Psyllid ID: psy6979


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
ccccccccccccccccEEcEEEEcHHHHHHHcccccccccccccccHHHHHHHHccEEEcccccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEcccccccccccccccccccEEEEEEcccccccccccccEEEEEEEc
ccHHHHHHHHEHEEHHHEEEccccccHHHHcccccccccccccHHHHHHHHHHHcccccEcccccccEEEEcccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEcccEEEcEcccccccccccEEcccEEHHHccEcccccccccEEccc
MLVRQQIDYTIFIIEQevevptvpwdkdqlvngfsneywgwggedddmSNRVKAAGLqiiryppdiakYSMLRHrkekanpqssffphsiseghpfnraslfnvGYAEAikirefdcfifhdvdlipeddrnlytcpgmprhmsvavdsmnyrlpyaslfggvsniy
mlvrqqidYTIFiieqevevptvpwdkdqlVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPyaslfggvsniy
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
****QQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSM**********************HPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGV****
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVRQQIDYTIFIIEQEVEVPTVPWDKDQLVNGFSNEYWGWGGEDDDMSNRVKAAGLQIIRYPPDIAKYSMLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q9GUM2 383 Beta-1,4-N-acetylgalactos yes N/A 0.413 0.180 0.647 1e-23
A8Y1P7 384 Beta-1,4-N-acetylgalactos N/A N/A 0.425 0.184 0.633 5e-23
O60513 344 Beta-1,4-galactosyltransf yes N/A 0.455 0.220 0.565 2e-20
O88419 382 Beta-1,4-galactosyltransf yes N/A 0.538 0.235 0.5 4e-20
Q9WVK5 382 Beta-1,4-galactosyltransf yes N/A 0.538 0.235 0.5 4e-20
Q9JMK0 388 Beta-1,4-galactosyltransf no N/A 0.574 0.247 0.484 5e-20
O43286 388 Beta-1,4-galactosyltransf no N/A 0.538 0.231 0.5 7e-20
Q80WN7 344 Beta-1,4-galactosyltransf no N/A 0.425 0.206 0.591 7e-20
Q66HH1 344 Beta-1,4-galactosyltransf no N/A 0.425 0.206 0.591 8e-20
Q9JJ04 344 Beta-1,4-galactosyltransf no N/A 0.425 0.206 0.577 1e-19
>sp|Q9GUM2|BRE4_CAEEL Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans GN=bre-4 PE=1 SV=1 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/71 (64%), Positives = 57/71 (80%)

Query: 96  FNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLP 155
           FNR  L NVGY  A ++  + CFIFHDVDL+PEDDRNLYTCP  PRHMSVA+D  NY+LP
Sbjct: 194 FNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAIDKFNYKLP 253

Query: 156 YASLFGGVSNI 166
           Y+++FGG+S +
Sbjct: 254 YSAIFGGISAL 264




Catalyzes the transfer of galactose onto proteins or lipids. Required for susceptibility to pore-forming crystal toxins in conjunction with bre-1, bre-2, bre-3 and bre-5.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|A8Y1P7|BRE4_CAEBR Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis briggsae GN=bre-4 PE=3 SV=1 Back     alignment and function description
>sp|O60513|B4GT4_HUMAN Beta-1,4-galactosyltransferase 4 OS=Homo sapiens GN=B4GALT4 PE=1 SV=1 Back     alignment and function description
>sp|O88419|B4GT6_RAT Beta-1,4-galactosyltransferase 6 OS=Rattus norvegicus GN=B4galt6 PE=1 SV=1 Back     alignment and function description
>sp|Q9WVK5|B4GT6_MOUSE Beta-1,4-galactosyltransferase 6 OS=Mus musculus GN=B4galt6 PE=2 SV=1 Back     alignment and function description
>sp|Q9JMK0|B4GT5_MOUSE Beta-1,4-galactosyltransferase 5 OS=Mus musculus GN=B4galt5 PE=2 SV=2 Back     alignment and function description
>sp|O43286|B4GT5_HUMAN Beta-1,4-galactosyltransferase 5 OS=Homo sapiens GN=B4GALT5 PE=2 SV=1 Back     alignment and function description
>sp|Q80WN7|B4GT4_CRIGR Beta-1,4-galactosyltransferase 4 OS=Cricetulus griseus GN=B4GALT4 PE=2 SV=1 Back     alignment and function description
>sp|Q66HH1|B4GT4_RAT Beta-1,4-galactosyltransferase 4 OS=Rattus norvegicus GN=B4galt4 PE=2 SV=1 Back     alignment and function description
>sp|Q9JJ04|B4GT4_MOUSE Beta-1,4-galactosyltransferase 4 OS=Mus musculus GN=B4galt4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
380030125 395 PREDICTED: beta-1,4-N-acetylgalactosamin 0.425 0.179 0.788 1e-26
328775879 395 PREDICTED: beta-1,4-N-acetylgalactosamin 0.425 0.179 0.788 1e-26
383865407 399 PREDICTED: beta-1,4-N-acetylgalactosamin 0.425 0.177 0.788 2e-26
383865405254 PREDICTED: beta-1,4-N-acetylgalactosamin 0.425 0.279 0.788 2e-26
442753803 386 Putative udp-gal:glucosylceramide beta-1 0.425 0.183 0.746 2e-26
350401522 398 PREDICTED: beta-1,4-N-acetylgalactosamin 0.413 0.173 0.811 2e-26
340729171 398 PREDICTED: beta-1,4-N-acetylgalactosamin 0.413 0.173 0.811 2e-26
427782137 379 Putative udp-gal:glucosylceramide beta-1 0.425 0.187 0.746 5e-26
307177276 295 Beta-1,4-N-acetylgalactosaminyltransfera 0.425 0.240 0.774 6e-26
195334298 403 GM21525 [Drosophila sechellia] gi|194125 0.443 0.183 0.675 7e-26
>gi|380030125|ref|XP_003698706.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like [Apis florea] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/71 (78%), Positives = 60/71 (84%)

Query: 96  FNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLP 155
           FNRA L NVGY EA+K R FDCFIFHDVDL+PE+DRNLYTCP  PRHMSVAVD  NYRLP
Sbjct: 220 FNRAMLMNVGYVEALKERPFDCFIFHDVDLLPENDRNLYTCPEQPRHMSVAVDKFNYRLP 279

Query: 156 YASLFGGVSNI 166
           YA LFGGVS +
Sbjct: 280 YADLFGGVSAV 290




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328775879|ref|XP_394839.3| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Apis mellifera] Back     alignment and taxonomy information
>gi|383865407|ref|XP_003708165.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|383865405|ref|XP_003708164.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like, partial [Megachile rotundata] Back     alignment and taxonomy information
>gi|442753803|gb|JAA69061.1| Putative udp-gal:glucosylceramide beta-14-galactosyltransferase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|350401522|ref|XP_003486181.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like isoform 1 [Bombus impatiens] gi|350401524|ref|XP_003486182.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729171|ref|XP_003402881.1| PREDICTED: beta-1,4-N-acetylgalactosaminyltransferase bre-4-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|427782137|gb|JAA56520.1| Putative udp-gal:glucosylceramide beta-14-galactosyltransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|307177276|gb|EFN66454.1| Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195334298|ref|XP_002033820.1| GM21525 [Drosophila sechellia] gi|194125790|gb|EDW47833.1| GM21525 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
FB|FBgn0027538 403 beta4GalNAcTA "beta4GalNAcTA" 0.443 0.183 0.675 2.6e-30
ZFIN|ZDB-GENE-061013-84 350 zgc:154116 "zgc:154116" [Danio 0.425 0.202 0.591 1.7e-25
ZFIN|ZDB-GENE-050417-236 364 b4galt1 "UDP-Gal:betaGlcNAc be 0.413 0.189 0.637 3.5e-25
ZFIN|ZDB-GENE-070912-258 379 b4galt2 "UDP-Gal:betaGlcNAc be 0.425 0.187 0.647 4e-25
WB|WBGene00000269 383 bre-4 [Caenorhabditis elegans 0.413 0.180 0.666 1.8e-23
UNIPROTKB|Q9GUM2 383 bre-4 "Beta-1,4-N-acetylgalact 0.413 0.180 0.666 1.8e-23
UNIPROTKB|C9J3R8301 B4GALT4 "N-acetyllactosamine s 0.443 0.245 0.581 2.1e-23
UNIPROTKB|O60513 344 B4GALT4 "Beta-1,4-galactosyltr 0.443 0.215 0.581 2.1e-23
UNIPROTKB|E7ETS9246 B4GALT4 "N-acetyllactosamine s 0.443 0.300 0.581 2.1e-23
RGD|1307880 344 B4galt4 "UDP-Gal:betaGlcNAc be 0.413 0.200 0.608 3.4e-23
FB|FBgn0027538 beta4GalNAcTA "beta4GalNAcTA" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 302 (111.4 bits), Expect = 2.6e-30, Sum P(2) = 2.6e-30
 Identities = 50/74 (67%), Positives = 64/74 (86%)

Query:    91 SEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSM 150
             + G PFNRA++ N+GY EA+K+ ++DCFIFHDVDL+P DDRNLY CP  PRHMSVA+D++
Sbjct:   222 TNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQPRHMSVAIDTL 281

Query:   151 NYRLPYASLFGGVS 164
             N+RLPY S+FGGVS
Sbjct:   282 NFRLPYRSIFGGVS 295


GO:0007291 "sperm individualization" evidence=IMP
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0008376 "acetylgalactosaminyltransferase activity" evidence=IDA
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0006044 "N-acetylglucosamine metabolic process" evidence=IDA
GO:0007528 "neuromuscular junction development" evidence=IMP
GO:0033842 "N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase activity" evidence=IDA
GO:0009247 "glycolipid biosynthetic process" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
ZFIN|ZDB-GENE-061013-84 zgc:154116 "zgc:154116" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-236 b4galt1 "UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-258 b4galt2 "UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00000269 bre-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GUM2 bre-4 "Beta-1,4-N-acetylgalactosaminyltransferase bre-4" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|C9J3R8 B4GALT4 "N-acetyllactosamine synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60513 B4GALT4 "Beta-1,4-galactosyltransferase 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETS9 B4GALT4 "N-acetyllactosamine synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307880 B4galt4 "UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60513B4GT4_HUMAN2, ., 4, ., 1, ., 2, 7, 50.56570.45500.2209yesN/A
Q9GUM2BRE4_CAEEL2, ., 4, ., 1, ., -0.64780.41310.1801yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
cd00899219 cd00899, b4GalT, Beta-4-Galactosyltransferase is i 4e-39
cd00899219 cd00899, b4GalT, Beta-4-Galactosyltransferase is i 2e-23
pfam13733136 pfam13733, Glyco_transf_7N, N-terminal region of g 5e-21
pfam0270978 pfam02709, Glyco_transf_7C, N-terminal domain of g 6e-20
pfam0270978 pfam02709, Glyco_transf_7C, N-terminal domain of g 4e-04
cd06420182 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain 0.004
>gnl|CDD|132999 cd00899, b4GalT, Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
 Score =  131 bits (333), Expect = 4e-39
 Identities = 43/70 (61%), Positives = 54/70 (77%)

Query: 95  PFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRL 154
            FNRA L NVG+ EA+K  ++DCFIFHDVDL+PE+DRNLY C   PRH+SV +D  +Y+L
Sbjct: 47  RFNRAKLLNVGFLEALKDGDWDCFIFHDVDLLPENDRNLYGCEEGPRHLSVPLDKFHYKL 106

Query: 155 PYASLFGGVS 164
           PY + FGGV 
Sbjct: 107 PYKTYFGGVL 116


Beta-4-Galactosyltransferase transfers galactose from uridine diphosphogalactose to the terminal beta-N-acetylglucosamine residues, hereby forming the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids. At least seven homologous beta-4-galactosyltransferase isoforms have been identified that use different types of glycoproteins and glycolipids as substrates. Of the seven identified members of the beta-1,4-galactosyltransferase subfamily (beta1,4-Gal-T1 to -T7), b1,4-Gal-T1 is most characterized (biochemically). It is a Golgi-resident type II membrane enzyme with a cytoplasmic domain, membrane spanning region, and a stem region and catalytic domain facing the lumen. Length = 219

>gnl|CDD|132999 cd00899, b4GalT, Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>gnl|CDD|222351 pfam13733, Glyco_transf_7N, N-terminal region of glycosyl transferase group 7 Back     alignment and domain information
>gnl|CDD|217196 pfam02709, Glyco_transf_7C, N-terminal domain of galactosyltransferase Back     alignment and domain information
>gnl|CDD|217196 pfam02709, Glyco_transf_7C, N-terminal domain of galactosyltransferase Back     alignment and domain information
>gnl|CDD|133042 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG3916|consensus 372 100.0
KOG3916|consensus372 99.94
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 99.94
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 99.86
PF13733136 Glyco_transf_7N: N-terminal region of glycosyl tra 99.81
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 99.68
KOG3917|consensus 310 99.59
KOG3917|consensus310 99.31
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 98.27
KOG3588|consensus494 97.44
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 97.11
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 96.37
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 96.12
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 96.11
COG4092346 Predicted glycosyltransferase involved in capsule 94.95
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 92.09
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 91.75
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 91.52
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 89.01
COG1216305 Predicted glycosyltransferases [General function p 87.51
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 87.04
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 87.02
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 86.74
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 81.68
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 81.55
>KOG3916|consensus Back     alignment and domain information
Probab=100.00  E-value=2.1e-35  Score=254.50  Aligned_cols=88  Identities=56%  Similarity=1.023  Sum_probs=84.2

Q ss_pred             CCCCCCcccccccCCcccccccchhhhHHHHHhhCCcCeEEEEeecccccCCCCccccCCcceeeeeecccccccCCCCc
Q psy6979          79 ANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYAS  158 (167)
Q Consensus        79 ~Npq~~~~v~~q~~~~~fNR~~LlNvg~~eal~~~~~~~~~~hdVDLlP~~~~n~Y~c~~~p~Hls~~~~~~~y~~~y~~  158 (167)
                      +-.++.|++++|.++++||||+|||+||.||++...||||+||||||+||||||+|+|+++|||+|+++|+|+|+|||.+
T Consensus       180 QrL~y~iyVieQ~g~~~FNRakL~NVGf~eAlkd~~wdCfIFHDVDllPenDrNlY~C~~~PRH~sva~dk~gy~LPY~~  259 (372)
T KOG3916|consen  180 QRLDYRIYVIEQAGNKPFNRAKLLNVGFLEALKDYGWDCFIFHDVDLLPENDRNLYGCPEQPRHMSVALDKFGYRLPYKE  259 (372)
T ss_pred             hhhceeEEEEEecCCCcccHHHhhhhHHHHHHHhcCCCEEEEecccccccCCCCccCCCCCCcchhhhhhhccccccchh
Confidence            33456689999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeee
Q psy6979         159 LFGGVSNI  166 (167)
Q Consensus       159 ~~GGv~~~  166 (167)
                      +||||+||
T Consensus       260 ~FGGVsal  267 (372)
T KOG3916|consen  260 YFGGVSAL  267 (372)
T ss_pred             hhCchhhc
Confidence            99999997



>KOG3916|consensus Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>KOG3917|consensus Back     alignment and domain information
>KOG3917|consensus Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
1pzy_B 286 W314a-Beta1,4-Galactosyltransferase-I Complexed Wit 7e-19
1tvy_A 286 Beta-1,4-Galactosyltransferase Mutant Met344his (M3 8e-19
1nmm_B 286 Beta-1,4-Galactosyltransferase Mutant Cys342thr Com 8e-19
2fyd_B 286 Catalytic Domain Of Bovine Beta 1, 4-Galactosyltran 9e-19
1nf5_B 286 Crystal Structure Of Lactose Synthase, Complex With 9e-19
1fr8_A 288 Crystal Structure Of The Bovine Beta 1,4 Galactosyl 9e-19
1fgx_A 288 Crystal Structure Of The Bovine Beta 1,4 Galactosyl 9e-19
1nhe_B 286 Crystal Structure Of Lactose Synthase Complex With 1e-18
2ae7_A 287 Crystal Structure Of Human M340h-Beta1,4-Galactosyl 2e-18
1yro_B 286 Crystal Structure Of Beta14,-Galactosyltransferase 2e-18
3lw6_A287 Crystal Structure Of Drosophila Beta1,4-Galactosylt 3e-06
>pdb|1PZY|B Chain B, W314a-Beta1,4-Galactosyltransferase-I Complexed With Alpha-Lactalbumin In The Presence Of N-Acetylglucosamine, Udp And Manganese Length = 286 Back     alignment and structure

Iteration: 1

Score = 89.7 bits (221), Expect = 7e-19, Method: Compositional matrix adjust. Identities = 39/71 (54%), Positives = 50/71 (70%) Query: 96 FNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLP 155 FNRA L NVG+ EA+K +++CF+F DVDLIP +D N Y C PRH+SVA+D + LP Sbjct: 110 FNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLP 169 Query: 156 YASLFGGVSNI 166 Y FGGVS + Sbjct: 170 YVQYFGGVSAL 180
>pdb|1TVY|A Chain A, Beta-1,4-Galactosyltransferase Mutant Met344his (M344h-Gal- T1) Complex With Udp-Galactose And Manganese Length = 286 Back     alignment and structure
>pdb|1NMM|B Chain B, Beta-1,4-Galactosyltransferase Mutant Cys342thr Complex With Alpha- Lactalbumin And Glcnac Length = 286 Back     alignment and structure
>pdb|2FYD|B Chain B, Catalytic Domain Of Bovine Beta 1, 4-Galactosyltransferase In Complex With Alpha-Lactalbumin, Glucose, Mn, And Udp-N- Acetylgalactosamine Length = 286 Back     alignment and structure
>pdb|1NF5|B Chain B, Crystal Structure Of Lactose Synthase, Complex With Glucose Length = 286 Back     alignment and structure
>pdb|1FR8|A Chain A, Crystal Structure Of The Bovine Beta 1,4 Galactosyltransferase (B4galt1) Catalytic Domain Complexed With Uridine Diphosphogalactose Length = 288 Back     alignment and structure
>pdb|1FGX|A Chain A, Crystal Structure Of The Bovine Beta 1,4 Galactosyltransferase (B4galt1) Catalytic Domain Complexed With Ump Length = 288 Back     alignment and structure
>pdb|1NHE|B Chain B, Crystal Structure Of Lactose Synthase Complex With Udp Length = 286 Back     alignment and structure
>pdb|2AE7|A Chain A, Crystal Structure Of Human M340h-Beta1,4-Galactosyltransferase-I (M340h-B4gal-T1) In Complex With Pentasaccharide Length = 287 Back     alignment and structure
>pdb|1YRO|B Chain B, Crystal Structure Of Beta14,-Galactosyltransferase Mutant Arg228lys In Complex With Alpha-Lactalbumin In The Presence Of Udp-Galactose And Mn Length = 286 Back     alignment and structure
>pdb|3LW6|A Chain A, Crystal Structure Of Drosophila Beta1,4-Galactosyltransferas Length = 287 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2fy7_A 287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 2e-16
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 2e-11
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 3e-13
3lw6_A 287 FI08434P, beta-4-galactosyltransferase 7; protein- 1e-12
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Length = 287 Back     alignment and structure
 Score = 73.8 bits (180), Expect = 2e-16
 Identities = 39/96 (40%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 71  MLRHRKEKANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDD 130
           +    + +      +  +   +   FNRA L NVG+ EA+K  ++ CF+F DVDLIP +D
Sbjct: 87  LHPVLQRQQLDYGIYVINQAGDT-IFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMND 145

Query: 131 RNLYTCPGMPRHMSVAVDSMNYRLPYASLFGGVSNI 166
            N Y C   PRH+SVA+D   + LPY   FGGVS +
Sbjct: 146 HNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSAL 181


>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Length = 287 Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Length = 287 Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
3lw6_A 287 FI08434P, beta-4-galactosyltransferase 7; protein- 99.91
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 99.76
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.58
2fy7_A 287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 98.89
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 95.45
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 95.04
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 94.37
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 94.24
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 93.5
3bcv_A240 Putative glycosyltransferase protein; protein stru 87.05
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
Probab=99.91  E-value=9.9e-26  Score=190.60  Aligned_cols=84  Identities=32%  Similarity=0.556  Sum_probs=77.5

Q ss_pred             CCCCCCcccccccCCcccccccchhhhHHHHHhhCCcCeEEEEeecccccCCCCccccCC--cceeeeeecccccccCCC
Q psy6979          79 ANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPG--MPRHMSVAVDSMNYRLPY  156 (167)
Q Consensus        79 ~Npq~~~~v~~q~~~~~fNR~~LlNvg~~eal~~~~~~~~~~hdVDLlP~~~~n~Y~c~~--~p~Hls~~~~~~~y~~~y  156 (167)
                      +..++.|++++|.++.+||||+|||+||.||.  ..+||++||||||+||||+|+|.|++  +|+|+|++  +|+|++||
T Consensus        80 Q~l~y~I~VieQ~~~~~FNRa~LlNvGf~ea~--~~~d~~ifHDVDLlP~dd~n~Y~c~~~~~P~Hls~~--~~~~~~~Y  155 (287)
T 3lw6_A           80 QGVAHHIFVLNQVDRFRFNRASLINVGFQFAS--DVYDYIAMHDVDLLPLNDNLLYEYPSSLGPLHIAGP--KLHPKYHY  155 (287)
T ss_dssp             TTCEEEEEEEEECSSSCCCHHHHHHHHHHHSC--TTCCEEEEECTTEEECCTTSCCCCCCTTCCEESSCT--TTCSSCCC
T ss_pred             cCCceEEEEEecCCCCccchhheecccHHHHh--ccCCEEEEecccccccCCCccccCCCCCCceEEeec--cccCCCCc
Confidence            44556799999999999999999999999985  47899999999999999999999997  89999974  89999999


Q ss_pred             Ccceeeeeee
Q psy6979         157 ASLFGGVSNI  166 (167)
Q Consensus       157 ~~~~GGv~~~  166 (167)
                      ..+||||+++
T Consensus       156 ~~~~GGv~a~  165 (287)
T 3lw6_A          156 DNFVGGILLV  165 (287)
T ss_dssp             TTCCCSEEEE
T ss_pred             CCccccEEec
Confidence            9999999987



>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1pzta_ 271 c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4Ga 4e-21
d1pzta_271 c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4Ga 4e-16
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: beta 1,4 galactosyltransferase (b4GalT1)
domain: beta 1,4 galactosyltransferase (b4GalT1)
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 85.1 bits (210), Expect = 4e-21
 Identities = 39/73 (53%), Positives = 50/73 (68%)

Query: 95  PFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRL 154
            FNRA L NVG+ EA+K  +++CF+F DVDLIP +D N Y C   PRH+SVA+D   + L
Sbjct: 94  MFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSL 153

Query: 155 PYASLFGGVSNIY 167
           PY   FGGVS + 
Sbjct: 154 PYVQYFGGVSALS 166


>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Length = 271 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1pzta_ 271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 99.87
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 99.86
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 96.97
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: beta 1,4 galactosyltransferase (b4GalT1)
domain: beta 1,4 galactosyltransferase (b4GalT1)
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.87  E-value=2.1e-23  Score=173.60  Aligned_cols=89  Identities=44%  Similarity=0.832  Sum_probs=84.0

Q ss_pred             CCCCCCcccccccCCcccccccchhhhHHHHHhhCCcCeEEEEeecccccCCCCccccCCcceeeeeecccccccCCCCc
Q psy6979          79 ANPQSSFFPHSISEGHPFNRASLFNVGYAEAIKIREFDCFIFHDVDLIPEDDRNLYTCPGMPRHMSVAVDSMNYRLPYAS  158 (167)
Q Consensus        79 ~Npq~~~~v~~q~~~~~fNR~~LlNvg~~eal~~~~~~~~~~hdVDLlP~~~~n~Y~c~~~p~Hls~~~~~~~y~~~y~~  158 (167)
                      +...+.+++++|.++.+||||.|+|+||.+|.+...++|++||||||+|+++++.|.|+++|+|++.++++++|+++|..
T Consensus        78 q~~~y~I~vieQ~~~~~FNRg~llNiGf~~a~~~~~~~~~ifHDVDllP~~~~~~Y~~~~~p~h~~~~~~~~~~~~~y~~  157 (271)
T d1pzta_          78 QQLDYGIYVINQAGESMFNRAKLLNVGFKEALKDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQ  157 (271)
T ss_dssp             TTCEEEEEEEEECSSSCCCHHHHHHHHHHHHHHHSCCCEEEEECTTEEESBTTSCCSCCSSCEECCCEEGGGTTSCSCTT
T ss_pred             cCCCEEEEEEeccCCcchhhhhhhhHHHHHhhhccCccEEEEecCCcCcccccccccccccCcceeeecccccccccccc
Confidence            34456689999999999999999999999999989999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeeeC
Q psy6979         159 LFGGVSNIY  167 (167)
Q Consensus       159 ~~GGv~~~~  167 (167)
                      +||||++|.
T Consensus       158 ~~GGv~~~~  166 (271)
T d1pzta_         158 YFGGVSALS  166 (271)
T ss_dssp             CCCSEEEEE
T ss_pred             ccceeeeec
Confidence            999999873



>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure