Psyllid ID: psy7149

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MDRGVNIVFDDASSNLVQSNGFVSSSLFQSLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
cccccccEEccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHccHHcccccHHHHHHHHHHHEEEEEEccccEEEcccccccEEEEEEEEEEEEEEcccEEEEEccccEEEEEcccccccEEEEEEEEcccEEEEEEcHHHHHHHHcc
cccccEEEEcccHHHHccccHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHEEEEHHcccEEEEEccccccEEEEEEEEEEEEEEcccEEEEEcccccccccccccccccEEEEEEEccccEEEEEcHHHHHHHHcc
mdrgvnivfddassnlvqsngfvsssLFQSLIVKDRVREclekdpsertdddIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGtivmndgeeldsWSVVINGCVEVelsdgrsqmlqvgdsfgilptmEKLYHegvmrtrcddcqfvcitqtdyyriqhq
mdrgvnivfddassnlvqsngfvssslfqsliVKDRVRECLekdpsertdddieQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
MDRGVNIVFDDASSNLVQSNGFVSSSLFQSLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
******IVFDD***NLVQSNGFVSSSLFQSLIVKDRVRECL***********IEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRI***
*******************************IVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
MDRGVNIVFDDASSNLVQSNGFVSSSLFQSLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
*****N***DDASSNLVQSNGFVSSSLFQSLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRGVNIVFDDASSNLVQSNGFVSSSLFQSLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
F1M386 1496 Rap guanine nucleotide ex yes N/A 0.826 0.092 0.659 1e-51
Q9Y4G8 1499 Rap guanine nucleotide ex yes N/A 0.826 0.092 0.659 2e-51
Q8CHG7 1496 Rap guanine nucleotide ex yes N/A 0.826 0.092 0.659 2e-51
Q8TEU7 1601 Rap guanine nucleotide ex no N/A 0.784 0.081 0.595 4e-46
Q9EQZ6 1011 Rap guanine nucleotide ex no N/A 0.766 0.126 0.341 5e-16
Q8WZA2 1011 Rap guanine nucleotide ex no N/A 0.766 0.126 0.333 1e-15
O95398 923 Rap guanine nucleotide ex no N/A 0.742 0.134 0.296 2e-12
Q9Z1C8 926 Rap guanine nucleotide ex no N/A 0.742 0.133 0.288 5e-12
Q8VCC8 918 Rap guanine nucleotide ex no N/A 0.742 0.135 0.288 9e-12
P34578 1038 Rap guanine nucleotide ex no N/A 0.628 0.101 0.276 4e-06
>sp|F1M386|RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Rapgef2 PE=1 SV=2 Back     alignment and function desciption
 Score =  201 bits (512), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 91/138 (65%), Positives = 114/138 (82%)

Query: 30  SLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKA 89
            L+ +D VR+CLEKDP +RTDDDIEQLL+F   L AF NMT++VR+ LC VMVFAVVE+A
Sbjct: 100 PLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERA 159

Query: 90  GTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCD 149
           GTIV+NDGEELDSWSV++NG VEV   DG++++L +G+SFG+ PTM+K Y +GVMRT+ D
Sbjct: 160 GTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVD 219

Query: 150 DCQFVCITQTDYYRIQHQ 167
           DCQFVCI Q DY RI +Q
Sbjct: 220 DCQFVCIAQQDYCRILNQ 237
Guanine nucleotide exchange factor (GEF) for Rap1, Rap1B and Rap2 GTPases.
Rattus norvegicus (taxid: 10116)
>sp|Q9Y4G8|RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens GN=RAPGEF2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CHG7|RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus GN=Rapgef2 PE=1 SV=2 Back     alignment and function description
>sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 Back     alignment and function description
>sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 Back     alignment and function description
>sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 Back     alignment and function description
>sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 Back     alignment and function description
>sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description
>sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description
>sp|P34578|RPGF1_CAEEL Rap guanine nucleotide exchange factor 1 OS=Caenorhabditis elegans GN=epac-1 PE=4 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
242024523 1117 pdz domain containing guanine nucleotide 0.826 0.123 0.833 7e-64
193627205 1595 PREDICTED: rap guanine nucleotide exchan 0.832 0.087 0.805 1e-63
157110707 1449 guanine nucleotide exchange factor [Aede 0.826 0.095 0.804 1e-62
157110705 1450 guanine nucleotide exchange factor [Aede 0.826 0.095 0.804 1e-62
350415848 1472 PREDICTED: rap guanine nucleotide exchan 0.922 0.104 0.691 6e-62
340713368 1378 PREDICTED: rap guanine nucleotide exchan 0.922 0.111 0.691 6e-62
340713364 1345 PREDICTED: rap guanine nucleotide exchan 0.922 0.114 0.691 6e-62
328782423 1358 PREDICTED: rap guanine nucleotide exchan 0.922 0.113 0.691 6e-62
383862539 1351 PREDICTED: rap guanine nucleotide exchan 0.922 0.113 0.691 6e-62
270004579 1218 hypothetical protein TcasGA2_TC003942 [T 0.826 0.113 0.789 7e-62
>gi|242024523|ref|XP_002432677.1| pdz domain containing guanine nucleotide exchange factor, pdz-gef, putative [Pediculus humanus corporis] gi|212518147|gb|EEB19939.1| pdz domain containing guanine nucleotide exchange factor, pdz-gef, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (89%)

Query: 30  SLIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKA 89
           SL V+D VRECLEKDPSERTD DIE LL+ TQHLKAFTNMTLAVR+ALC VMVFAVVEKA
Sbjct: 100 SLTVRDHVRECLEKDPSERTDQDIEILLELTQHLKAFTNMTLAVRRALCAVMVFAVVEKA 159

Query: 90  GTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCD 149
            T+VMNDGEELDSWSV+ING VEVE S+G  + L +GDSFGILPTMEKLYH GVMRT+CD
Sbjct: 160 NTVVMNDGEELDSWSVLINGHVEVEHSNGELEQLGLGDSFGILPTMEKLYHRGVMRTKCD 219

Query: 150 DCQFVCITQTDYYRIQHQ 167
           DCQFVCITQTDYYRIQHQ
Sbjct: 220 DCQFVCITQTDYYRIQHQ 237

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193627205|ref|XP_001952587.1| PREDICTED: rap guanine nucleotide exchange factor 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157110707|ref|XP_001651212.1| guanine nucleotide exchange factor [Aedes aegypti] gi|108878626|gb|EAT42851.1| AAEL005643-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|157110705|ref|XP_001651211.1| guanine nucleotide exchange factor [Aedes aegypti] gi|108878625|gb|EAT42850.1| AAEL005643-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|350415848|ref|XP_003490767.1| PREDICTED: rap guanine nucleotide exchange factor 6-like, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713368|ref|XP_003395216.1| PREDICTED: rap guanine nucleotide exchange factor 6-like isoform 4 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340713364|ref|XP_003395214.1| PREDICTED: rap guanine nucleotide exchange factor 6-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328782423|ref|XP_392340.4| PREDICTED: rap guanine nucleotide exchange factor 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383862539|ref|XP_003706741.1| PREDICTED: rap guanine nucleotide exchange factor 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|270004579|gb|EFA01027.1| hypothetical protein TcasGA2_TC003942 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
UNIPROTKB|F1NL62 994 RAPGEF2 "Uncharacterized prote 0.820 0.137 0.678 1.5e-46
UNIPROTKB|E1BVM2 1491 RAPGEF2 "Uncharacterized prote 0.820 0.091 0.678 3.9e-46
UNIPROTKB|H3BVI8 1478 Rapgef2 "Rap guanine nucleotid 0.820 0.092 0.664 1.7e-45
UNIPROTKB|F1MSG6 1486 RAPGEF2 "Uncharacterized prote 0.820 0.092 0.664 1.7e-45
MGI|MGI:2659071 1496 Rapgef2 "Rap guanine nucleotid 0.820 0.091 0.664 1.7e-45
RGD|1306434 1496 Rapgef2 "Rap guanine nucleotid 0.820 0.091 0.664 1.7e-45
UNIPROTKB|F1PBJ0 1498 RAPGEF2 "Uncharacterized prote 0.820 0.091 0.664 1.7e-45
UNIPROTKB|Q9Y4G8 1499 RAPGEF2 "Rap guanine nucleotid 0.820 0.091 0.664 1.7e-45
UNIPROTKB|F1RTX9 1625 RAPGEF2 "Uncharacterized prote 0.820 0.084 0.664 2e-45
ZFIN|ZDB-GENE-030131-6959 1601 rapgef2 "Rap guanine nucleotid 0.820 0.085 0.656 3.7e-44
UNIPROTKB|F1NL62 RAPGEF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 497 (180.0 bits), Expect = 1.5e-46, P = 1.5e-46
 Identities = 93/137 (67%), Positives = 114/137 (83%)

Query:    31 LIVKDRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAG 90
             L+ +D VR+CLEKDP +RTDDDIEQLL+F   L AF NMT++VR+ LC VMVFAVVE+AG
Sbjct:    81 LMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVERAG 140

Query:    91 TIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDD 150
             TIV+NDGEELDSWSV++NG VEV   DGR+++L +G+SFG+ PTMEK Y +GVMRT+ DD
Sbjct:   141 TIVLNDGEELDSWSVILNGSVEVTYPDGRTEILCMGNSFGVSPTMEKEYMKGVMRTKVDD 200

Query:   151 CQFVCITQTDYYRIQHQ 167
             CQFVCI Q DY RI +Q
Sbjct:   201 CQFVCIAQQDYCRILNQ 217
GO:0005622 "intracellular" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0051056 "regulation of small GTPase mediated signal transduction" evidence=IEA
GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
UNIPROTKB|E1BVM2 RAPGEF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BVI8 Rapgef2 "Rap guanine nucleotide exchange factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSG6 RAPGEF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2659071 Rapgef2 "Rap guanine nucleotide exchange factor (GEF) 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306434 Rapgef2 "Rap guanine nucleotide exchange factor (GEF) 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBJ0 RAPGEF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4G8 RAPGEF2 "Rap guanine nucleotide exchange factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RTX9 RAPGEF2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6959 rapgef2 "Rap guanine nucleotide exchange factor (GEF) 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4G8RPGF2_HUMANNo assigned EC number0.65940.82630.0920yesN/A
Q8CHG7RPGF2_MOUSENo assigned EC number0.65940.82630.0922yesN/A
F1M386RPGF2_RATNo assigned EC number0.65940.82630.0922yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 1e-09
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 6e-08
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 2e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 52.7 bits (127), Expect = 1e-09
 Identities = 26/108 (24%), Positives = 47/108 (43%), Gaps = 7/108 (6%)

Query: 65  AFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEV--ELSDGRSQ- 121
            F+ +     + L   +       AG +++  G+  DS  +V++G VEV     DGR Q 
Sbjct: 1   LFSGLDDEELEELADALEERRF-PAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQI 59

Query: 122 --MLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ 167
              L  GD FG L  +        +R    D + + + ++D+ R+  +
Sbjct: 60  VGFLGPGDLFGELALLGNGPRSATVRAL-TDSELLVLPRSDFRRLLQE 106

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG1113|consensus 368 99.81
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.78
KOG0614|consensus 732 99.77
KOG0614|consensus 732 99.73
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.71
cd00038115 CAP_ED effector domain of the CAP family of transc 99.7
PLN02868 413 acyl-CoA thioesterase family protein 99.69
KOG3542|consensus 1283 99.68
KOG0498|consensus 727 99.68
PRK11753 211 DNA-binding transcriptional dual regulator Crp; Pr 99.67
COG0664 214 Crp cAMP-binding proteins - catabolite gene activa 99.66
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.64
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.64
COG2905 610 Predicted signal-transduction protein containing c 99.62
KOG1113|consensus368 99.62
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 99.59
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.59
KOG0500|consensus 536 99.52
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.41
PRK13918 202 CRP/FNR family transcriptional regulator; Provisio 99.4
PRK09391 230 fixK transcriptional regulator FixK; Provisional 99.39
KOG0499|consensus 815 99.39
KOG0501|consensus 971 98.99
KOG2968|consensus 1158 98.68
KOG3542|consensus 1283 98.52
PF04831153 Popeye: Popeye protein conserved region; InterPro: 98.19
PRK11832207 putative DNA-binding transcriptional regulator; Pr 98.12
KOG2968|consensus 1158 98.05
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 96.33
PRK13290125 ectC L-ectoine synthase; Reviewed 94.12
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 93.78
COG1917131 Uncharacterized conserved protein, contains double 90.83
smart00835146 Cupin_1 Cupin. This family represents the conserve 88.7
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 86.97
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 86.89
PRK11171 266 hypothetical protein; Provisional 86.41
COG0745229 OmpR Response regulators consisting of a CheY-like 86.36
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 85.16
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 83.88
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 82.7
>KOG1113|consensus Back     alignment and domain information 
Probab=99.81  E-value=7e-20  Score=145.73  Aligned_cols=118  Identities=21%  Similarity=0.242  Sum_probs=112.2

Q ss_pred             CCCHHHHHHHHHHhhcChhhhcCCHHHHHHHhhhcceeEEccCCcEEEecCCCCCeEEEEEEeEEEEEEcCceeEEecCC
Q psy7149          47 ERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRSQMLQVG  126 (167)
Q Consensus        47 ~R~~~~~~~i~~~L~~~~~F~~L~~~~l~~l~~~~~~~~~~~~ge~I~~~Gd~~~~lyiI~~G~v~v~~~~~~~~~l~~G  126 (167)
                      ..++++++.+.+.+++.-+|++|+++++..+..++..+.+ ++|+.|+.||+.++.||+|-+|++.|++++..+..++||
T Consensus       111 pKd~e~~~~L~~a~r~~~LF~~Ld~eq~~~v~dam~~~~v-~~G~~Vi~qGdeGd~fYvI~kGt~dVyv~~~~v~~~~~g  189 (368)
T KOG1113|consen  111 PKDDETRRRLEEAFRKNLLFANLDDEQLSQVLDAMFEKRV-KAGETVIKQGDEGDNFYVIDKGTFDVYVNGTYVTTYSPG  189 (368)
T ss_pred             CCCHHHHHHHHHHHHhccccccCCHHHHHHHHHhhceeee-cCCcEEEecCCcCCcEEEEecceEEEEECCeEEeeeCCC
Confidence            4667888899999999999999999999999999999999 999999999999999999999999999999999999999


Q ss_pred             CeeeecccccCCceeeEEEEecCceEEEEEeHHHHHHHhc
Q psy7149         127 DSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQH  166 (167)
Q Consensus       127 d~FGe~all~~~~r~~tv~~a~~~~~ll~i~~~~f~~ll~  166 (167)
                      ..|||+||+.+.||.+|+ .|.+++.+|.+++..|.+++.
T Consensus       190 ~sFGElALmyn~PRaATv-~a~t~~klWgldr~SFrrIi~  228 (368)
T KOG1113|consen  190 GSFGELALMYNPPRAATV-VAKSLKKLWGLDRTSFRRIIM  228 (368)
T ss_pred             CchhhhHhhhCCCcccce-eeccccceEEEeeceeEEEee
Confidence            999999999999999999 688999999999999987653

>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2d93_A134 Solution Structure Of The Cnmp_binding Domain Of Hu 4e-37
3cf6_E 694 Structure Of Epac2 In Complex With Cyclic-Amp And R 3e-17
2byv_E 999 Structure Of The Camp Responsive Exchange Factor Ep 4e-17
1o7f_A469 Crystal Structure Of The Regulatory Domain Of Epac2 4e-17
4f7z_A 999 Conformational Dynamics Of Exchange Protein Directl 2e-16
>pdb|2D93|A Chain A, Solution Structure Of The Cnmp_binding Domain Of Human Rap Guanine Nucleotide Exchange Factor 6 Length = 134 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (379), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 87/112 (77%)
Query: 53  IEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVE 112
           IEQLL+F   L AF NMT++VR+ LC VM+F VVE+AG I++ DG+ELDSW V++NG VE
Sbjct: 11  IEQLLEFMHQLPAFANMTMSVRRELCSVMIFEVVEQAGAIILEDGQELDSWYVILNGTVE 70
Query: 113 VELSDGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRI 164
           +   DG+ + L +G+SFGI PT++K Y  G++RT+ DDCQFVCI Q DY+RI
Sbjct: 71  ISHPDGKVENLFMGNSFGITPTLDKQYMHGIVRTKVDDCQFVCIAQQDYWRI 122
>pdb|3CF6|E Chain E, Structure Of Epac2 In Complex With Cyclic-Amp And Rap Length = 694 Back     alignment and structure
>pdb|2BYV|E Chain E, Structure Of The Camp Responsive Exchange Factor Epac2 In Its Auto-Inhibited State Length = 999 Back     alignment and structure
>pdb|1O7F|A Chain A, Crystal Structure Of The Regulatory Domain Of Epac2 Length = 469 Back     alignment and structure
>pdb|4F7Z|A Chain A, Conformational Dynamics Of Exchange Protein Directly Activated By Camp Length = 999 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 4e-58
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-54
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 3e-44
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 6e-42
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 1e-23
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 5e-22
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 3e-10
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 5e-09
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 1e-08
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 3e-07
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 5e-07
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 5e-04
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 1e-06
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 3e-06
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-04
3ukn_A212 Novel protein similar to vertebrate potassium VOL 2e-04
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
 Score =  191 bits (486), Expect = 4e-58
 Identities = 44/134 (32%), Positives = 70/134 (52%), Gaps = 1/134 (0%)

Query: 35  DRVRECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVM 94
             +R  L K P +RT DD+E + D   H+KA ++++  V++ L GV++F    K GT++ 
Sbjct: 9   AHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLF 68

Query: 95  NDGEELDSWSVVINGCVEVELS-DGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQF 153
           N GEE  SW +++ G V V +   G    L  GD FG L  +        +  R D+C F
Sbjct: 69  NQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHF 128

Query: 154 VCITQTDYYRIQHQ 167
           + + + D+ RI   
Sbjct: 129 LRVDKEDFNRILRD 142
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.93
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.93
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.91
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.91
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.91
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.9
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.89
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.89
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.89
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.89
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.88
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.88
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.88
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.87
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.87
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.87
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.87
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.87
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.87
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.87
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.87
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.86
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.86
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.85
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.84
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.83
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 99.83
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 99.83
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.83
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.83
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.83
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.83
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.83
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.82
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 99.82
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.82
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 99.82
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.8
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.8
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.79
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 99.77
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 99.75
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 99.73
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.73
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 99.72
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.71
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.68
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.67
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.63
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 99.63
3b02_A 195 Transcriptional regulator, CRP family; structural 99.56
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.42
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 94.83
3h8u_A125 Uncharacterized conserved protein with double-STR 94.39
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 94.21
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 93.83
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 93.79
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 93.31
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 92.98
3lwc_A119 Uncharacterized protein; structural genomics, unkn 92.89
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 92.5
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 91.92
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 91.89
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 91.76
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 91.39
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 91.29
3rns_A227 Cupin 2 conserved barrel domain protein; structura 91.22
1v70_A105 Probable antibiotics synthesis protein; structural 91.18
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 90.51
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 90.22
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 90.21
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 90.09
1sfn_A246 Conserved hypothetical protein; structural genomic 90.07
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 89.8
1vj2_A126 Novel manganese-containing cupin TM1459; structura 89.6
3bcw_A123 Uncharacterized protein; structural genomics, join 89.58
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 89.52
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 89.5
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 89.05
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 89.05
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 88.79
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 88.62
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 88.59
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 88.44
4axo_A151 EUTQ, ethanolamine utilization protein; structural 88.38
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 88.17
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 87.92
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 87.83
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 87.79
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 86.86
2q30_A110 Uncharacterized protein; double-stranded beta-heli 86.53
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 86.17
4i4a_A128 Similar to unknown protein; structural genomics, P 86.09
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 85.85
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 85.83
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 85.72
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 85.47
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 84.76
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 84.73
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 84.27
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 84.16
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 83.77
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 83.21
1sfn_A 246 Conserved hypothetical protein; structural genomic 82.88
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 82.7
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 82.57
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 82.41
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 82.3
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 82.27
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 82.27
3d82_A102 Cupin 2, conserved barrel domain protein; structur 82.01
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 81.77
1sef_A274 Conserved hypothetical protein; structural genomic 81.65
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 80.88
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 80.42
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
Probab=99.93  E-value=8e-25  Score=154.30  Aligned_cols=125  Identities=12%  Similarity=0.125  Sum_probs=118.2

Q ss_pred             hcCCCCCCCHHHHHHHHHHhhcChhhhcCCHHHHHHHhhhcceeEEccCCcEEEecCCCCCeEEEEEEeEEEEEEcCcee
Q psy7149          41 LEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELSDGRS  120 (167)
Q Consensus        41 l~k~p~~R~~~~~~~i~~~L~~~~~F~~L~~~~l~~l~~~~~~~~~~~~ge~I~~~Gd~~~~lyiI~~G~v~v~~~~~~~  120 (167)
                      +..|+..|+..+.+.+.++|+++|+|++|+++++..++..+..+.| ++|++|+++|++++.+|+|++|.|++..++..+
T Consensus         6 ~~~p~~~k~~~~~~~~~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~-~~g~~i~~~g~~~~~~y~i~~G~v~~~~~g~~~   84 (139)
T 3ocp_A            6 VTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEY-GKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKL   84 (139)
T ss_dssp             CCCCCCCCCHHHHHHHHHHHHHCTTTTTSCHHHHHHHHHHCEEEEE-CSSCEEECTTSCCCEEEEEEECCEEEEETTEEE
T ss_pred             ccCCCCCCCHHHHHHHHHHHhcCHhhhcCCHHHHHHHHHhcEEEec-CCCCEEEeCCCcCCEEEEEEeCEEEEEECCEEE
Confidence            3567789999999999999999999999999999999999999999 999999999999999999999999998888888


Q ss_pred             EEecCCCeeeecccccCCceeeEEEEecCceEEEEEeHHHHHHHhcC
Q psy7149         121 QMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ  167 (167)
Q Consensus       121 ~~l~~Gd~FGe~all~~~~r~~tv~~a~~~~~ll~i~~~~f~~ll~~  167 (167)
                      ..+++|++||+.+++.+.++++++ .|.++|.++.|++++|.+++.+
T Consensus        85 ~~~~~G~~fGe~~~l~~~~~~~~~-~a~~~~~v~~i~~~~~~~l~~~  130 (139)
T 3ocp_A           85 CTMGPGKVFGELAILYNCTRTATV-KTLVNVKLWAIDRQCFQTIMMR  130 (139)
T ss_dssp             EEECTTCEESCHHHHHCCCCSSEE-EESSCEEEEEEEHHHHHHHHTC
T ss_pred             EEeCCCCEeccHHHHCCCCcceEE-EECcceEEEEEcHHHHHHHHhh
Confidence            999999999999999999999999 7899999999999999999864
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 7e-16
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 4e-13
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-05
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 5e-05
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory domain of Epac2, domains 1 and 3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 67.8 bits (165), Expect = 7e-16
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 1/120 (0%)

Query: 49  TDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVIN 108
           T DD+E + D   H+KA ++++  V++ L GV++F    K GT++ N GEE  SW +++ 
Sbjct: 1   TVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILK 60

Query: 109 GCVEVELSDGRSQ-MLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ 167
           G V V +        L  GD FG L  +        +  R D+C F+ + + D+ RI   
Sbjct: 61  GSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRD 120
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.95
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.94
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.94
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.93
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.9
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.9
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.89
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.88
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.88
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.87
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.81
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.77
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.76
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.74
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.74
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.72
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.66
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.18
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 95.94
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 95.22
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 95.07
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 94.12
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 93.1
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 92.67
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 92.49
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 91.7
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 87.79
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 84.93
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 83.39
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 83.38
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 82.96
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 82.27
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 81.94
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 80.44
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory domain of Epac2, domains 1 and 3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=7.6e-27  Score=167.29  Aligned_cols=127  Identities=20%  Similarity=0.436  Sum_probs=117.7

Q ss_pred             HHHhcCCCCCCCHHHHHHHHHHhhcChhhhcCCHHHHHHHhhhcceeEEccCCcEEEecCCCCCeEEEEEEeEEEEEEc-
Q psy7149          38 RECLEKDPSERTDDDIEQLLDFTQHLKAFTNMTLAVRKALCGVMVFAVVEKAGTIVMNDGEELDSWSVVINGCVEVELS-  116 (167)
Q Consensus        38 r~~l~k~p~~R~~~~~~~i~~~L~~~~~F~~L~~~~l~~l~~~~~~~~~~~~ge~I~~~Gd~~~~lyiI~~G~v~v~~~-  116 (167)
                      ..+|.|+|.+|+..+++.+..+|+++|+|+.++++.+.+|+..+.++.+ ++|++|+++||+++.+|+|++|.|.|... 
T Consensus         4 i~~L~k~p~~Rt~~~~~~i~~~L~~~~~F~~l~~~~l~~l~~~~~~~~~-~~ge~I~~~gd~~~~~y~I~~G~v~v~~~~   82 (155)
T d1o7fa2           4 IACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENL-EKGITLFRQGDIGTNWYAVLAGSLDVKVSE   82 (155)
T ss_dssp             HHHHTSCSTTCCHHHHHHHHHHHTTCTTTTTCCHHHHHHHHHHCEEEEE-CTTCEEECTTSBCCEEEEEEESCEEEEECS
T ss_pred             HHHhcCChhhCCHHHHHHHHHHHhCCHhHhcCCHHHHHHHHHhcEEEEE-CCCCEEEeCCCcceeeEEEeccchheeeec
Confidence            4679999999999999999999999999999999999999999999999 99999999999999999999999998642 


Q ss_pred             ------CceeEEecCCCeeeecccccCCceeeEEEEecCceEEEEEeHHHHHHHhcC
Q psy7149         117 ------DGRSQMLQVGDSFGILPTMEKLYHEGVMRTRCDDCQFVCITQTDYYRIQHQ  167 (167)
Q Consensus       117 ------~~~~~~l~~Gd~FGe~all~~~~r~~tv~~a~~~~~ll~i~~~~f~~ll~~  167 (167)
                            ...+..+++|++||+ +++.+.+|++++ .|.++|+++.|++++|.+++.+
T Consensus        83 ~~~~~~~~~v~~l~~g~~fGe-~~l~~~~~~~tv-~a~~~~~l~~i~~~~f~~il~~  137 (155)
T d1o7fa2          83 TSSHQDAVTICTLGIGTAFGE-SILDNTPRHATI-VTRESSELLRIEQEDFKALWEK  137 (155)
T ss_dssp             SSCGGGCEEEEEECTTCEECG-GGGGTCBCSSEE-EESSSEEEEEEEHHHHHHHHHH
T ss_pred             ccccccccccccccccccchh-hhhcCCCceEEE-EECCCEEEEEEeHHHHHHHHHH
Confidence                  135778999999999 789999999999 7899999999999999999853
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure