Psyllid ID: psy6973

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
GNEILNKGNGKSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLELDEW
ccccccccccccccccHHHHHHHHHHHHccccccccccccccccccEEEcccEEEEEEccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccc
ccHHHcccccccccccHHHHHHHHHHHHHcccccEccccccEcccEEEccccEEEcHHHHHHHHHHccccccEEEcccccccHcccEEEcHHHHHHHHHHccccccEEEcccccc
gneilnkgngksrLQSSVETASLQSirsrvpgnltcadcaeagptwaSLNLGLLLCIQccgvhrclgahVSRVrsleldewplnLGLLLCIqccgvhrclgahvsrvrfleldew
gneilnkgngksrlqSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSrvrfleldew
GNEILNKGNGKSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLELDEW
*****************************VPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLEL***
****************************RVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVS**********
*************************IRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLELDEW
***************SSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLEL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GNEILNKGNGKSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHRCLGAHVSRVRFLELDEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q9NGC3 995 Centaurin-gamma-1A OS=Dro no N/A 0.721 0.083 0.523 9e-22
Q6NRL1 864 Arf-GAP with GTPase, ANK N/A N/A 0.643 0.085 0.613 4e-20
Q8BXK8 857 Arf-GAP with GTPase, ANK yes N/A 0.643 0.086 0.6 8e-20
Q9UPQ3 857 Arf-GAP with GTPase, ANK yes N/A 0.643 0.086 0.6 1e-19
Q3UHD9 1186 Arf-GAP with GTPase, ANK no N/A 0.686 0.066 0.562 1e-19
Q8CGU4 1186 Arf-GAP with GTPase, ANK no N/A 0.686 0.066 0.562 1e-19
Q5VW22 663 Arf-GAP with GTPase, ANK no N/A 0.704 0.122 0.536 3e-19
Q99490 1192 Arf-GAP with GTPase, ANK no N/A 0.686 0.066 0.55 6e-19
Q5VUJ5 663 Arf-GAP with GTPase, ANK no N/A 0.704 0.122 0.524 2e-18
Q8TF27 550 Arf-GAP with GTPase, ANK no N/A 0.643 0.134 0.573 3e-18
>sp|Q9NGC3|CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster GN=cenG1A PE=2 SV=2 Back     alignment and function desciption
 Score =  102 bits (253), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 62/84 (73%), Gaps = 1/84 (1%)

Query: 9   NGKSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGA 68
           + K++  +S + A++ +IR RVPGN  C DC    P WASLNLG+L+CI+C GVHR LG+
Sbjct: 690 SSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGS 749

Query: 69  HVSRVRSLELDEWPL-NLGLLLCI 91
           H+S+VRSL LD+WP  +L ++L I
Sbjct: 750 HISKVRSLGLDDWPSPHLSVMLAI 773
GTPase-activating protein for the ADP ribosylation factor family.
Drosophila melanogaster (taxid: 7227)
>sp|Q6NRL1|AGAP1_XENLA Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis GN=agap1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BXK8|AGAP1_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Agap1 PE=2 SV=1 Back     alignment and function description
>sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 Back     alignment and function description
>sp|Q3UHD9|AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Agap2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CGU4|AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Agap2 PE=1 SV=1 Back     alignment and function description
>sp|Q5VW22|AGAP6_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 OS=Homo sapiens GN=AGAP6 PE=2 SV=1 Back     alignment and function description
>sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 Back     alignment and function description
>sp|Q5VUJ5|AGAP7_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 OS=Homo sapiens GN=AGAP7 PE=2 SV=1 Back     alignment and function description
>sp|Q8TF27|AGA11_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 OS=Homo sapiens GN=AGAP11 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
270001122 570 hypothetical protein TcasGA2_TC011430 [T 0.756 0.152 0.556 9e-23
189241692 599 PREDICTED: similar to AGAP009160-PA [Tri 0.756 0.145 0.556 5e-22
157130881 759 centaurin gamma [Aedes aegypti] gi|10888 0.721 0.109 0.583 6e-22
170060156 860 centaurin-gamma 1A [Culex quinquefasciat 0.721 0.096 0.583 1e-21
158299912 889 AGAP009160-PA [Anopheles gambiae str. PE 0.721 0.093 0.583 1e-21
195433571 959 GK15018 [Drosophila willistoni] gi|19416 0.721 0.086 0.547 1e-21
321475825 874 hypothetical protein DAPPUDRAFT_44591 [D 0.686 0.090 0.609 2e-21
427783795 867 Putative gtpase-activating protein centa 0.686 0.091 0.566 5e-21
427780055 895 Putative gtpase-activating protein centa 0.686 0.088 0.566 5e-21
427783793 867 Putative gtpase-activating protein centa 0.686 0.091 0.566 5e-21
>gi|270001122|gb|EEZ97569.1| hypothetical protein TcasGA2_TC011430 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  110 bits (276), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 49/88 (55%), Positives = 66/88 (75%), Gaps = 1/88 (1%)

Query: 5   LNKGNGKSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHR 64
           LN+ +   +  + +E A++QSIRSRVPGN  C DC    P WASLNLG+L+CI+C G+HR
Sbjct: 286 LNESSKGKKQNNPMEAATIQSIRSRVPGNGFCVDCDATNPDWASLNLGVLMCIECSGIHR 345

Query: 65  CLGAHVSRVRSLELDEWPL-NLGLLLCI 91
            LG+H+SRVRSL+LDEWP  +L ++L I
Sbjct: 346 NLGSHISRVRSLDLDEWPAGHLSVMLAI 373

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189241692|ref|XP_969889.2| PREDICTED: similar to AGAP009160-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157130881|ref|XP_001662044.1| centaurin gamma [Aedes aegypti] gi|108881886|gb|EAT46111.1| AAEL002660-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|170060156|ref|XP_001865678.1| centaurin-gamma 1A [Culex quinquefasciatus] gi|167878685|gb|EDS42068.1| centaurin-gamma 1A [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158299912|ref|XP_319921.4| AGAP009160-PA [Anopheles gambiae str. PEST] gi|157013746|gb|EAA14733.4| AGAP009160-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195433571|ref|XP_002064784.1| GK15018 [Drosophila willistoni] gi|194160869|gb|EDW75770.1| GK15018 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|321475825|gb|EFX86787.1| hypothetical protein DAPPUDRAFT_44591 [Daphnia pulex] Back     alignment and taxonomy information
>gi|427783795|gb|JAA57349.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427780055|gb|JAA55479.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427783793|gb|JAA57348.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
UNIPROTKB|H7C0A7276 AGAP1 "Arf-GAP with GTPase, AN 0.643 0.268 0.6 2.1e-20
UNIPROTKB|F1SM13 511 AGAP1 "Uncharacterized protein 0.643 0.144 0.6 5.5e-20
UNIPROTKB|F1SKF2377 AGAP2 "Uncharacterized protein 0.678 0.206 0.556 7.2e-20
UNIPROTKB|F1MGL2 807 AGAP1 "Uncharacterized protein 0.643 0.091 0.6 1.5e-19
FB|FBgn0028509 995 CenG1A "Centaurin gamma 1A" [D 0.721 0.083 0.523 2e-19
UNIPROTKB|F1P7C6 857 F1P7C6 "Uncharacterized protei 0.643 0.086 0.6 2.1e-19
RGD|1309244 669 Agap1 "ArfGAP with GTPase doma 0.643 0.110 0.6 2.2e-19
UNIPROTKB|F5GXM9 696 AGAP1 "Arf-GAP with GTPase, AN 0.643 0.106 0.6 2.4e-19
MGI|MGI:3580016 1186 Agap2 "ArfGAP with GTPase doma 0.678 0.065 0.569 2.6e-19
RGD|628844 1186 Agap2 "ArfGAP with GTPase doma 0.678 0.065 0.569 2.6e-19
UNIPROTKB|H7C0A7 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 241 (89.9 bits), Expect = 2.1e-20, P = 2.1e-20
 Identities = 45/75 (60%), Positives = 55/75 (73%)

Query:    11 KSRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHV 70
             KSRL S  E  +LQSIR+ + GN  C DC    P WASLNLG L+CI+C G+HR LG H+
Sbjct:   153 KSRLTSQSEAMALQSIRN-MRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHL 211

Query:    71 SRVRSLELDEWPLNL 85
             SRVRSL+LD+WP+ L
Sbjct:   212 SRVRSLDLDDWPVEL 226
GO:0005543 "phospholipid binding" evidence=IEA
GO:0008060 "ARF GTPase activator activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0032312 "regulation of ARF GTPase activity" evidence=IEA
UNIPROTKB|F1SM13 AGAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKF2 AGAP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MGL2 AGAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0028509 CenG1A "Centaurin gamma 1A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7C6 F1P7C6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1309244 Agap1 "ArfGAP with GTPase domain, ankyrin repeat and PH domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F5GXM9 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3580016 Agap2 "ArfGAP with GTPase domain, ankyrin repeat and PH domain 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628844 Agap2 "ArfGAP with GTPase domain, ankyrin repeat and PH domain 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8BXK8AGAP1_MOUSENo assigned EC number0.60.64340.0863yesN/A
O74345UCP3_SCHPONo assigned EC number0.53960.53910.1031yesN/A
P40529AGE2_YEASTNo assigned EC number0.55550.46080.1778yesN/A
Q9UPQ3AGAP1_HUMANNo assigned EC number0.60.64340.0863yesN/A
Q9C6C3AGD2_ARATHNo assigned EC number0.61810.47820.0708yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
pfam01412117 pfam01412, ArfGap, Putative GTPase activating prot 6e-27
smart00105119 smart00105, ArfGap, Putative GTP-ase activating pr 3e-23
COG5347 319 COG5347, COG5347, GTPase-activating protein that r 5e-23
PLN03114 395 PLN03114, PLN03114, ADP-ribosylation factor GTPase 1e-15
PLN03131 705 PLN03131, PLN03131, hypothetical protein; Provisio 2e-04
PLN03119 648 PLN03119, PLN03119, putative ADP-ribosylation fact 5e-04
>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf Back     alignment and domain information 
 Score = 95.8 bits (239), Expect = 6e-27
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 23 LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 82
          L+ +R ++PGN  CADC    PTWASLNLG+ +CI+C GVHR LG H+S+VRSL LD+W 
Sbjct: 4  LRELR-KLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLDKWT 62

Query: 83 LNLGLLLCIQCCG 95
               L  ++  G
Sbjct: 63 PE--QLEFMKAGG 73

Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117
>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178666 PLN03119, PLN03119, putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
KOG0703|consensus 287 99.97
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 99.97
KOG0706|consensus 454 99.96
PF01412116 ArfGap: Putative GTPase activating protein for Arf 99.96
KOG0704|consensus 386 99.95
smart00105112 ArfGap Putative GTP-ase activating proteins for th 99.95
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 99.94
PLN03131 705 hypothetical protein; Provisional 99.9
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 99.9
KOG0705|consensus 749 99.88
KOG0521|consensus 785 99.75
KOG1117|consensus 1186 99.56
KOG0818|consensus 669 99.54
KOG0702|consensus 524 98.82
KOG0703|consensus 287 98.74
COG5347 319 GTPase-activating protein that regulates ARFs (ADP 98.71
KOG0704|consensus 386 98.42
smart00105112 ArfGap Putative GTP-ase activating proteins for th 98.41
KOG0706|consensus 454 98.35
PF01412116 ArfGap: Putative GTPase activating protein for Arf 98.32
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 98.25
KOG0705|consensus 749 98.1
KOG0521|consensus 785 97.52
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 96.64
PLN03131 705 hypothetical protein; Provisional 96.56
KOG1117|consensus 1186 93.0
KOG0818|consensus 669 88.58
PRK12495 226 hypothetical protein; Provisional 82.35
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 81.78
>KOG0703|consensus Back     alignment and domain information 
Probab=99.97  E-value=9.6e-32  Score=212.83  Aligned_cols=85  Identities=35%  Similarity=0.743  Sum_probs=79.3

Q ss_pred             CChHHHHHHHHHHhcCCCCCCccCCCCCCCCeeeeeccchhhhhccccccCCCceeeEEEecCCCcccchhhhhhhhhcc
Q psy6973          15 QSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCC   94 (115)
Q Consensus        15 ~~~~~~~~l~~l~~~~~~N~~CaDCg~~~p~waS~~~GvflC~~CsgiHR~lG~~is~VkSl~ld~W~~~~~~~m~~~gn   94 (115)
                      ..+..+..|.+|++ .|+|++|||||++.|+|||+|+|||||+.|+||||+||+|||+||||+||.|++|+|+.|...||
T Consensus         8 ~~~~~~~~l~~Ll~-~~~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN   86 (287)
T KOG0703|consen    8 SNERNKRRLRELLR-EPDNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGN   86 (287)
T ss_pred             ccchHHHHHHHHHc-CcccCcccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcc
Confidence            34666888999999 89999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             Cccccc
Q psy6973          95 GVHRCL  100 (115)
Q Consensus        95 g~~r~~  100 (115)
                      ..++.+
T Consensus        87 ~~an~~   92 (287)
T KOG0703|consen   87 AKANSY   92 (287)
T ss_pred             hhhhhh
Confidence            877654

>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0706|consensus Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>KOG0704|consensus Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0702|consensus Back     alignment and domain information
>KOG0703|consensus Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0704|consensus Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>KOG0706|consensus Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>KOG1117|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
3t9k_A 390 Crystal Structure Of Acap1 C-portion Mutant S554d F 6e-16
3jue_A 368 Crystal Structure Of Arfgap And Ank Repeat Domain O 8e-16
4f1p_A 368 Crystal Structure Of Mutant S554d For Arfgap And An 8e-16
2crr_A141 Solution Structure Of Arfgap Domain From Human Smap 3e-14
2iqj_A134 Crystal Structure Of The Gap Domain Of Smap1l (Loc6 4e-14
2p57_A144 Gap Domain Of Znf289, An Id1-Regulated Zinc Finger 8e-13
2b0o_E 301 Crystal Structure Of Uplc1 Gap Domain Length = 301 9e-13
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 1e-12
1dcq_A 278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 4e-12
2crw_A149 Solution Structure Of The Arfgap Domain Of Adp-Ribo 8e-12
3fm8_C 392 Crystal Structure Of Full Length Centaurin Alpha-1 2e-11
3feh_A 386 Crystal Structure Of Full Length Centaurin Alpha-1 2e-11
2owa_A138 Crystal Structure Of Putative Gtpase Activating Pro 3e-11
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 7e-11
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 4e-05
3o47_A 329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 7e-09
3dwd_A147 Crystal Structure Of The Arfgap Domain Of Human Arf 1e-08
2olm_A140 Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 6e-04
2d9l_A134 Solution Structure Of The Arfgap Domain Of Human Ri 7e-04
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 41/61 (67%)
Query: 30  VPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLL 89
           V GN  C DC E  P WAS+NLG+ LCIQC G+HR LG H S+VRSL LD W   L  L+
Sbjct: 42  VDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLM 101
Query: 90  C 90
           C
Sbjct: 102 C 102
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 Back     alignment and structure
>pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 Back     alignment and structure
>pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 Back     alignment and structure
>pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 Back     alignment and structure
>pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 Back     alignment and structure
>pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 Back     alignment and structure
>pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 Back     alignment and structure
>pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 7e-30
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-29
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 4e-29
2owa_A138 Arfgap-like finger domain containing protein; zinc 9e-29
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 2e-28
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 4e-28
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 9e-28
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 9e-28
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 3e-27
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-27
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 1e-24
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 1e-24
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 2e-24
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 1e-19
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 Back     alignment and structure
 Score =  103 bits (259), Expect = 7e-30
 Identities = 25/68 (36%), Positives = 38/68 (55%)

Query: 15 QSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVR 74
           ++     +  ++     N  C DC  + P W S+N G+ LCI C GVHR LG H+S VR
Sbjct: 4  MNAAAVEFINRLKKEDESNNKCFDCGISNPDWVSVNHGIFLCINCSGVHRSLGVHISIVR 63

Query: 75 SLELDEWP 82
          S+++D + 
Sbjct: 64 SIKMDIFT 71
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
2owa_A138 Arfgap-like finger domain containing protein; zinc 99.97
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 99.97
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 99.97
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 99.97
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 99.97
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 99.96
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 99.96
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 99.96
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 99.94
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 99.94
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 99.93
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 99.91
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 99.91
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
2owa_A138 Arfgap-like finger domain containing protein; zinc 98.66
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 98.61
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 98.56
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 98.56
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 98.5
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 98.5
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 98.42
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 98.32
3jue_A 368 Arfgap with coiled-coil, ANK repeat and PH domain 98.24
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 98.18
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.12
1dcq_A 278 PYK2-associated protein beta; zinc-binding module, 98.05
2b0o_E 301 UPLC1; arfgap, structural genomics, structural gen 98.02
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 97.92
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 89.85
3dfx_A63 Trans-acting T-cell-specific transcription factor 86.49
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 84.87
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 82.08
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
Probab=99.97  E-value=3.5e-33  Score=200.73  Aligned_cols=86  Identities=33%  Similarity=0.597  Sum_probs=79.4

Q ss_pred             ccCCChHHHHHHHHHHhcCCCCCCccCCCCCCCCeeeeeccchhhhhccccccCCCceeeEEEecCCCcccchhhhhhhh
Q psy6973          12 SRLQSSVETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCI   91 (115)
Q Consensus        12 ~~~~~~~~~~~l~~l~~~~~~N~~CaDCg~~~p~waS~~~GvflC~~CsgiHR~lG~~is~VkSl~ld~W~~~~~~~m~~   91 (115)
                      .+..++..+++++.|++ .|+|+.|||||+++|+|+|+|||+|||.+|+|+||+||+|||+||||+||.|+++++++|..
T Consensus        16 ~~~~~~~~~~l~~~l~~-~p~N~~CaDCga~~P~WaS~n~GvfiC~~CsgiHR~LG~hiS~VrSl~lD~w~~~~l~~m~~   94 (138)
T 2owa_A           16 GFVSDKLRDNFFQIVRN-RPENRTCFDCESRNPTWLSLSFAVFICLNCSSDHRKMGVHISFVRSSDLDKFTPIQLVRMDI   94 (138)
T ss_dssp             SCBCHHHHHHHHHHHHH-SGGGGBCTTTCCBSCCEEETTTTEEECHHHHHHHHTTCTTTCCEEETTTSCCCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHc-CcCCCcCCCCcCCCCCeEEecCCEEEhHhhhHHHhCCCCCCCeeeecCcCcCCHHHHHHHHh
Confidence            34566777788888999 99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCccc
Q psy6973          92 QCCGVHR   98 (115)
Q Consensus        92 ~gng~~r   98 (115)
                      +||...+
T Consensus        95 ~GN~~an  101 (138)
T 2owa_A           95 GGNGRAR  101 (138)
T ss_dssp             CCHHHHH
T ss_pred             hccHHHH
Confidence            9887754
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1dcqa2122 g.45.1.1 (A:247-368) Pyk2-associated protein beta 9e-21
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure

class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 78.5 bits (193), Expect = 9e-21
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 29 RVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLL 88
          R+ GN  C DC    PTW S NLG+L CI+C G+HR LG H SR++SL LD    +   L
Sbjct: 11 RMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTS--EL 68

Query: 89 LCIQCCGVHRC 99
          L  +  G    
Sbjct: 69 LLAKNIGNAGF 79

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 99.97
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 98.45
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 92.62
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 89.25
d1d4ua236 DNA repair factor XPA DNA- and RPA-binding domain, 81.56
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: ArfGap/RecO-like zinc finger
superfamily: ArfGap/RecO-like zinc finger
family: Pyk2-associated protein beta ARF-GAP domain
domain: Pyk2-associated protein beta ARF-GAP domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.97  E-value=6.7e-33  Score=193.39  Aligned_cols=79  Identities=38%  Similarity=0.653  Sum_probs=75.3

Q ss_pred             HHHHHHHHHhcCCCCCCccCCCCCCCCeeeeeccchhhhhccccccCCCceeeEEEecCCCcccchhhhhhhhhccCccc
Q psy6973          19 ETASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPLNLGLLLCIQCCGVHR   98 (115)
Q Consensus        19 ~~~~l~~l~~~~~~N~~CaDCg~~~p~waS~~~GvflC~~CsgiHR~lG~~is~VkSl~ld~W~~~~~~~m~~~gng~~r   98 (115)
                      ++++|+.|++ .|+|+.|||||+++|+|+|+|||+|||..|+|+||+||+|||+|+|++||.|+++++++|...||....
T Consensus         2 t~~~l~~l~~-~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld~w~~~~i~~~~~~GN~~~n   80 (122)
T d1dcqa2           2 TKEIISEVQR-MTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLAKNIGNAGFN   80 (122)
T ss_dssp             HHHHHHHHHH-STTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTSCCCGGGGHHHHHSCHHHHH
T ss_pred             hHHHHHHHHh-CCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccCCCCHHHHHHHHHHhHHHHH
Confidence            4679999999 999999999999999999999999999999999999999999999999999999999999999986655
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d4ua2 g.39.1.5 (A:1-36) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure