIEVAKPGFVNVFLSRVYAGEQIKDIIVNGVQP- 131
+AQ+I ++ SE+ I+ VA PGFVNV LS + ++I+ ++V+G+
Sbjct: 60 AVAQAIVKNLPASEM---------IESTSVAGPGFVNVRLSASWLAKRIERMLVDGIDTW 110
Query: 132 -PTLNKKLRVLVDFSSPNIAKEMHVGHLSRS 161
PTL K R +VDFSSPNIAKEMHVGHL RS
Sbjct: 111 APTLPVK-RAVVDFSSPNIAKEMHVGHL-RS 139
|
Length = 576 |
| >gnl|CDD|234964 PRK01611, argS, arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223097 COG0018, ArgS, Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|232981 TIGR00456, argS, arginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|217589 pfam03485, Arg_tRNA_synt_N, Arginyl tRNA synthetase N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|214975 smart01016, Arg_tRNA_synt_N, Arginyl tRNA synthetase N terminal dom | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|216097 pfam00750, tRNA-synt_1d, tRNA synthetases class I (R) | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|183534 PRK12451, PRK12451, arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|185675 cd00671, ArgRS_core, catalytic core domain of arginyl-tRNA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|145949 pfam03066, Nucleoplasmin, Nucleoplasmin | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|221275 pfam11861, DUF3381, Domain of unknown function (DUF3381) | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218177 pfam04615, Utp14, Utp14 protein | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218561 pfam05340, DUF740, Protein of unknown function (DUF740) | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|218737 pfam05764, YL1, YL1 nuclear protein | Back alignment and domain information |
|---|
| >gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) | Back alignment and domain information |
|---|
| >gnl|CDD|240329 PTZ00248, PTZ00248, eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|212055 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporter SGLT1;solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|218223 pfam04712, Radial_spoke, Radial spokehead-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|237799 PRK14715, PRK14715, DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|218734 pfam05758, Ycf1, Ycf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|217927 pfam04147, Nop14, Nop14-like family | Back alignment and domain information |
|---|
| >gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217829 pfam03985, Paf1, Paf1 | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) | Back alignment and domain information |
|---|
| >gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|148630 pfam07133, Merozoite_SPAM, Merozoite surface protein (SPAM) | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221490 pfam12253, CAF1A, Chromatin assembly factor 1 subunit A | Back alignment and domain information |
|---|
| >gnl|CDD|218556 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3 | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein | Back alignment and domain information |
|---|
| >gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|217783 pfam03896, TRAP_alpha, Translocon-associated protein (TRAP), alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235549 PRK05658, PRK05658, RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220972 pfam11081, DUF2890, Protein of unknown function (DUF2890) | Back alignment and domain information |
|---|
| >gnl|CDD|237622 PRK14140, PRK14140, heat shock protein GrpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226894 COG4499, COG4499, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|203043 pfam04546, Sigma70_ner, Sigma-70, non-essential region | Back alignment and domain information |
|---|
| >gnl|CDD|218538 pfam05285, SDA1, SDA1 | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|129661 TIGR00570, cdk7, CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|149343 pfam08229, SHR3_chaperone, ER membrane protein SH3 | Back alignment and domain information |
|---|
| >gnl|CDD|117592 pfam09026, Cenp-B_dimeris, Centromere protein B dimerisation domain | Back alignment and domain information |
|---|
| >gnl|CDD|217503 pfam03344, Daxx, Daxx Family | Back alignment and domain information |
|---|
| >gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|221175 pfam11705, RNA_pol_3_Rpc31, DNA-directed RNA polymerase III subunit Rpc31 | Back alignment and domain information |
|---|
| >gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237063 PRK12329, nusA, transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 | Back alignment and domain information |
|---|
| >gnl|CDD|224530 COG1614, CdhC, CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221203 pfam11748, DUF3306, Protein of unknown function (DUF3306) | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235795 PRK06402, rpl12p, 50S ribosomal protein L12P; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| KOG4426|consensus | 656 | 100.0 | ||
| COG0018 | 577 | ArgS Arginyl-tRNA synthetase [Translation, ribosom | 99.97 | |
| PLN02286 | 576 | arginine-tRNA ligase | 99.96 | |
| PRK12451 | 562 | arginyl-tRNA synthetase; Reviewed | 99.93 | |
| PRK01611 | 507 | argS arginyl-tRNA synthetase; Reviewed | 99.92 | |
| TIGR00456 | 566 | argS arginyl-tRNA synthetase. This model recognize | 99.91 | |
| PF03485 | 85 | Arg_tRNA_synt_N: Arginyl tRNA synthetase N termina | 99.74 | |
| KOG1195|consensus | 567 | 99.52 | ||
| PF00750 | 354 | tRNA-synt_1d: tRNA synthetases class I (R); InterP | 99.14 | |
| cd00671 | 212 | ArgRS_core catalytic core domain of arginyl-tRNA s | 98.5 | |
| cd00802 | 143 | class_I_aaRS_core catalytic core domain of class I | 95.23 | |
| cd00818 | 338 | IleRS_core catalytic core domain of isoleucyl-tRNA | 85.52 | |
| cd00668 | 312 | Ile_Leu_Val_MetRS_core catalytic core domain of is | 85.07 | |
| PRK13208 | 800 | valS valyl-tRNA synthetase; Reviewed | 84.86 | |
| PTZ00419 | 995 | valyl-tRNA synthetase-like protein; Provisional | 84.83 | |
| PF00749 | 314 | tRNA-synt_1c: tRNA synthetases class I (E and Q), | 84.4 | |
| PRK05729 | 874 | valS valyl-tRNA synthetase; Reviewed | 84.33 | |
| PF00133 | 601 | tRNA-synt_1: tRNA synthetases class I (I, L, M and | 84.19 | |
| PLN02381 | 1066 | valyl-tRNA synthetase | 83.51 | |
| cd00418 | 230 | GlxRS_core catalytic core domain of glutamyl-tRNA | 82.94 | |
| cd00817 | 382 | ValRS_core catalytic core domain of valyl-tRNA syn | 82.67 | |
| PLN02943 | 958 | aminoacyl-tRNA ligase | 82.48 | |
| cd00812 | 314 | LeuRS_core catalytic core domain of leucyl-tRNA sy | 82.28 | |
| cd00807 | 238 | GlnRS_core catalytic core domain of glutaminyl-tRN | 81.83 | |
| TIGR00422 | 861 | valS valyl-tRNA synthetase. The valyl-tRNA synthet | 81.19 | |
| TIGR03838 | 272 | queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe | 80.89 | |
| COG0008 | 472 | GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr | 80.54 | |
| TIGR00392 | 861 | ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA | 80.43 | |
| PLN02959 | 1084 | aminoacyl-tRNA ligase | 80.24 |
| >KOG4426|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.3e-33 Score=255.90 Aligned_cols=145 Identities=48% Similarity=0.798 Sum_probs=136.0
Q ss_pred ccHHHHHHHHHHHHHHHhCCccCCCccccccCccccccccccchhhHHHHHHHHhcccCCCCChHHHHHHHHHhhhhhhc
Q psy695 9 MSVRDYLSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCKIFKDKGEKKNPFDIAQSIASVVTSELA 88 (214)
Q Consensus 9 m~i~~~~~~~i~~aI~~a~~~~~~~~i~v~~~~~~~~~~~GDy~~n~A~~lak~lk~~~~~~~P~eiA~~i~~~~~~el~ 88 (214)
-||+.+++..|..+|..++|....+++.|.+++.+ +|||||||+||.|++++|.+|+++.|++||+.|... ++
T Consensus 71 ~ni~~~L~~lF~~aik~a~Pd~~~vp~liaps~~~---kFGDYQCNnAMgl~~~lK~kg~~~~P~~va~~l~~~----lP 143 (656)
T KOG4426|consen 71 SNIFRRLQSLFDVAIKLAFPDLPDVPLLIAPSPNA---KFGDYQCNNAMGLSSKLKGKGINKRPRDVAQELQKH----LP 143 (656)
T ss_pred ccHHHHHHHHHHHHHHHhCCCCCCCCceeccCccc---ccccccccchhhHHHHHhhcCCccCcHHHHHHHHhh----CC
Confidence 58999999999999999999887778888888777 999999999999999999999999999999999999 98
Q ss_pred cCCccccccceeEEecCeEEEEEeCHHHHHHHHHHHHHcCCCCCCCCCCeeEEEeecCcccccccccccchhhhhcc
Q psy695 89 TNPSLAKVIDKIEVAKPGFVNVFLSRVYAGEQIKDIIVNGVQPPTLNKKLRVLVDFSSPNIAKEMHVGHLSRSLCHG 165 (214)
Q Consensus 89 ~~~~~~~~i~~v~iagpGFIN~~l~~~~~~~~l~~i~~~~~~~~~~~~~~~V~IEf~Spn~~~~~hvgh~R~~~lg~ 165 (214)
.+ ++|++++|+||||||++|+..|++.+|..++.+|...|.+. .++|+|||+|||++++|||||+|++|+|+
T Consensus 144 ~s----e~vEk~~iagpGFiNv~Ls~d~~~~~i~nll~~GV~~P~l~-~KrvlVDFSSPNIAKeMHVGHLRSTIIGd 215 (656)
T KOG4426|consen 144 TS----EMVEKCEIAGPGFINVFLSKDYMSKQISNLLVNGVKLPTLS-VKRVLVDFSSPNIAKEMHVGHLRSTIIGD 215 (656)
T ss_pred ch----hhhhhhcccCCceEEEEechHHHHHHHHHHHHcCCCCcccc-eeeEEEecCCCcHHHHhhhhhhhhhhHhH
Confidence 87 89999999999999999999999999999999999988874 48999999999999999999999999976
|
|
| >COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02286 arginine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK12451 arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK01611 argS arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00456 argS arginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF03485 Arg_tRNA_synt_N: Arginyl tRNA synthetase N terminal domain; InterPro: IPR005148 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >KOG1195|consensus | Back alignment and domain information |
|---|
| >PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases | Back alignment and domain information |
|---|
| >PRK13208 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00419 valyl-tRNA synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK05729 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN02381 valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases | Back alignment and domain information |
|---|
| >PLN02943 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00422 valS valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase | Back alignment and domain information |
|---|
| >COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00392 ileS isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02959 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| 2zue_A | 629 | Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase | 99.94 | |
| 1f7u_A | 607 | Arginyl-tRNA synthetase; RNA-protein complex, amin | 99.91 | |
| 1iq0_A | 592 | Arginyl-tRNA synthetase; riken structural genomics | 99.9 | |
| 3gdz_A | 109 | Arginyl-tRNA synthetase; klebsiella pneumoniae sub | 99.86 | |
| 3fnr_A | 464 | Arginyl-tRNA synthetase; transferase, PSI-2, NYSGX | 99.16 | |
| 3al0_C | 592 | Glutamyl-tRNA(Gln) amidotransferase subunit C, GL | 97.11 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 95.48 | |
| 2o5r_A | 481 | Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g | 95.35 | |
| 2d5b_A | 500 | Methionyl-tRNA synthetase; rossmann fold, class 1A | 95.1 | |
| 2csx_A | 497 | Methionyl-tRNA synthetase; ligase, riken structura | 94.91 | |
| 3kfl_A | 564 | Methionyl-tRNA synthetase; parasite, aminoacyl-tRN | 94.79 | |
| 1li5_A | 461 | Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys | 93.6 | |
| 4dlp_A | 536 | Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA | 92.97 | |
| 3c8z_A | 414 | Cysteinyl-tRNA synthetase; cysteine ligase, rossma | 92.43 | |
| 2x1l_A | 524 | Methionyl-tRNA synthetase; nucleotide-binding, pro | 91.13 | |
| 1irx_A | 523 | Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin | 89.98 | |
| 3tqo_A | 462 | Cysteinyl-tRNA synthetase; protein synthesis, liga | 89.14 | |
| 3h99_A | 560 | Methionyl-tRNA synthetase; rossmann fold, aminoacy | 88.74 | |
| 1ile_A | 821 | Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s | 88.31 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 84.49 | |
| 1rqg_A | 722 | Methionyl-tRNA synthetase; translation, dimerizati | 84.42 | |
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 83.76 | |
| 1gax_A | 862 | Valrs, valyl-tRNA synthetase; protein-RNA complex, | 83.67 | |
| 1ffy_A | 917 | Isoleucyl-tRNA synthetase; protein-RNA complex, me | 82.56 | |
| 1nzj_A | 298 | Hypothetical protein YADB; Zn cluster, glutamyl T- | 82.05 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 80.99 |
| >2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A | Back alignment and structure |
|---|
Probab=99.94 E-value=1.8e-27 Score=229.80 Aligned_cols=139 Identities=25% Similarity=0.450 Sum_probs=118.1
Q ss_pred ccHHHHHHHHHHHHHHHhCCccCCCccccccCccccccccccchhhHHHHHHHHhcccCCCCChHHHHHHHHHhhhhhhc
Q psy695 9 MSVRDYLSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCKIFKDKGEKKNPFDIAQSIASVVTSELA 88 (214)
Q Consensus 9 m~i~~~~~~~i~~aI~~a~~~~~~~~i~v~~~~~~~~~~~GDy~~n~A~~lak~lk~~~~~~~P~eiA~~i~~~~~~el~ 88 (214)
|++++.+...|..++....... ...+.|+.|+++ .|||||||+||.|||.++ ++|++||+.|++. |.
T Consensus 3 ~~~~~~i~~~~~~a~~~~~~~~-~~~~~v~~~~~~---~~GD~~~n~a~~lak~~~-----~~P~~iA~~i~~~----l~ 69 (629)
T 2zue_A 3 MEIRESVKERIEEIIKEIAPQW-EGEIELKETPDP---KLGDFGTPIAFKLAKLLK-----RPPIEIAEKIVEK----LK 69 (629)
T ss_dssp CTTHHHHHHHHHHHHHHHCTTC-CCCCCCEECSSG---GGCSEEECHHHHHHHHHT-----SCHHHHHHHHHHH----HT
T ss_pred HHHHHHHHHHHHHHHHhcCccc-cccceeeCCCCC---CCCceeHHHHHHHHHHcC-----CCHHHHHHHHHHH----hh
Confidence 5778888888888888764322 234568888888 999999999999999997 8999999999999 75
Q ss_pred c--CCccccccceeEEecCeEEEEEeCHHHHH-HHHHHHHHcCCCCCC--CCCCeeEEEeecCcccccccccccchhhhh
Q psy695 89 T--NPSLAKVIDKIEVAKPGFVNVFLSRVYAG-EQIKDIIVNGVQPPT--LNKKLRVLVDFSSPNIAKEMHVGHLSRSLC 163 (214)
Q Consensus 89 ~--~~~~~~~i~~v~iagpGFIN~~l~~~~~~-~~l~~i~~~~~~~~~--~~~~~~V~IEf~Spn~~~~~hvgh~R~~~l 163 (214)
. . ++|++++++| |||||+|++.++. ..+..++..+..||. .+++++|+|||+||||++++||||+|++++
T Consensus 70 ~~~~----~~i~~vevag-GfiN~~l~~~~~~~~~~~~i~~~~~~yG~~~~~~~~~V~ve~~spN~~~~~HiGH~Rs~ii 144 (629)
T 2zue_A 70 LNLP----EGIKDVKAVN-GYINVFIDYPHFARILINDILAKGDRFGSSEIGKGKKVIVEHTSVNPTKPLHMGHARNAIL 144 (629)
T ss_dssp TSCC----TTEEEEEEET-TEEEEEECHHHHHHHHHHHHHHHGGGTTCCCTTTTCEEEEECCCCCTTSCCBHHHHHHHHH
T ss_pred hccC----CCeEEEEEcC-CEEEEEECHHHHHHHHHHHHHhcchhcCCCccCCCCEEEEEeeCCCCCCCCccchhHHHHH
Confidence 4 4 6799999999 9999999999555 567777877888875 357889999999999999999999999998
Q ss_pred cc
Q psy695 164 HG 165 (214)
Q Consensus 164 g~ 165 (214)
|+
T Consensus 145 gD 146 (629)
T 2zue_A 145 GD 146 (629)
T ss_dssp HH
T ss_pred HH
Confidence 76
|
| >1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* | Back alignment and structure |
|---|
| >1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 | Back alignment and structure |
|---|
| >3gdz_A Arginyl-tRNA synthetase; klebsiella pneumoniae subsp. pneumo 78578, structural genomics, PSI-2; HET: MSE; 2.20A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3fnr_A Arginyl-tRNA synthetase; transferase, PSI-2, NYSGXRC, struc genomics, protein structure initiative; 2.20A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3al0_C Glutamyl-tRNA(Gln) amidotransferase subunit C, GL tRNA synthetase 2; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A | Back alignment and structure |
|---|
| >2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* | Back alignment and structure |
|---|
| >3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B | Back alignment and structure |
|---|
| >4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* | Back alignment and structure |
|---|
| >1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 | Back alignment and structure |
|---|
| >3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A | Back alignment and structure |
|---|
| >1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* | Back alignment and structure |
|---|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* | Back alignment and structure |
|---|
| >1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 | Back alignment and structure |
|---|
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* | Back alignment and structure |
|---|
| >1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A | Back alignment and structure |
|---|
| >1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* | Back alignment and structure |
|---|
| >1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 214 | ||||
| d1iq0a2 | 370 | c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS | 2e-07 | |
| d1f7ua2 | 348 | c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgR | 5e-07 | |
| d1iq0a3 | 96 | d.67.2.1 (A:1-96) Arginyl-tRNA synthetase (ArgRS), | 3e-06 | |
| d1f7ua3 | 134 | d.67.2.1 (A:2-135) Arginyl-tRNA synthetase (ArgRS) | 7e-04 |
| >d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Length = 370 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Arginyl-tRNA synthetase (ArgRS) species: Thermus thermophilus [TaxId: 274]
Score = 48.0 bits (113), Expect = 2e-07
Identities = 13/27 (48%), Positives = 17/27 (62%)
Query: 132 PTLNKKLRVLVDFSSPNIAKEMHVGHL 158
P + VLV+ +S N KE+HVGHL
Sbjct: 1 PFPRRPGVVLVEHTSVNPNKELHVGHL 27
|
| >d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 348 | Back information, alignment and structure |
|---|
| >d1iq0a3 d.67.2.1 (A:1-96) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Thermus thermophilus [TaxId: 274]} Length = 96 | Back information, alignment and structure |
|---|
| >d1f7ua3 d.67.2.1 (A:2-135) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 214 | |||
| d1iq0a3 | 96 | Arginyl-tRNA synthetase (ArgRS), N-terminal 'addit | 99.7 | |
| d1f7ua3 | 134 | Arginyl-tRNA synthetase (ArgRS), N-terminal 'addit | 99.49 | |
| d1f7ua2 | 348 | Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa | 99.05 | |
| d1iq0a2 | 370 | Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi | 98.96 | |
| d1irxa2 | 317 | Class I lysyl-tRNA synthetase {Archaeon Pyrococcus | 97.71 | |
| d1ivsa4 | 425 | Valyl-tRNA synthetase (ValRS) {Thermus thermophilu | 95.53 | |
| d2d5ba2 | 348 | Methionyl-tRNA synthetase (MetRS) {Thermus thermop | 95.28 | |
| d1li5a2 | 315 | Cysteinyl-tRNA synthetase (CysRS) {Escherichia col | 94.74 | |
| d1pfva2 | 350 | Methionyl-tRNA synthetase (MetRS) {Escherichia col | 93.87 | |
| d1rqga2 | 361 | Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys | 91.73 | |
| d1ilea3 | 452 | Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop | 88.5 | |
| d1nzja_ | 286 | Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia c | 87.89 | |
| d1gtra2 | 331 | Glutaminyl-tRNA synthetase (GlnRS) {Escherichia co | 87.08 | |
| d1ffya3 | 450 | Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus | 86.74 | |
| d1j09a2 | 305 | Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph | 86.17 | |
| d1h3na3 | 494 | Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil | 83.2 |
| >d1iq0a3 d.67.2.1 (A:1-96) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: RRF/tRNA synthetase additional domain-like superfamily: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain family: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain domain: Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain species: Thermus thermophilus [TaxId: 274]
Probab=99.70 E-value=1e-17 Score=123.99 Aligned_cols=89 Identities=21% Similarity=0.225 Sum_probs=70.3
Q ss_pred HHHHHHHHHHHHHHhCCccCCCccccccCccccccccccchhhHHHHHHHHhcccCCCCChHHHHHHHHHhhhhhhccCC
Q psy695 12 RDYLSDVFTHAVQVAFPELGDKTASVASTNEKYVHKFGDFQCNDAMALCKIFKDKGEKKNPFDIAQSIASVVTSELATNP 91 (214)
Q Consensus 12 ~~~~~~~i~~aI~~a~~~~~~~~i~v~~~~~~~~~~~GDy~~n~A~~lak~lk~~~~~~~P~eiA~~i~~~~~~el~~~~ 91 (214)
++.+.+.|..++.... .+..+.++.|+++ +||||+|| ||.|||.++ ++|++||+.|++. |...
T Consensus 3 ~~~i~~~i~~~l~~~~---~~~~~~i~~~~~~---~~GD~a~n-a~~laK~~~-----k~P~~iA~~I~~~----l~~~- 65 (96)
T d1iq0a3 3 RRALEEAIAQALKEMG---VPVRLKVARAPKD---KPGDYGVP-LFALAKELR-----KPPQAIAQELKDR----LPLP- 65 (96)
T ss_dssp HHHHHHHHHHHHHTTS---CCCCCCCEECSTT---SSCSEEEE-CSHHHHHTT-----SCHHHHHHHHHHT----CCCC-
T ss_pred HHHHHHHHHHHHHhcC---CCCceeeecCCCC---CCcchHHH-HHHHHHHHC-----CCHHHHHHHHHHH----hccC-
Confidence 3444444444444321 1335678888888 99999999 999999997 8999999999999 8665
Q ss_pred ccccccceeEEecCeEEEEEeCHHHHHHHH
Q psy695 92 SLAKVIDKIEVAKPGFVNVFLSRVYAGEQI 121 (214)
Q Consensus 92 ~~~~~i~~v~iagpGFIN~~l~~~~~~~~l 121 (214)
++|++++++|| ||||+|++.|+.+.+
T Consensus 66 ---~~i~~v~~~gp-FiNf~l~~~~l~~~i 91 (96)
T d1iq0a3 66 ---EFVEEAVPVGG-YLNFRLRTEALLREA 91 (96)
T ss_dssp ---TTEEEEEEETT-EEEEEECHHHHHHHH
T ss_pred ---cccceeEeeCC-eEEEEECHHHHHHHH
Confidence 78999999996 999999999987544
|
| >d1f7ua3 d.67.2.1 (A:2-135) Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtra2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|