Psyllid ID: psy7267


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------57
MISQQNNRTQSGVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGIDAEGSRGTRPEKG
ccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHHHccccccccccccccccEEEEEEccccccccEEccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccEEccHHHHHHHHHccccEEEEEEEEEEccccEEEcHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccHHHHHHHHHcccccHHHHcccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEcccEEEEEccccccccccEEEEEEEccccEEEEEEEEcccccccEEEEEEEcEEEEcccccccccccccEEEEEEcEEEEEEcHHHcccccccccccccEEEEEEEcccccccccEEEEcccccccccccccccc
ccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEccHccccccEEccHHHHHHHHHHHHHHHHEHccccccccccccEEccHHHHHHHHHHHcccccEEHHHHHHHHHHccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHHHHHHccccEcEcHHHccccccHHHcccEEEEEEEEccEEEEEEccccccccccEEcccEEEccccEEEccccEccccccccEEEEccccccEEHHEEHccccHcccEEEEEEccEEEEccccccccHHcccEEEEEEcEEEEEHcHHHHcccEEccccEccEEEEEccccccccccEEEEEccEccccccccccccc
misqqnnrtqsgvfplemggesepiltEFEIHCYIALFLVCGILSYAYrsfktknpfpdidflskgervfldvktgqelefpslddepsvnlsvivpayneqdrlkPMLDETIEFLNERRkkiptfkyEIIVVsdgstdktMQVVHQYTEKCGEDIVRGLKLLKnrgkggavtlgtkcargsiilfadadgatkfADLEKLEDKLKeltdgdyiedknnaagcngvIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGvrtirdtqcgfkLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHipmaevsvnwteiegskivpvFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYravyvpsqtspvyflkvtgscnmdvhktcakndcsarskLGVVAVKCVLlpvvrieyfpqmplrpgevhcssvvcrpmnavtfgrtvsesspgigtihkfgvsGKSLLFIQLCDIgrefnyyyyfwypqiiicpemsktgllnknlIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFIcgwdlnnhhsvpvcvsggidaegsrgtrpekg
misqqnnrtqsgvfpleMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELefpslddepsvnLSVIVPayneqdrlkpMLDETIEFLNerrkkiptfkyeiivvsdgstdktMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELtdgdyiedknnAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNdcsarsklgVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRtvsesspgigTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVsggidaegsrgtrpekg
MISQQNNRTQSGVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVrglkllknrgkggAVTLGTKCARGSIILFADADGATKFAdlekledklkeltdGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGvvavkcvllpvvRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGIDAEGSRGTRPEKG
***********************PILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFP******SVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGI*************
***********GVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLS*************************VNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAME*******VPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFP***********SSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGI*************
**********SGVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGIDA***********
**********SGVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDG*********AGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGID************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISQQNNRTQSGVFPLEMGGESEPILTEFEIHCYIALFLVCGILSYAYRSFKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQMGWDVLNIWLHYTLGLWKIKAMENKYRAVYVPSQTSPVYFLKVTGSCNMDVHKTCAKNDCSARSKLGVVAVKCVLLPVVRIEYFPQMPLRPGEVHCSSVVCRPMNAVTFGRTVSESSPGIGTIHKFGVSGKSLLFIQLCDIGREFNYYYYFWYPQIIICPEMSKTGLLNKNLIIFWNLKCVFFCGYKLLSQSIIGTSKISSQFFICGWDLNNHHSVPVCVSGGIDAEGSRGTRPEKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query569
FB|FBgn0261020326 wol "wollknaeuel" [Drosophila 0.550 0.960 0.492 9.3e-75
ZFIN|ZDB-GENE-030131-6586323 alg5 "asparagine-linked glycos 0.492 0.866 0.512 2.1e-70
UNIPROTKB|F1N540324 ALG5 "Uncharacterized protein" 0.537 0.944 0.447 8e-69
UNIPROTKB|Q9Y673324 ALG5 "Dolichyl-phosphate beta- 0.513 0.901 0.478 1.7e-68
UNIPROTKB|E2R422324 ALG5 "Uncharacterized protein" 0.518 0.910 0.470 9.2e-68
MGI|MGI:1913498324 Alg5 "asparagine-linked glycos 0.513 0.901 0.485 1.2e-67
UNIPROTKB|J9P6U5291 ALG5 "Uncharacterized protein" 0.485 0.948 0.493 1.5e-67
RGD|1308900324 Alg5 "ALG5, dolichyl-phosphate 0.485 0.851 0.496 5.1e-67
UNIPROTKB|E1BUU9287 ALG5 "Uncharacterized protein" 0.476 0.944 0.486 1.3e-66
UNIPROTKB|E1C2H8291 ALG5 "Uncharacterized protein" 0.486 0.951 0.489 1.3e-66
FB|FBgn0261020 wol "wollknaeuel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 9.3e-75, P = 9.3e-75
 Identities = 160/325 (49%), Positives = 207/325 (63%)

Query:    34 YIALFLVCGILSYAYRS-FKTKNPFPDIDFLSKGERVFLDVKTGQELEFPSLDDEPSVNL 92
             Y+   L    LS A    +KTK P+P+I    K E  FLD  T + + FPSL+D PS+ L
Sbjct:    11 YLLSTLAVAALSIAALVLYKTK-PYPNIK-RHKDEETFLDPHTIKTVTFPSLEDSPSLEL 68

Query:    93 SVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKC 152
             SVIVPAYNE+ RL  MLDE + FL ++    P F YE+IVVSDGS D T+ V   Y++K 
Sbjct:    69 SVIVPAYNEEQRLPSMLDECLAFLEQKSAGTPNFTYEVIVVSDGSQDATVSVALGYSKKH 128

Query:   153 GEDIVXXXXXXXXXXXXXAVTLGTKCARGSIILFADADGATKFAXXXXXXXXXXXXXXGD 212
             G + V             AV +G   ARG  +LFADADGATKF                +
Sbjct:   129 GAEKVRVLELIENRGKGGAVRMGMLSARGRNLLFADADGATKFPDYDKLEVALKQLAP-E 187

Query:   213 YIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGF 272
             + +D        G+ +GSRAHLE  A   RSFFR ILM GFHF+VW   VR+IRDTQCGF
Sbjct:   188 WRDD--------GIAIGSRAHLENDAIATRSFFRTILMHGFHFLVWLFAVRSIRDTQCGF 239

Query:   273 KLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSKIVPVFSWIQ 332
             KLFTR +A +LF+S+HV+RWAFDVELL++AE L +PM+EV+V WTEI+GSK+ P +SW+Q
Sbjct:   240 KLFTRTTARKLFTSLHVERWAFDVELLYLAENLKLPMSEVAVRWTEIDGSKLTPFWSWLQ 299

Query:   333 MGWDVLNIWLHYTLGLWKIKAMENK 357
             MG D+  IW+ Y +G W+I +++ K
Sbjct:   300 MGRDLFMIWVRYLVGAWRIASIQKK 324




GO:0004581 "dolichyl-phosphate beta-glucosyltransferase activity" evidence=ISS
GO:0007379 "segment specification" evidence=IMP
GO:0009880 "embryonic pattern specification" evidence=IMP
GO:0007030 "Golgi organization" evidence=IMP
GO:0040003 "chitin-based cuticle development" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0007029 "endoplasmic reticulum organization" evidence=IMP
GO:0006493 "protein O-linked glycosylation" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=IMP
GO:0019991 "septate junction assembly" evidence=IMP
GO:0007009 "plasma membrane organization" evidence=IMP
ZFIN|ZDB-GENE-030131-6586 alg5 "asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N540 ALG5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y673 ALG5 "Dolichyl-phosphate beta-glucosyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R422 ALG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913498 Alg5 "asparagine-linked glycosylation 5 (dolichyl-phosphate beta-glucosyltransferase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6U5 ALG5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308900 Alg5 "ALG5, dolichyl-phosphate beta-glucosyltransferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BUU9 ALG5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2H8 ALG5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1LOW CONFIDENCE prediction!
4th Layer2.4.1.80LOW CONFIDENCE prediction!
4th Layer2.4.1.117LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in 1e-107
PTZ00260333 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucos 1e-106
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l 4e-52
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 2e-20
cd06442224 cd06442, DPM1_like, DPM1_like represents putative 2e-19
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme 5e-19
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 9e-18
COG0463291 COG0463, WcaA, Glycosyltransferases involved in ce 7e-17
cd06423180 cd06423, CESA_like, CESA_like is the cellulose syn 5e-15
cd06439251 cd06439, CESA_like_1, CESA_like_1 is a member of t 1e-14
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved i 7e-14
PRK11204420 PRK11204, PRK11204, N-glycosyltransferase; Provisi 3e-13
TIGR03937407 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glu 2e-12
TIGR04283220 TIGR04283, glyco_like_mftF, transferase 2, rSAM/se 1e-10
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransfe 7e-10
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 1e-09
PRK10714325 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy 7e-09
cd02522221 cd02522, GT_2_like_a, GT_2_like_a represents a gly 8e-09
PLN02726243 PLN02726, PLN02726, dolichyl-phosphate beta-D-mann 1e-08
PRK10073328 PRK10073, PRK10073, putative glycosyl transferase; 5e-08
TIGR03965467 TIGR03965, mycofact_glyco, mycofactocin system gly 1e-06
PRK14583444 PRK14583, hmsR, N-glycosyltransferase; Provisional 9e-06
PRK13915306 PRK13915, PRK13915, putative glucosyl-3-phosphogly 3e-05
pfam13641229 pfam13641, Glyco_tranf_2_3, Glycosyltransferase li 2e-04
pfam10111278 pfam10111, Glyco_tranf_2_2, Glycosyltransferase li 4e-04
cd02511229 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS 9e-04
TIGR04182293 TIGR04182, glyco_TIGR04182, glycosyltransferase, T 0.003
cd04196214 cd04196, GT_2_like_d, Subfamily of Glycosyltransfe 0.003
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
 Score =  321 bits (824), Expect = e-107
 Identities = 119/230 (51%), Positives = 147/230 (63%), Gaps = 19/230 (8%)

Query: 94  VIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCG 153
           V++PAYNE+ RL P L+E +E+L ER    P+F YEIIVV DGS D T +V  +   K  
Sbjct: 1   VVIPAYNEEKRLPPTLEEAVEYLEER----PSFSYEIIVVDDGSKDGTAEVARKLARKNP 56

Query: 154 EDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDY 213
             I R L L KNRGKGGAV  G   ARG  ILFADAD AT F +LEKLE+ LK      Y
Sbjct: 57  ALI-RVLTLPKNRGKGGAVRAGMLAARGDYILFADADLATPFEELEKLEEALKT---SGY 112

Query: 214 IEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQCGFK 273
                       + +GSRAHL + A V+RS+ RN+L +GF+F+V       I+DTQCGFK
Sbjct: 113 -----------DIAIGSRAHLASAAVVKRSWLRNLLGRGFNFLVRLLLGLGIKDTQCGFK 161

Query: 274 LFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGSK 323
           LFTR +A +LF  +H++RWAFDVELL +A  L  P+ EV V W EI GSK
Sbjct: 162 LFTRDAARRLFPRLHLERWAFDVELLVLARRLGYPIEEVPVRWVEIPGSK 211


UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. Length = 211

>gnl|CDD|240336 PTZ00260, PTZ00260, dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|236882 PRK11204, PRK11204, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|188452 TIGR03937, PgaC_IcaA, poly-beta-1,6 N-acetyl-D-glucosamine synthase Back     alignment and domain information
>gnl|CDD|234532 TIGR04283, glyco_like_mftF, transferase 2, rSAM/selenodomain-associated Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182669 PRK10714, PRK10714, undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>gnl|CDD|133013 cd02522, GT_2_like_a, GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>gnl|CDD|215385 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|184755 PRK14583, hmsR, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237556 PRK13915, PRK13915, putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>gnl|CDD|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|220577 pfam10111, Glyco_tranf_2_2, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|133005 cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>gnl|CDD|200433 TIGR04182, glyco_TIGR04182, glycosyltransferase, TIGR04182 family Back     alignment and domain information
>gnl|CDD|133039 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 569
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 100.0
KOG2977|consensus323 100.0
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 100.0
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.97
KOG2978|consensus238 99.97
PRK11204420 N-glycosyltransferase; Provisional 99.97
PRK14583444 hmsR N-glycosyltransferase; Provisional 99.96
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.96
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.96
TIGR03111439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.96
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.95
PRK10714325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 99.95
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.95
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl tra 99.94
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.94
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.93
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.93
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.93
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.93
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. T 99.93
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.93
COG1215439 Glycosyltransferases, probably involved in cell wa 99.93
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.92
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.92
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.91
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.91
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.91
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.91
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.91
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 99.9
PRK10073328 putative glycosyl transferase; Provisional 99.9
PRK14716504 bacteriophage N4 adsorption protein B; Provisional 99.9
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.9
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.89
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.88
PRK10063248 putative glycosyl transferase; Provisional 99.88
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.88
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.88
cd06438183 EpsO_like EpsO protein participates in the methano 99.87
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.87
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.87
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.86
PRK10018279 putative glycosyl transferase; Provisional 99.86
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.86
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.85
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.85
PRK05454691 glucosyltransferase MdoH; Provisional 99.85
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.84
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.84
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.83
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.82
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.81
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.81
COG1216305 Predicted glycosyltransferases [General function p 99.8
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.77
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 99.7
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 99.68
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.59
KOG3736|consensus578 99.24
KOG3737|consensus603 99.24
KOG3738|consensus559 99.22
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 99.11
KOG2547|consensus431 99.05
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 98.9
PLN02893734 Cellulose synthase-like protein 98.89
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 98.74
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 98.68
PF03142527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 98.65
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 98.43
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 97.97
PLN02190756 cellulose synthase-like protein 97.75
PLN02195 977 cellulose synthase A 97.74
PLN02189 1040 cellulose synthase 97.71
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 97.63
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 97.57
KOG2571|consensus862 97.28
COG4092346 Predicted glycosyltransferase involved in capsule 97.27
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 97.24
PF03071434 GNT-I: GNT-I family; InterPro: IPR004139 The biosy 97.17
PLN02248 1135 cellulose synthase-like protein 97.13
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 97.11
PLN02400 1085 cellulose synthase 96.97
PLN02915 1044 cellulose synthase A [UDP-forming], catalytic subu 96.49
TIGR02460381 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase 96.46
PF06306347 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( 96.41
KOG3916|consensus372 96.35
PRK14503393 mannosyl-3-phosphoglycerate synthase; Provisional 96.26
PF09488381 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas 96.23
PF11735241 CAP59_mtransfer: Cryptococcal mannosyltransferase 96.1
PLN02436 1094 cellulose synthase A 95.87
PF03552 720 Cellulose_synt: Cellulose synthase; InterPro: IPR0 95.05
KOG3588|consensus494 94.67
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 94.62
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 93.98
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 93.6
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 93.6
PF13733136 Glyco_transf_7N: N-terminal region of glycosyl tra 93.54
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 93.44
PF11397343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 93.27
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 93.2
PLN02917293 CMP-KDO synthetase 92.92
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 92.48
cd04181217 NTP_transferase NTP_transferases catalyze the tran 92.38
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 92.13
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 90.48
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 90.33
cd02503181 MobA MobA catalyzes the formation of molybdopterin 90.25
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 90.11
PLN02458346 transferase, transferring glycosyl groups 89.98
PF01697285 Glyco_transf_92: Glycosyltransferase family 92; In 89.86
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) 89.0
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 88.73
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 87.93
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 87.67
PF01762195 Galactosyl_T: Galactosyltransferase; InterPro: IPR 87.58
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 87.42
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 86.79
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 86.2
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 86.16
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 86.11
PF04666297 Glyco_transf_54: N-Acetylglucosaminyltransferase-I 86.0
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 85.81
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 85.41
COG2068199 Uncharacterized MobA-related protein [General func 85.27
KOG3917|consensus310 84.99
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 84.77
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 84.43
PF03214348 RGP: Reversibly glycosylated polypeptide; InterPro 84.25
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 84.04
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 83.71
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 83.31
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 83.1
PF09258247 Glyco_transf_64: Glycosyl transferase family 64 do 82.5
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 82.25
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 82.21
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 82.11
PF05212294 DUF707: Protein of unknown function (DUF707); Inte 82.08
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 82.02
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 81.74
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 80.98
KOG1476|consensus330 80.49
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 80.34
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 80.18
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 80.08
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.3e-36  Score=316.42  Aligned_cols=257  Identities=49%  Similarity=0.856  Sum_probs=224.3

Q ss_pred             CCCCccEEEEEeecCCCCChHHHHHHHHHHHHhhhccCCCCceEEEEEeCCCCccHHHHHHHHhHhh--CCCeEEEEEcC
Q psy7267          86 DEPSVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKC--GEDIVRGLKLL  163 (569)
Q Consensus        86 ~~~~p~VSVIIP~yNE~~~I~~~L~sll~~l~~~~~~yp~~~~EIIVVDDgStD~T~eil~~~~~~~--~~~~V~vi~~~  163 (569)
                      ....|.+|||||+|||++.|+++|+++.+++.+..-++|..++||+||||||+|+|.++++++.+++  ++.+++++.++
T Consensus        66 ~~~~~~isVVIP~yNe~~~i~~~L~~l~~~~~~~~~~~~~~~~EIIVVDDgStD~T~~i~~~~~~~~~~~~~~i~vi~~~  145 (333)
T PTZ00260         66 KDSDVDLSIVIPAYNEEDRLPKMLKETIKYLESRSRKDPKFKYEIIIVNDGSKDKTLKVAKDFWRQNINPNIDIRLLSLL  145 (333)
T ss_pred             CCCCeEEEEEEeeCCCHHHHHHHHHHHHHHHHhhhccCCCCCEEEEEEeCCCCCchHHHHHHHHHhcCCCCCcEEEEEcC
Confidence            4567889999999999999999999999887642223455579999999999999999999987764  33569999999


Q ss_pred             CCCChHHHHHHHHHhccCcEEEEEcCCCCCChhhHHHHHHHHHhccCCCccccccCCCCCceEEEeeeeecccc-cchhh
Q psy7267         164 KNRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEAL-ANVQR  242 (569)
Q Consensus       164 ~n~Gka~AlN~Gl~~A~gd~Vv~lDaD~~~~pd~L~~lv~~~~~~~~~~~~g~~~~~~~g~dvV~G~r~~~~~~-~~~~~  242 (569)
                      +|.|++.|+|.|+++|+||+|+++|+|+.++|++++++++.+.+..           .++.|+|+|+|....++ ....+
T Consensus       146 ~N~G~~~A~~~Gi~~a~gd~I~~~DaD~~~~~~~l~~l~~~l~~~~-----------~~~~dvV~GsR~~~~~~~~~~~~  214 (333)
T PTZ00260        146 RNKGKGGAVRIGMLASRGKYILMVDADGATDIDDFDKLEDIMLKIE-----------QNGLGIVFGSRNHLVDSDVVAKR  214 (333)
T ss_pred             CCCChHHHHHHHHHHccCCEEEEEeCCCCCCHHHHHHHHHHHHHhh-----------ccCCceEEeeccccccCcccccC
Confidence            9999999999999999999999999999999999999999987521           14679999999754332 34566


Q ss_pred             HHHHHHhhhhhhhHhhhcccccccccccceeeEeHHHHHHHhccccCCchhhchHHHHHHHHcCCCEEEEEEEEEEecCC
Q psy7267         243 SFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRWAFDVELLFIAEVLHIPMAEVSVNWTEIEGS  322 (569)
Q Consensus       243 ~~~r~~~~~~~~~l~~~~~~~~i~d~~~gf~lfrR~al~~I~~~~~~e~~~~D~EL~~Ra~~~G~rI~~vPv~~~~~~GS  322 (569)
                      ++++++.++.++.+.+...+..+.|.+||+++|+|++++++++....++|.+|+|+.+++.+.|+++.++|+.|+++.+|
T Consensus       215 ~~~r~~~~~~~~~l~~~~~~~~i~D~~~Gfk~~~r~~~~~i~~~~~~~~~~fd~Ell~~a~~~g~~I~EvPv~~~~~~~S  294 (333)
T PTZ00260        215 KWYRNILMYGFHFIVNTICGTNLKDTQCGFKLFTRETARIIFPSLHLERWAFDIEIVMIAQKLNLPIAEVPVNWTEVEGS  294 (333)
T ss_pred             cHHHHHHHHHHHHHHHHHcCCCcccCCCCeEEEeHHHHHHHhhhccccCccchHHHHHHHHHcCCCEEEEceeeEECCCC
Confidence            78888889988888889999999999999999999999999766667889999999999999999999999999998889


Q ss_pred             ccchhHHHHHHHHHHHHHHHHhcchhhHHHH
Q psy7267         323 KIVPVFSWIQMGWDVLNIWLHYTLGLWKIKA  353 (569)
Q Consensus       323 ~~~~~~~~~~~~~~~l~~r~ry~~g~w~i~~  353 (569)
                      +...++..+++.+.+++.+..|..|.|.+..
T Consensus       295 k~~~~~~~~~~~~~l~~~~~~y~~~~~~~~~  325 (333)
T PTZ00260        295 KLNVISASIQMARDILLVRSFYLLGIWKVKD  325 (333)
T ss_pred             eechHHHHHHHHHHHHHHHHHHhcCeeeccC
Confidence            9988999999999999999999999988754



>KOG2977|consensus Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>KOG2978|consensus Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG2571|consensus Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>PLN02400 cellulose synthase Back     alignment and domain information
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit Back     alignment and domain information
>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase Back     alignment and domain information
>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] Back     alignment and domain information
>KOG3916|consensus Back     alignment and domain information
>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis Back     alignment and domain information
>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>PF03552 Cellulose_synt: Cellulose synthase; InterPro: IPR005150 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02458 transferase, transferring glycosyl groups Back     alignment and domain information
>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function Back     alignment and domain information
>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF01762 Galactosyl_T: Galactosyltransferase; InterPro: IPR002659 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>KOG3917|consensus Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants [] Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PF05212 DUF707: Protein of unknown function (DUF707); InterPro: IPR007877 This family consists of uncharacterised proteins from Arabidopsis thaliana Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1476|consensus Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query569
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 1e-24
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 3e-20
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 1e-12
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 3e-10
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 9e-12
2bo4_A397 Mannosylglycerate synthase; catalysis, glycosyltra 4e-11
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 5e-11
3bcv_A240 Putative glycosyltransferase protein; protein stru 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 6e-08
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-07
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 5e-07
2zu9_A394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 5e-04
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Length = 329 Back     alignment and structure
 Score =  103 bits (259), Expect = 1e-24
 Identities = 41/227 (18%), Positives = 74/227 (32%), Gaps = 22/227 (9%)

Query: 92  LSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEK 151
           +SV++PA +E+D +  ++D            +     E+IV+  GSTD T         +
Sbjct: 50  ISVVLPALDEEDTIGSVIDSI-------SPLVDGLVDELIVLDSGSTDDTEIRAVAAGAR 102

Query: 152 CGEDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFA-DLEKLEDKLKELTD 210
                    ++    GKG A+      +RG I++F D+D        +  L   L  LT 
Sbjct: 103 VVSREQALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFVPWLVGPL--LTG 160

Query: 211 GDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGVRTIRDTQC 270
                 K+       V                      L            +  I     
Sbjct: 161 DGVHLVKSFYRRPLNVGDAGGGAGATGGGRVTELVARPL-----LAALRPELGCILQPLG 215

Query: 271 GFKLFTRKSALQL-FSSIHVQRWAFDVELLF--IAEVLHIPMAEVSV 314
           G    TR+    + F+      +  ++ LL      +    +A+V++
Sbjct: 216 GEYAATRELLTSVPFAP----GYGVEIGLLVDTFDRLGLDAIAQVNL 258


>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Length = 387 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Length = 397 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Length = 240 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Length = 394 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.95
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 99.94
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.94
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.93
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.92
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.92
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.91
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.91
2bo4_A397 Mannosylglycerate synthase; catalysis, glycosyltra 99.89
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.88
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.86
4fix_A657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.86
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.85
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.7
2zu9_A394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 99.69
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.6
2wvl_A391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 99.58
1fo8_A343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 98.78
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 97.93
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 97.57
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 96.12
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 95.6
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 94.36
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 94.06
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 93.65
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 93.65
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 92.82
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 91.66
1v84_A253 Galactosylgalactosylxylosylprotein 3-beta- glucuro 91.56
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 90.91
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 90.87
3cu0_A281 Galactosylgalactosylxylosylprotein 3-beta- glucuro 90.48
2d0j_A246 Galactosylgalactosylxylosylprotein 3-beta- glucuro 89.9
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 89.84
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 89.1
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 88.68
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 88.43
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 87.48
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 86.62
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 86.31
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 85.58
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 85.24
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 84.1
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 84.07
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 83.31
1omz_A293 Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro 82.13
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 81.6
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 81.03
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 80.86
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 80.84
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 80.42
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
Probab=99.95  E-value=8.7e-27  Score=227.86  Aligned_cols=199  Identities=15%  Similarity=0.153  Sum_probs=141.9

Q ss_pred             CccEEEEEeecCCCCChHHHHHHHHHHHHhhhccCCCCceEEEEEeCCCCccHHHHHHHHhHhhCCCeEEEEEcCCCCCh
Q psy7267          89 SVNLSVIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCGEDIVRGLKLLKNRGK  168 (569)
Q Consensus        89 ~p~VSVIIP~yNE~~~I~~~L~sll~~l~~~~~~yp~~~~EIIVVDDgStD~T~eil~~~~~~~~~~~V~vi~~~~n~Gk  168 (569)
                      .|+||||||+||+++.|.++|+|+++|      .|+  ++|||||||||+|+|.++++++.+++  +++++++ .+|.|+
T Consensus         4 ~p~vsViIp~yn~~~~l~~~l~Sl~~q------~~~--~~eiIvvDd~S~d~t~~~~~~~~~~~--~~i~~i~-~~n~G~   72 (240)
T 3bcv_A            4 IPKVSVIVPIYNVEKYLDQCVQALLAQ------TLS--DIEIILIDDESPDNCPKICDDYAAQY--PNIKVIH-KKNAGL   72 (240)
T ss_dssp             CCSEEEEEEESSCTTTHHHHHHHHHTC------SSS--SEEEEEEECCCSSSHHHHHHHHHHHC--SSEEEEE-CCCCCH
T ss_pred             CCcEEEEEecCCCHHHHHHHHHHHHhC------cCC--CeEEEEEECCCCcCHHHHHHHHHhhC--CCEEEEE-CCCCCh
Confidence            578999999999999999999999887      555  78999999999999999999998887  7899997 679999


Q ss_pred             HHHHHHHHHhccCcEEEEEcCCCCCChhhHHHHHHHHHhccCCCccccccCCCCCceEEEeeeeecccccchhhHHHHH-
Q psy7267         169 GGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRN-  247 (569)
Q Consensus       169 a~AlN~Gl~~A~gd~Vv~lDaD~~~~pd~L~~lv~~~~~~~~~~~~g~~~~~~~g~dvV~G~r~~~~~~~~~~~~~~r~-  247 (569)
                      +.|+|.|+++|+||||+++|+|+.++|++|+++++.+++.              +.+++++.......++......... 
T Consensus        73 ~~a~N~g~~~a~g~~i~~lD~Dd~~~~~~l~~l~~~~~~~--------------~~~~v~~~~~~~~~~~~~~~~~~~~~  138 (240)
T 3bcv_A           73 GMACNSGLDVATGEYVAFCDSDDYVDSDMYMTMYNVAQKY--------------TCDAVFTGLKRITMAGIPTGTVTHQK  138 (240)
T ss_dssp             HHHHHHHHHHCCSSEEEECCTTCCCCTTHHHHHHHHHHHH--------------TCSEEEC-------------------
T ss_pred             HHHHHHHHHHcCCCEEEEECCCCcCCHHHHHHHHHHHHhc--------------CCCEEEEeeEEEccCCcccccccccc
Confidence            9999999999999999999999999999999999999873              3456655443222221100000000 


Q ss_pred             ----Hhh--hhhhhHhhhcccc------cccccccceeeEeHHHHHHHhcc-ccCCc---hhhchHHHHHHHHcCCCEEE
Q psy7267         248 ----ILM--KGFHFIVWFTGVR------TIRDTQCGFKLFTRKSALQLFSS-IHVQR---WAFDVELLFIAEVLHIPMAE  311 (569)
Q Consensus       248 ----~~~--~~~~~l~~~~~~~------~i~d~~~gf~lfrR~al~~I~~~-~~~e~---~~~D~EL~~Ra~~~G~rI~~  311 (569)
                          ...  .....+.......      ......++..++||++++++  + .+++.   ..+|.+++.|+..+|+++.+
T Consensus       139 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rr~~~~~~--g~~f~~~~~~~~eD~~~~~r~~~~g~~i~~  216 (240)
T 3bcv_A          139 EFKLYKNKNEIHTLLKDLIASDPYAREERAIQVSAKVVLYRRNLIEKK--HLRFVSERILPSEDLIFNVDVLANSNIVCV  216 (240)
T ss_dssp             -CEEECSHHHHHHHHGGGTSSCHHHHHHHHHHHTCSCEEEEHHHHHHT--TCCCCCTTTCTTHHHHHHHHHHTTCSCEEE
T ss_pred             ccccccCHHHHHHHHHHHhhcchhhccccccccchhheeeeHHHHHHc--CCccCCCCCccCCCHHHHHHHHHhCCEEEE
Confidence                000  0000000111100      00112245679999999997  4 34333   45799999999999999999


Q ss_pred             EEE
Q psy7267         312 VSV  314 (569)
Q Consensus       312 vPv  314 (569)
                      +|.
T Consensus       217 ~~~  219 (240)
T 3bcv_A          217 LPQ  219 (240)
T ss_dssp             CC-
T ss_pred             ECC
Confidence            874



>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* Back     alignment and structure
>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 569
d2bo4a1381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 3e-27
d1omza_265 c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf 1e-08
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 9e-07
d1qg8a_255 c.68.1.1 (A:) Spore coat polysaccharide biosynthes 1e-05
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: MGS-like
domain: Mannosylglycerate synthase, MGS
species: Rhodothermus marinus [TaxId: 29549]
 Score =  111 bits (278), Expect = 3e-27
 Identities = 36/244 (14%), Positives = 66/244 (27%), Gaps = 41/244 (16%)

Query: 94  VIVPAYNEQDRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTMQVVHQYTEKCG 153
           V+ P  +E         E +          P   +E++ +          V     E   
Sbjct: 3   VVFPFKHEHP-------EVLLHNVRVAAAHPRV-HEVLCIGYERDQTYEAVERAAPEISR 54

Query: 154 ----------EDIVRGLKLLKNRGKGGAVTLGTKCARGSIILFADADGATKFAD-LEKLE 202
                     ++ +  L+  K  G   A+    +  +   I F DAD  +   D + K E
Sbjct: 55  ATGTPVSVRLQERLGTLRPGKGDGMNTALRYFLEETQWERIHFYDADITSFGPDWITKAE 114

Query: 203 DKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANVQRSFFRNILMKGFHFIVWFTGV 262
           +          +                RA  +A   +     R         +   T +
Sbjct: 115 EAADF--GYGLV-----------RHYFPRASTDA--MITWMITRTGF----ALLWPHTEL 155

Query: 263 RTIRDTQCGFKLFTRKSALQLFSSIHVQ---RWAFDVELLFIAEVLHIPMAEVSVNWTEI 319
             I     G  L  R+ A  L+    V+    W  D    F+     + + E  +   + 
Sbjct: 156 SWIEQPLGGELLMRREVAAMLYEDERVRRRSDWGIDTLYTFVTVQQGVSIYECYIPEGKA 215

Query: 320 EGSK 323
               
Sbjct: 216 HRLY 219


>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Length = 255 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query569
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.95
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.9
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 99.8
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.76
d1fo8a_343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 97.62
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 97.58
d1v82a_252 Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human ( 88.36
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 87.91
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 83.64
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 81.22
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95  E-value=2.4e-27  Score=241.86  Aligned_cols=203  Identities=17%  Similarity=0.078  Sum_probs=146.5

Q ss_pred             CCCccEEEEEeecCCC-CChHHHHHHHHHHHHhhhccCCCCceEEEEEeCCCCccHH-HHHHHHhHhhCCCeEEEEEcCC
Q psy7267          87 EPSVNLSVIVPAYNEQ-DRLKPMLDETIEFLNERRKKIPTFKYEIIVVSDGSTDKTM-QVVHQYTEKCGEDIVRGLKLLK  164 (569)
Q Consensus        87 ~~~p~VSVIIP~yNE~-~~I~~~L~sll~~l~~~~~~yp~~~~EIIVVDDgStD~T~-eil~~~~~~~~~~~V~vi~~~~  164 (569)
                      ..+|.||||||+|||+ ..|.+||+|+++|      .||...+|||||||||+|+|. +.++++.++.+ .+++++++++
T Consensus        19 ~~~P~vSIIIp~yNe~~~~l~~~l~Si~~q------t~~~~~~EIIvVDdgS~d~~~~~~l~~~~~~~~-~~i~vi~~~~   91 (328)
T d1xhba2          19 DNLPTTSVVIVFHNEAWSTLLRTVHSVINR------SPRHMIEEIVLVDDASERDFLKRPLESYVKKLK-VPVHVIRMEQ   91 (328)
T ss_dssp             SCCCCEEEEEEESSCCHHHHHHHHHHHHHS------SCGGGEEEEEEEECSCCCGGGTHHHHHHHHSSS-SCEEEEECSS
T ss_pred             CCCCCEEEEEeccCCcHHHHHHHHHHHHhc------CCCCCCeEEEEEECCCChhhHHHHHHHHHHhcC-CCeEEEEecc
Confidence            4578899999999997 5689999999987      556556899999999999975 56777766553 6799999999


Q ss_pred             CCChHHHHHHHHHhccCcEEEEEcCCCCCChhhHHHHHHHHHhccCCCccccccCCCCCceEEEeeeeecccccch----
Q psy7267         165 NRGKGGAVTLGTKCARGSIILFADADGATKFADLEKLEDKLKELTDGDYIEDKNNAAGCNGVIVGSRAHLEALANV----  240 (569)
Q Consensus       165 n~Gka~AlN~Gl~~A~gd~Vv~lDaD~~~~pd~L~~lv~~~~~~~~~~~~g~~~~~~~g~dvV~G~r~~~~~~~~~----  240 (569)
                      |.|.+.|+|.|+++|+||||+++|+|+.++|++|+++++.+++.+              ..++++...........    
T Consensus        92 n~G~~~a~N~Gi~~a~gd~i~flD~D~~~~p~~l~~l~~~~~~~~--------------~~~v~~~~~~i~~~~~~~~~~  157 (328)
T d1xhba2          92 RSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDR--------------RTVVCPIIDVISDDTFEYMAG  157 (328)
T ss_dssp             CCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCT--------------TEEEEEEEEEECSSSCCEECC
T ss_pred             cccchHHHHHHHHhhhcceeeecCcccccChhHHHHHHHHHhcCC--------------CeEEecceeeeccCceeeccC
Confidence            999999999999999999999999999999999999999998853              23443332211111000    


Q ss_pred             --------hh-------HHHHHHhhhhhhhHhhhcccccccccccceeeEeHHHHHHHhccccCCch----hhchHHHHH
Q psy7267         241 --------QR-------SFFRNILMKGFHFIVWFTGVRTIRDTQCGFKLFTRKSALQLFSSIHVQRW----AFDVELLFI  301 (569)
Q Consensus       241 --------~~-------~~~r~~~~~~~~~l~~~~~~~~i~d~~~gf~lfrR~al~~I~~~~~~e~~----~~D~EL~~R  301 (569)
                              ..       ........   ................+++.+++|++++++  +.+++.+    .+|+||++|
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~g~~~~irr~~f~~v--GgfDe~~~~~g~ED~Dl~~R  232 (328)
T d1xhba2         158 SDMTYGGFNWKLNFRWYPVPQREMD---RRKGDRTLPVRTPTMAGGLFSIDRDYFQEI--GTYDAGMDIWGGENLEISFR  232 (328)
T ss_dssp             CTTEEEEECTTCCEEEEECCHHHHH---HTTTCTTSCEECSBCCSSSEEEEHHHHHHT--TSCCTTSCTTCCCCSHHHHH
T ss_pred             Cccccccccccccccccccchhhhh---ccccccccccccceecceeeeeeHHHHHHh--CCCCCCCcCcCchHHHHHHH
Confidence                    00       00000000   000000011112234456778999999999  6666544    379999999


Q ss_pred             HHHcCCCEEEEEEE
Q psy7267         302 AEVLHIPMAEVSVN  315 (569)
Q Consensus       302 a~~~G~rI~~vPv~  315 (569)
                      +.++|+++.++|..
T Consensus       233 ~~~~G~~i~~~p~~  246 (328)
T d1xhba2         233 IWQCGGTLEIVTCS  246 (328)
T ss_dssp             HHHTTCEEEEEEEE
T ss_pred             HHHhCCeEEEeCCe
Confidence            99999999999954



>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure