Psyllid ID: psy7288
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
No hits with e-value below 0.001 by BLAST
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 518 | ||||||
| UNIPROTKB|E1BYL9 | 332 | E1BYL9 "Uncharacterized protei | 0.320 | 0.5 | 0.602 | 1.1e-56 | |
| UNIPROTKB|F1N9J1 | 332 | GYG1 "Uncharacterized protein" | 0.312 | 0.487 | 0.604 | 9.9e-56 | |
| UNIPROTKB|F1PVC0 | 333 | GYG1 "Uncharacterized protein" | 0.320 | 0.498 | 0.578 | 3.3e-55 | |
| UNIPROTKB|F1PVB5 | 331 | GYG1 "Uncharacterized protein" | 0.312 | 0.489 | 0.586 | 8.8e-55 | |
| ZFIN|ZDB-GENE-080723-74 | 409 | gyg2 "glycogenin 2" [Danio rer | 0.312 | 0.396 | 0.537 | 1.8e-54 | |
| UNIPROTKB|P46976 | 350 | GYG1 "Glycogenin-1" [Homo sapi | 0.308 | 0.457 | 0.593 | 3.7e-54 | |
| UNIPROTKB|F6QLM5 | 331 | GYG1 "Uncharacterized protein" | 0.312 | 0.489 | 0.592 | 6.1e-54 | |
| WB|WBGene00012020 | 300 | gyg-2 [Caenorhabditis elegans | 0.335 | 0.58 | 0.528 | 6.1e-54 | |
| UNIPROTKB|F1SKC4 | 331 | GYG1 "Uncharacterized protein" | 0.312 | 0.489 | 0.586 | 9.9e-54 | |
| ZFIN|ZDB-GENE-040625-30 | 321 | gyg1b "glycogenin 1b" [Danio r | 0.301 | 0.485 | 0.596 | 1.3e-53 |
| UNIPROTKB|E1BYL9 E1BYL9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 518 (187.4 bits), Expect = 1.1e-56, Sum P(2) = 1.1e-56
Identities = 100/166 (60%), Positives = 121/166 (72%)
Query: 4 VTGTAWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKE 63
VT A+VTLAT+D Y GALV+ SL+ T LA+LITP V+ M++ L VF+ V E
Sbjct: 3 VTDQAFVTLATDDVYCQGALVLGQSLRNHTTSRKLAVLITPEVSSGMRSVLRSVFDEVTE 62
Query: 64 VDVFDSRDETNLRLLSRPDLGITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDREEL 123
VD DS D L LL RP+LG+TFTK+H W LT YSKCVF+DAD L++ N DELFDREE
Sbjct: 63 VDALDSADSVRLALLQRPELGVTFTKLHCWTLTHYSKCVFMDADTLVLCNVDELFDREEF 122
Query: 124 SAAPDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFDDATRQL 169
SAAPD+GWPDCFNSGVFVF+PS TYN L++FA +GSFD + L
Sbjct: 123 SAAPDSGWPDCFNSGVFVFRPSLKTYNLLLQFAAEHGSFDGGDQGL 168
|
|
| UNIPROTKB|F1N9J1 GYG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PVC0 GYG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PVB5 GYG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080723-74 gyg2 "glycogenin 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P46976 GYG1 "Glycogenin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6QLM5 GYG1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00012020 gyg-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKC4 GYG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-30 gyg1b "glycogenin 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 518 | |||
| cd02537 | 240 | cd02537, GT8_Glycogenin, Glycogenin belongs the GT | 3e-73 | |
| pfam01501 | 248 | pfam01501, Glyco_transf_8, Glycosyl transferase fa | 5e-39 | |
| cd00505 | 246 | cd00505, Glyco_transf_8, Members of glycosyltransf | 1e-20 | |
| cd06914 | 278 | cd06914, GT8_GNT1, GNT1 is a fungal enzyme that be | 9e-15 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-13 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 9e-13 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 8e-12 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-11 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-11 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 3e-11 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 5e-11 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 6e-11 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 9e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-10 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-10 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-10 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-10 | |
| cd04194 | 248 | cd04194, GT8_A4GalT_like, A4GalT_like proteins cat | 4e-10 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-10 | |
| COG5597 | 368 | COG5597, COG5597, Alpha-N-acetylglucosamine transf | 8e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-09 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-09 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 3e-09 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 3e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-09 | |
| PLN00176 | 333 | PLN00176, PLN00176, galactinol synthase | 4e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 5e-09 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-09 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-09 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-08 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 1e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-08 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-08 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-08 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-08 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 3e-08 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 5e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 7e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 9e-08 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 9e-08 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-07 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-07 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-07 | |
| PRK14949 | 944 | PRK14949, PRK14949, DNA polymerase III subunits ga | 3e-07 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 4e-07 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-07 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 6e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-07 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 8e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-06 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 1e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-06 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 2e-06 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-06 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 2e-06 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 2e-06 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 2e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-06 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 4e-06 | |
| PRK08691 | 709 | PRK08691, PRK08691, DNA polymerase III subunits ga | 4e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 5e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 6e-06 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 6e-06 | |
| PRK11907 | 814 | PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl | 7e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-05 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 1e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 1e-05 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 1e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 1e-05 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 1e-05 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 1e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-05 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 2e-05 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 2e-05 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 2e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-05 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 3e-05 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 3e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 3e-05 | |
| PRK12799 | 421 | PRK12799, motB, flagellar motor protein MotB; Revi | 3e-05 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 4e-05 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 4e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-05 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 5e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 5e-05 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 5e-05 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 5e-05 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 6e-05 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 6e-05 | |
| PRK14949 | 944 | PRK14949, PRK14949, DNA polymerase III subunits ga | 7e-05 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 7e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 8e-05 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 8e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 9e-05 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 9e-05 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 9e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 1e-04 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 1e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 1e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 2e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-04 | |
| PRK11907 | 814 | PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl | 2e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 2e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 2e-04 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 2e-04 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 2e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-04 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 3e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 3e-04 | |
| PRK11907 | 814 | PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl | 3e-04 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 3e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 3e-04 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 3e-04 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 3e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 3e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 4e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-04 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 4e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 4e-04 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 4e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-04 | |
| COG3266 | 292 | COG3266, DamX, Uncharacterized protein conserved i | 4e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-04 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 5e-04 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 5e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 6e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 6e-04 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 6e-04 | |
| PRK12799 | 421 | PRK12799, motB, flagellar motor protein MotB; Revi | 7e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| pfam05104 | 151 | pfam05104, Rib_recp_KP_reg, Ribosome receptor lysi | 7e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 8e-04 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 8e-04 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 8e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-04 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 9e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 9e-04 | |
| PHA03369 | 663 | PHA03369, PHA03369, capsid maturational protease; | 9e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 0.001 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.001 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 0.001 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.001 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.001 | |
| COG1426 | 284 | COG1426, COG1426, Predicted transcriptional regula | 0.001 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 0.001 | |
| PRK10672 | 361 | PRK10672, PRK10672, rare lipoprotein A; Provisiona | 0.001 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.002 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.002 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 0.002 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.002 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 0.002 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.002 | |
| PRK10905 | 328 | PRK10905, PRK10905, cell division protein DamX; Va | 0.002 | |
| PRK14666 | 694 | PRK14666, uvrC, excinuclease ABC subunit C; Provis | 0.002 | |
| PLN02217 | 670 | PLN02217, PLN02217, probable pectinesterase/pectin | 0.002 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.003 | |
| pfam05104 | 151 | pfam05104, Rib_recp_KP_reg, Ribosome receptor lysi | 0.003 | |
| PRK10118 | 408 | PRK10118, PRK10118, flagellar hook-length control | 0.003 | |
| PHA03269 | 566 | PHA03269, PHA03269, envelope glycoprotein C; Provi | 0.003 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.003 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 0.003 | |
| COG3147 | 226 | COG3147, DedD, Uncharacterized protein conserved i | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.004 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.004 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.004 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 0.004 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.004 | |
| PLN02217 | 670 | PLN02217, PLN02217, probable pectinesterase/pectin | 0.004 |
| >gnl|CDD|133018 cd02537, GT8_Glycogenin, Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen | Back alignment and domain information |
|---|
Score = 231 bits (592), Expect = 3e-73
Identities = 81/159 (50%), Positives = 104/159 (65%), Gaps = 3/159 (1%)
Query: 8 AWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKEVDVF 67
A+VTL TND Y GALV+ SL++V + +DL +L+TPGV+ + L +V V+EV+
Sbjct: 2 AYVTLLTNDDYLPGALVLGYSLRKVGSSYDLVVLVTPGVSEESREALEEVGWIVREVEPI 61
Query: 68 DSRDETNLRLLSRPDLGITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDRE-ELSAA 126
D D NL L RP T+TK+ W LT+Y K VFLDAD L+++N DELFD E +AA
Sbjct: 62 DPPDSANL--LKRPRFKDTYTKLRLWNLTEYDKVVFLDADTLVLRNIDELFDLPGEFAAA 119
Query: 127 PDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFDDA 165
PD GWPD FNSGVFV KPSE T+N L++ SFD
Sbjct: 120 PDCGWPDLFNSGVFVLKPSEETFNDLLDALQDTPSFDGG 158
|
Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. Length = 240 |
| >gnl|CDD|216536 pfam01501, Glyco_transf_8, Glycosyl transferase family 8 | Back alignment and domain information |
|---|
| >gnl|CDD|132996 cd00505, Glyco_transf_8, Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis | Back alignment and domain information |
|---|
| >gnl|CDD|133064 cd06914, GT8_GNT1, GNT1 is a fungal enzyme that belongs to the GT 8 family | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133037 cd04194, GT8_A4GalT_like, A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227884 COG5597, COG5597, Alpha-N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215090 PLN00176, PLN00176, galactinol synthase | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|225805 COG3266, DamX, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218435 pfam05104, Rib_recp_KP_reg, Ribosome receptor lysine/proline rich region | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|224343 COG1426, COG1426, Predicted transcriptional regulator contains Xre-like HTH domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236733 PRK10672, PRK10672, rare lipoprotein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236792 PRK10905, PRK10905, cell division protein DamX; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237782 PRK14666, uvrC, excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218435 pfam05104, Rib_recp_KP_reg, Ribosome receptor lysine/proline rich region | Back alignment and domain information |
|---|
| >gnl|CDD|236652 PRK10118, PRK10118, flagellar hook-length control protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 518 | |||
| PLN00176 | 333 | galactinol synthase | 100.0 | |
| cd02537 | 240 | GT8_Glycogenin Glycogenin belongs the GT 8 family | 100.0 | |
| cd06914 | 278 | GT8_GNT1 GNT1 is a fungal enzyme that belongs to t | 100.0 | |
| cd00505 | 246 | Glyco_transf_8 Members of glycosyltransferase fami | 99.97 | |
| PF01501 | 250 | Glyco_transf_8: Glycosyl transferase family 8; Int | 99.96 | |
| cd04194 | 248 | GT8_A4GalT_like A4GalT_like proteins catalyze the | 99.96 | |
| PRK15171 | 334 | lipopolysaccharide 1,3-galactosyltransferase; Prov | 99.95 | |
| cd06429 | 257 | GT8_like_1 GT8_like_1 represents a subfamily of GT | 99.93 | |
| COG1442 | 325 | RfaJ Lipopolysaccharide biosynthesis proteins, LPS | 99.92 | |
| cd06431 | 280 | GT8_LARGE_C LARGE catalytic domain has closest hom | 99.91 | |
| cd06432 | 248 | GT8_HUGT1_C_like The C-terminal domain of HUGT1-li | 99.8 | |
| PLN02523 | 559 | galacturonosyltransferase | 99.79 | |
| cd06430 | 304 | GT8_like_2 GT8_like_2 represents a subfamily of GT | 99.79 | |
| PLN02718 | 603 | Probable galacturonosyltransferase | 99.79 | |
| COG5597 | 368 | Alpha-N-acetylglucosamine transferase [Cell envelo | 99.74 | |
| PLN02769 | 629 | Probable galacturonosyltransferase | 99.73 | |
| PLN02867 | 535 | Probable galacturonosyltransferase | 99.68 | |
| PLN02742 | 534 | Probable galacturonosyltransferase | 99.67 | |
| PLN02659 | 534 | Probable galacturonosyltransferase | 99.67 | |
| PLN02829 | 639 | Probable galacturonosyltransferase | 99.66 | |
| PLN02870 | 533 | Probable galacturonosyltransferase | 99.64 | |
| PLN02910 | 657 | polygalacturonate 4-alpha-galacturonosyltransferas | 99.6 | |
| KOG1950|consensus | 369 | 99.36 | ||
| PF11051 | 271 | Mannosyl_trans3: Mannosyltransferase putative; Int | 98.32 | |
| PF03407 | 212 | Nucleotid_trans: Nucleotide-diphospho-sugar transf | 97.35 | |
| KOG1879|consensus | 1470 | 96.53 | ||
| PF05637 | 239 | Glyco_transf_34: galactosyl transferase GMA12/MNN1 | 93.38 | |
| KOG1928|consensus | 409 | 92.0 | ||
| KOG1950|consensus | 369 | 90.59 | ||
| PF00535 | 169 | Glycos_transf_2: Glycosyl transferase family 2; In | 86.25 | |
| PF07801 | 142 | DUF1647: Protein of unknown function (DUF1647); In | 86.0 | |
| cd04186 | 166 | GT_2_like_c Subfamily of Glycosyltransferase Famil | 85.04 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 82.69 | |
| cd02525 | 249 | Succinoglycan_BP_ExoA ExoA is involved in the bios | 82.49 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 82.45 | |
| cd00761 | 156 | Glyco_tranf_GTA_type Glycosyltransferase family A | 82.13 |
| >PLN00176 galactinol synthase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-46 Score=386.59 Aligned_cols=236 Identities=25% Similarity=0.390 Sum_probs=196.5
Q ss_pred CCCEEEEEE-ecChhhHHHHHHHHHHHHhhCCCCeEEEEECCCCCHHHHHHHHhcCCeEEEEeeeCCCchhhhcccCCCc
Q psy7288 4 VTGTAWVTL-ATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKEVDVFDSRDETNLRLLSRPD 82 (518)
Q Consensus 4 ~~~~A~VTl-~tnd~Yl~ga~VL~~SLr~~~s~~~lvvLvt~~vs~~~r~~L~~~~~~v~~V~~l~~~d~~~l~~~~rp~ 82 (518)
.+++||||+ ++|++|++||+||++|||++++.+++||||+++|+++.++.|++.|+.|++|+.+...+. ...+.+++
T Consensus 20 ~~~~AyVT~L~~n~~Y~~Ga~vL~~SLr~~~s~~~lVvlVt~dVp~e~r~~L~~~g~~V~~V~~i~~~~~--~~~~~~~~ 97 (333)
T PLN00176 20 PAKRAYVTFLAGNGDYVKGVVGLAKGLRKVKSAYPLVVAVLPDVPEEHRRILVSQGCIVREIEPVYPPEN--QTQFAMAY 97 (333)
T ss_pred cCceEEEEEEecCcchHHHHHHHHHHHHHhCCCCCEEEEECCCCCHHHHHHHHHcCCEEEEecccCCccc--ccccccch
Confidence 468999995 579999999999999999999999999999999999999999999999999988865432 22234567
Q ss_pred hhhhhHhHhhhhccCcCeEEEecCCeEEcCCChhhhCCC--CcccccC------------------------CCCC----
Q psy7288 83 LGITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDRE--ELSAAPD------------------------AGWP---- 132 (518)
Q Consensus 83 ~~~tftKL~~w~L~eydKVVYLDaD~LVl~nIDeLF~~~--elaAapD------------------------~gwp---- 132 (518)
+..+|+||+||+|++|+||||||+|+||++||||||+++ .++|+.| .+||
T Consensus 98 ~~i~~tKl~iw~l~~ydkvlyLDaD~lv~~nid~Lf~~~~~~~aAV~dc~~~~~~~~~p~~~~~~c~~~~~~~~wp~~~g 177 (333)
T PLN00176 98 YVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLPDGYFYAVMDCFCEKTWSHTPQYKIGYCQQCPDKVTWPAELG 177 (333)
T ss_pred hhhhhhhhhhccccccceEEEecCCEEeecChHHHhcCCCcceEEEecccccccccccccccccccccchhhccchhhcc
Confidence 788999999999999999999999999999999999985 3666655 2333
Q ss_pred ----CCCCceEEEEeCChHHHHHHHHHHHhcCCCCcCccccccccccCCCCCcccCCCCCCCCCCCCCccccCCCCCCCC
Q psy7288 133 ----DCFNSGVFVFKPSESTYNALVEFALVNGSFDDATRQLQKPLNMRNLPKSFFQPPSTGSRSPSVSSISHSRENSADS 208 (518)
Q Consensus 133 ----~~FNSGVmVi~Ps~~~~~~Ll~~~~~~~s~d~~DQdl~~pL~mr~lpN~~F~~~~~~di~p~~~~i~~Lr~~s~p~ 208 (518)
.|||||||||+|+.++|++|++++.....+.++|||+ | |.+|.+.. +.| |+
T Consensus 178 ~~~~~yFNSGVlvinps~~~~~~ll~~l~~~~~~~f~DQD~---L------N~~F~~~~-----------~~L-----p~ 232 (333)
T PLN00176 178 PPPPLYFNAGMFVFEPSLSTYEDLLETLKITPPTPFAEQDF---L------NMFFRDIY-----------KPI-----PP 232 (333)
T ss_pred CCCCCeEEeEEEEEEcCHHHHHHHHHHHHhcCCCCCCCHHH---H------HHHHcCcE-----------EEC-----Cc
Confidence 4999999999999999999999988776778999999 9 99999742 678 99
Q ss_pred ccccccccccccc--ccCCCceEEcccC-CCCCCCccccchhhhhhhhhHHHhhhhhhhcc
Q psy7288 209 AFGTSTITSTSSS--VSGGGLQIAHPRA-HSSPASLQQTYASAQQQHQQHLKQRSYDITTV 266 (518)
Q Consensus 209 ~YN~~~~~~y~y~--~~~~~~kIiHf~g-~~KPW~~~~~~~~~~~~~~~~~~~~WWdi~~~ 266 (518)
+||++....+.+. ...++++||||+| ..|||+...............+.++||++|+.
T Consensus 233 ~YN~~~~~~~~~~~~~~~~~vkIIHY~~~~~KPW~~~~~~~~~~~~~~~~~~~~Ww~~~~~ 293 (333)
T PLN00176 233 VYNLVLAMLWRHPENVELDKVKVVHYCAAGSKPWRYTGKEENMDREDIKMLVKKWWDIYND 293 (333)
T ss_pred hhcCchhhhhhChhhcccCCcEEEEeeCCCCCCCCCCCcccCCChHHHHHHHHHHHHHhcc
Confidence 9999876555441 1256899999996 58999976544333334557889999999953
|
|
| >cd02537 GT8_Glycogenin Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen | Back alignment and domain information |
|---|
| >cd06914 GT8_GNT1 GNT1 is a fungal enzyme that belongs to the GT 8 family | Back alignment and domain information |
|---|
| >cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis | Back alignment and domain information |
|---|
| >PF01501 Glyco_transf_8: Glycosyl transferase family 8; InterPro: IPR002495 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd04194 GT8_A4GalT_like A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface | Back alignment and domain information |
|---|
| >PRK15171 lipopolysaccharide 1,3-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd06429 GT8_like_1 GT8_like_1 represents a subfamily of GT8 with unknown function | Back alignment and domain information |
|---|
| >COG1442 RfaJ Lipopolysaccharide biosynthesis proteins, LPS:glycosyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis | Back alignment and domain information |
|---|
| >cd06432 GT8_HUGT1_C_like The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family | Back alignment and domain information |
|---|
| >PLN02523 galacturonosyltransferase | Back alignment and domain information |
|---|
| >cd06430 GT8_like_2 GT8_like_2 represents a subfamily of GT8 with unknown function | Back alignment and domain information |
|---|
| >PLN02718 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >COG5597 Alpha-N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02769 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02867 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02742 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02659 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02829 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02870 Probable galacturonosyltransferase | Back alignment and domain information |
|---|
| >PLN02910 polygalacturonate 4-alpha-galacturonosyltransferase | Back alignment and domain information |
|---|
| >KOG1950|consensus | Back alignment and domain information |
|---|
| >PF11051 Mannosyl_trans3: Mannosyltransferase putative; InterPro: IPR022751 Alpha-mannosyltransferase is responsible for the addition of residues to the outer chain of core N-linked polysaccharides and to O-linked mannotriose | Back alignment and domain information |
|---|
| >PF03407 Nucleotid_trans: Nucleotide-diphospho-sugar transferase; InterPro: IPR005069 Proteins in this family have been been predicted to be nucleotide-diphospho-sugar transferases [] | Back alignment and domain information |
|---|
| >KOG1879|consensus | Back alignment and domain information |
|---|
| >PF05637 Glyco_transf_34: galactosyl transferase GMA12/MNN10 family; InterPro: IPR008630 This family contains a number of glycosyltransferase enzymes that contain a DXD motif | Back alignment and domain information |
|---|
| >KOG1928|consensus | Back alignment and domain information |
|---|
| >KOG1950|consensus | Back alignment and domain information |
|---|
| >PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PF07801 DUF1647: Protein of unknown function (DUF1647); InterPro: IPR012444 This entry consists of hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 518 | |||
| 1ll2_A | 333 | Glycogenin-1; protein-substrate complex, beta-alph | 2e-64 | |
| 3u2u_A | 263 | Glycogenin-1, GN-1, GN1; structural genomics, stru | 8e-49 | |
| 1g9r_A | 311 | Glycosyl transferase; alpha-beta structure; HET: U | 5e-11 | |
| 3tzt_A | 276 | Glycosyl transferase family 8; structural genomics | 6e-11 | |
| 3kys_B | 125 | YAP65, 65 kDa YES-associated protein; immunoglobul | 3e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-10 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 4e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-04 | |
| 3l4h_A | 109 | E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d | 7e-08 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-07 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-07 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 7e-06 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 4e-07 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 5e-07 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 5e-05 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 9e-07 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 1e-06 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-06 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-05 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 4e-06 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 5e-06 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 5e-06 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 5e-06 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 6e-06 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 7e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 8e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 5e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 6e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 3e-04 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 9e-06 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 9e-06 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 9e-06 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 1e-05 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 1e-05 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 1e-05 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 2e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-05 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 3e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 3e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-04 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 4e-05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 4e-05 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-04 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 4e-05 | |
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng | 6e-05 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 7e-05 | |
| 1e0m_A | 37 | Wwprototype; SH3 prototype, protein design, de nov | 9e-05 | |
| 2zaj_A | 49 | Membrane-associated guanylate kinase, WW and PDZ d | 1e-04 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 2e-04 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 2e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-04 | |
| 3k8t_A | 888 | Ribonucleoside-diphosphate reductase large chain; | 6e-04 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 6e-04 |
| >1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* Length = 333 | Back alignment and structure |
|---|
Score = 211 bits (538), Expect = 2e-64
Identities = 124/365 (33%), Positives = 175/365 (47%), Gaps = 42/365 (11%)
Query: 4 VTGTAWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKE 63
+T A+VTL TND+YA GALV+ +SLK+ T LA+L TP V+ M+ L VF+ V
Sbjct: 1 MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVIT 60
Query: 64 VDVFDSRDETNLRLLSRPDLGITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDREEL 123
VD+ DS D +L L+ RP+LG+T TK+H W LTQYSKCVF+DAD L++ N D+LF+REEL
Sbjct: 61 VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREEL 120
Query: 124 SAAPDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFDDATRQLQKPLNMRNLPKSFF 183
SAAPD GWPDCFNSGVFV++PS TYN L+ A GSFD + L
Sbjct: 121 SAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFDGGDQGLLNTFFNSWATTDIR 180
Query: 184 QPPSTGSRSPSVSSISHSRENSADSAFGTSTITSTSSSVSGGGLQIAH---------PRA 234
+ S+S S+ A G ++ H
Sbjct: 181 KHLPFIYNLSSISIYSYLPAFKAF----------------GANAKVVHFLGQTKPWNYTY 224
Query: 235 HSSPASLQQTYASAQQQHQQHLKQ-RSYDITTVLDELGPLPPGWEQARTAEGQVYYLKGV 293
+ S++ H Q L T+V+ L +
Sbjct: 225 DTKTKSVRSEGHDPTMTHPQFLNVWWDIFTTSVVPLLQQFGLVQDTCSYQ---------- 274
Query: 294 LFMYTRLQAGLARALAQVPIGTPISAEQLAYEDHIHRQHWEEGHIDYLGKDSWDNIWKKI 353
++ A++ + +G + Q ++ WE+G DY+G DS+DNI KK+
Sbjct: 275 ------HVEDVSGAVSHLSLGETPATTQPFVSSEERKERWEQGQADYMGADSFDNIKKKL 328
Query: 354 SQTIE 358
++
Sbjct: 329 DTYLQ 333
|
| >3u2u_A Glycogenin-1, GN-1, GN1; structural genomics, structural genomics consortium, SGC, transferase, glycosyltransferase, glycogen biosynthesis; HET: GLC UDP; 1.45A {Homo sapiens} PDB: 3t7n_A* 3t7o_A* 3t7m_A* 3u2v_A* 3u2x_A* 3u2t_A 3rmv_A* 3rmw_A* 3u2w_A* 3qvb_A* 3q4s_A* 1zct_A* 3v8y_A 3v8z_A* 3usr_A 3v90_A 3v91_A* 3usq_A Length = 263 | Back alignment and structure |
|---|
| >1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* Length = 311 | Back alignment and structure |
|---|
| >3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} Length = 276 | Back alignment and structure |
|---|
| >3kys_B YAP65, 65 kDa YES-associated protein; immunoglobulin-like fold, activator, disease mutation, DNA- binding, nucleus, phosphoprotein, transcription; 2.80A {Homo sapiens} PDB: 3jua_B Length = 125 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50 | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 | Back alignment and structure |
|---|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38 | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57 | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49 | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46 | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42 | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46 | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88 | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36 | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36 | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41 | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90 | Back alignment and structure |
|---|
| >1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37 | Back alignment and structure |
|---|
| >2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49 | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40 | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3k8t_A Ribonucleoside-diphosphate reductase large chain; eukaryotic ribonucleotide reductase, nucleotide analogs, all enzyme ATP-binding; HET: DGT 2A5; 2.10A {Saccharomyces cerevisiae} PDB: 1zyz_A 2cvs_A 2cvt_A* 2cvu_A* 2cvv_A* 1zzd_A* 2cvw_A* 2cvy_A* 2eud_A* 2zlf_A 2zlg_A* 2cvx_A* 3paw_A 3s87_A* 3s8b_A* 3s8c_A* 3s8a_A* 3tb9_A* 3tba_A* Length = 888 | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 518 | |||
| 1ll2_A | 333 | Glycogenin-1; protein-substrate complex, beta-alph | 100.0 | |
| 3u2u_A | 263 | Glycogenin-1, GN-1, GN1; structural genomics, stru | 100.0 | |
| 3tzt_A | 276 | Glycosyl transferase family 8; structural genomics | 99.97 | |
| 1g9r_A | 311 | Glycosyl transferase; alpha-beta structure; HET: U | 99.96 | |
| 3kys_B | 125 | YAP65, 65 kDa YES-associated protein; immunoglobul | 97.26 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 95.51 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 95.31 | |
| 2ysg_A | 40 | Syntaxin-binding protein 4; synip, STXBP4, WW doma | 94.73 | |
| 2law_A | 38 | Yorkie homolog; YAP, SMAD1, CDK, signal transducti | 94.69 | |
| 2djy_A | 42 | SMAD ubiquitination regulatory factor 2; beta shee | 94.53 | |
| 2kyk_A | 39 | E3 ubiquitin-protein ligase itchy homolog; LMP2A, | 94.44 | |
| 2zaj_A | 49 | Membrane-associated guanylate kinase, WW and PDZ d | 94.38 | |
| 2l4j_A | 46 | YES-associated protein 2 (YAP2); WW domain, medaka | 94.29 | |
| 2yse_A | 60 | Membrane-associated guanylate kinase, WW and PDZ d | 94.26 | |
| 2ysf_A | 40 | E3 ubiquitin-protein ligase itchy homolog; AIP4, N | 94.23 | |
| 2jmf_A | 53 | E3 ubiquitin-protein ligase suppressor of deltex; | 94.21 | |
| 1i5h_W | 50 | Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, | 93.89 | |
| 2ez5_W | 46 | Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma | 93.88 | |
| 1wr4_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 93.77 | |
| 1jmq_A | 46 | YAP65, 65 kDa YES-associated protein; polyproline | 93.7 | |
| 1wr3_A | 36 | Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M | 93.69 | |
| 2ysd_A | 57 | Membrane-associated guanylate kinase, WW and PDZ d | 93.62 | |
| 2ysb_A | 49 | Salvador homolog 1 protein; WW domain, structural | 93.56 | |
| 2kpz_A | 49 | E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV | 93.0 | |
| 1wr7_A | 41 | NEDD4-2; all-beta, ligase; NMR {Mus musculus} | 92.97 | |
| 1wmv_A | 54 | WWOX, WW domain containing oxidoreductase; all-bet | 92.95 | |
| 2dwv_A | 49 | Salvador homolog 1 protein; WW domain, dimer, stru | 92.74 | |
| 1e0m_A | 37 | Wwprototype; SH3 prototype, protein design, de nov | 92.37 | |
| 2dmv_A | 43 | Itchy homolog E3 ubiquitin protein ligase; WW doma | 92.05 | |
| 2ysh_A | 40 | GAS-7, growth-arrest-specific protein 7; WW domain | 90.21 | |
| 3l4h_A | 109 | E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d | 90.08 | |
| 2ysc_A | 39 | Amyloid beta A4 precursor protein-binding family B | 88.81 | |
| 1ymz_A | 43 | CC45; artificial protein, computational design, un | 88.55 | |
| 3bcv_A | 240 | Putative glycosyltransferase protein; protein stru | 86.16 | |
| 2kxq_A | 90 | E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG | 85.94 | |
| 2ho2_A | 38 | Fe65 protein, amyloid beta A4 protein-binding fami | 85.49 | |
| 1tk7_A | 88 | CG4244-PB; WW domain, notch, signaling protein; NM | 83.36 | |
| 1qg8_A | 255 | Protein (spore coat polysaccharide biosynthesis P | 82.7 | |
| 3olm_A | 429 | E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S | 80.98 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 80.67 |
| >1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-65 Score=530.63 Aligned_cols=319 Identities=39% Similarity=0.628 Sum_probs=208.4
Q ss_pred CCCEEEEEEecChhhHHHHHHHHHHHHhhCCCCeEEEEECCCCCHHHHHHHHhcCCeEEEEeeeCCCchhhhcccCCCch
Q psy7288 4 VTGTAWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKEVDVFDSRDETNLRLLSRPDL 83 (518)
Q Consensus 4 ~~~~A~VTl~tnd~Yl~ga~VL~~SLr~~~s~~~lvvLvt~~vs~~~r~~L~~~~~~v~~V~~l~~~d~~~l~~~~rp~~ 83 (518)
++++||||+++|++|+.|++|+++||++++++++++||++++++++.++.|++.++.++.|+.++..+..++..+.++++
T Consensus 1 Ms~~a~vt~~~d~~Yl~~a~vl~~SL~~~~s~~~l~vlv~~~is~~~~~~L~~~~~~v~~v~~l~~~~~~~~~~~~~~~~ 80 (333)
T 1ll2_A 1 MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPEL 80 (333)
T ss_dssp CCSEEEEEEESSHHHHHHHHHHHHHHHHTTCCSEEEEEECTTSCHHHHHHHHHHCSEEEECCTTSTTSTTHHHHHHCGGG
T ss_pred CCceEEEEEEeCHHHHHHHHHHHHHHHHhCCCCCEEEEEcCCCCHHHHHHHHHhCCEEEEEeecCCcchhhcccccccch
Confidence 47899999999999999999999999999999999999999999999999999999999988877655455554556777
Q ss_pred hhhhHhHhhhhccCcCeEEEecCCeEEcCCChhhhCCCCcccccCCCCCCCCCceEEEEeCChHHHHHHHHHHHhcCCCC
Q psy7288 84 GITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDREELSAAPDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFD 163 (518)
Q Consensus 84 ~~tftKL~~w~L~eydKVVYLDaD~LVl~nIDeLF~~~elaAapD~gwp~~FNSGVmVi~Ps~~~~~~Ll~~~~~~~s~d 163 (518)
..+|+||++|.|++|+||||||+|+||++|||+||+++.++|++|.||++|||||||||+|+..++++|++++.++++++
T Consensus 81 ~~t~~Kl~i~~l~~ydrvlYLDaD~lv~~di~eLf~~~~~aAv~d~~~~~~fNsGvmlin~~~~~~~~l~~~~~~~~~~~ 160 (333)
T 1ll2_A 81 GVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFD 160 (333)
T ss_dssp HHHHHHGGGGGCTTCSEEEEECTTEEECSCCGGGGGSCSSEEEECSSSTTSEEEEEEEECCCHHHHHHHHHHHHHTCCTT
T ss_pred HHHHHHHHHhHhcCCCeEEEEeCCEEeccCHHHHhCCCceeEEecCCCCcceeeeEEEEeCCHHHHHHHHHHHHhcCCCC
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999888999
Q ss_pred cCccccccccccCCCCCcccCCCCCCCCCCCCCccccCCCCCCCCcccccccccccc----cccCCCceEEcccCCCCCC
Q psy7288 164 DATRQLQKPLNMRNLPKSFFQPPSTGSRSPSVSSISHSRENSADSAFGTSTITSTSS----SVSGGGLQIAHPRAHSSPA 239 (518)
Q Consensus 164 ~~DQdl~~pL~mr~lpN~~F~~~~~~di~p~~~~i~~Lr~~s~p~~YN~~~~~~y~y----~~~~~~~kIiHf~g~~KPW 239 (518)
++|||+ | |.+|.+|...++. ..| |++||++....|.+ ..+..+++||||+|..|||
T Consensus 161 ~~DQ~~---L------N~~f~~~~~~~~~------~~L-----p~~yN~~~~~~~~~~p~~~~~~~~~~IiHf~g~~KPW 220 (333)
T 1ll2_A 161 GGDQGL---L------NTFFNSWATTDIR------KHL-----PFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPW 220 (333)
T ss_dssp SSHHHH---H------HHHTTTTTTSCGG------GBC-----CGGGSEETTHHHHTHHHHHHHGGGCSEEECCSSCCGG
T ss_pred CCCHHH---H------HHHHHhhcccCcc------ccC-----CcHHhcccccchhccHHHHhhcCCCEEEEECCCCCCC
Confidence 999999 9 9999988533332 567 99999997654544 2346789999999999999
Q ss_pred Cccccc----h--hhhhhh--hhHHHhhhhhhhcccc--cCCCCCCCCccccccccceeeecccchhhHHHhhhHhhhhc
Q psy7288 240 SLQQTY----A--SAQQQH--QQHLKQRSYDITTVLD--ELGPLPPGWEQARTAEGQVYYLKGVLFMYTRLQAGLARALA 309 (518)
Q Consensus 240 ~~~~~~----~--~~~~~~--~~~~~~~WWdi~~~l~--e~~~l~~gwe~a~t~~g~~y~~~~~~~~~~~~~~~~a~~~s 309 (518)
...... . ..+..+ |..++++||++|+..- -+.+. +............+++++++
T Consensus 221 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~WW~~~~~~~~~~~~~~----------------~~~~~~~~~~~~~~~~~~~~ 284 (333)
T 1ll2_A 221 NYTYDTKTKSVRSEGHDPTMTHPQFLNVWWDIFTTSVVPLLQQF----------------GLVQDTCSYQHVEDVSGAVS 284 (333)
T ss_dssp GSCEETTTTEEC--------CCHHHHHHHHHHHHHTHHHHHTC-------------------------------------
T ss_pred CCCCCCCccccccccccccccHHHHHHHHHHHHHhhcccccchh----------------hccCCCCCccchhhhhhhhh
Confidence 875221 1 011111 4689999999995311 00000 00000011123466899999
Q ss_pred cccCCCCCCCcccccchhhcccccccCCCCCcCchhhHHHHHHhhhccC
Q psy7288 310 QVPIGTPISAEQLAYEDHIHRQHWEEGHIDYLGKDSWDNIWKKISQTIE 358 (518)
Q Consensus 310 q~~i~~~~~~~~~~~ee~~rr~~WE~G~iDYmG~dsf~nIqkKld~~L~ 358 (518)
|+++++..++++...++++||++||+|||||||+|||||||||||+||+
T Consensus 285 ~~~~~~~~~~~~~~~~~~~~~~~we~g~~dy~g~d~f~~i~~kl~~~l~ 333 (333)
T 1ll2_A 285 HLSLGETPATTQPFVSSEERKERWEQGQADYMGADSFDNIKKKLDTYLQ 333 (333)
T ss_dssp -------------------------------------------------
T ss_pred ccccccccCccCCCCCcHHHHHHHhccCCccccchhHHHHHHHHHHhhC
Confidence 9999975555555456777799999999999999999999999999995
|
| >3u2u_A Glycogenin-1, GN-1, GN1; structural genomics, structural genomics consortium, SGC, transferase, glycosyltransferase, glycogen biosynthesis; HET: GLC UDP; 1.45A {Homo sapiens} SCOP: c.68.1.14 PDB: 3t7n_A* 3t7o_A* 3t7m_A* 3u2v_A* 3u2x_A* 3u2t_A 3rmv_A* 3rmw_A* 3u2w_A* 3qvb_A* 3q4s_A* 1zct_A* 3v8y_A 3v8z_A* 3usr_A 3v90_A 3v91_A* 3usq_A | Back alignment and structure |
|---|
| >3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} SCOP: c.68.1.0 | Back alignment and structure |
|---|
| >1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* | Back alignment and structure |
|---|
| >3kys_B YAP65, 65 kDa YES-associated protein; immunoglobulin-like fold, activator, disease mutation, DNA- binding, nucleus, phosphoprotein, transcription; 2.80A {Homo sapiens} PDB: 3jua_B | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A | Back alignment and structure |
|---|
| >2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} | Back alignment and structure |
|---|
| >2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A | Back alignment and structure |
|---|
| >1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* | Back alignment and structure |
|---|
| >2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* | Back alignment and structure |
|---|
| >1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* | Back alignment and structure |
|---|
| >1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* | Back alignment and structure |
|---|
| >1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 | Back alignment and structure |
|---|
| >1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 | Back alignment and structure |
|---|
| >3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* | Back alignment and structure |
|---|
| >2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A | Back alignment and structure |
|---|
| >1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 | Back alignment and structure |
|---|
| >1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* | Back alignment and structure |
|---|
| >3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 518 | ||||
| d1ll2a_ | 263 | c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cun | 2e-47 | |
| d1ga8a_ | 282 | c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseri | 2e-18 | |
| d1tk7a1 | 45 | b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) | 4e-07 | |
| d1i5hw_ | 50 | b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain | 2e-06 | |
| d2jmfa1 | 33 | b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII | 6e-06 | |
| d1jmqa_ | 46 | b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens | 2e-04 |
| >d1ll2a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 263 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Glycogenin domain: Glycogenin species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 163 bits (413), Expect = 2e-47
Identities = 94/160 (58%), Positives = 118/160 (73%)
Query: 4 VTGTAWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKE 63
+T A+VTL TND+YA GALV+ +SLK+ T LA+L TP V+ M+ L VF+ V
Sbjct: 1 MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVIT 60
Query: 64 VDVFDSRDETNLRLLSRPDLGITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDREEL 123
VD+ DS D +L L+ RP+LG+T TK+H W LTQYSKCVF+DAD L++ N D+LF+REEL
Sbjct: 61 VDILDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREEL 120
Query: 124 SAAPDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFD 163
SAAPD GWPDCFNSGVFV++PS TYN L+ A GSFD
Sbjct: 121 SAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFD 160
|
| >d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} Length = 282 | Back information, alignment and structure |
|---|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45 | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50 | Back information, alignment and structure |
|---|
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33 | Back information, alignment and structure |
|---|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 518 | |||
| d1ll2a_ | 263 | Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: | 100.0 | |
| d1ga8a_ | 282 | Galactosyltransferase LgtC {Neisseria meningitidis | 99.96 | |
| d2jmfa1 | 33 | Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr | 96.86 | |
| d1tk7a1 | 45 | Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso | 96.21 | |
| d1jmqa_ | 46 | Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606 | 96.15 | |
| d1i5hw_ | 50 | Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n | 95.84 | |
| d1pina1 | 34 | Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId | 87.37 |
| >d1ll2a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Nucleotide-diphospho-sugar transferases superfamily: Nucleotide-diphospho-sugar transferases family: Glycogenin domain: Glycogenin species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=100.00 E-value=2.5e-44 Score=354.00 Aligned_cols=242 Identities=45% Similarity=0.720 Sum_probs=204.2
Q ss_pred CCCEEEEEEecChhhHHHHHHHHHHHHhhCCCCeEEEEECCCCCHHHHHHHHhcCCeEEEEeeeCCCchhhhcccCCCch
Q psy7288 4 VTGTAWVTLATNDSYALGALVVANSLKRVNTVHDLAILITPGVTLAMKNELLKVFNFVKEVDVFDSRDETNLRLLSRPDL 83 (518)
Q Consensus 4 ~~~~A~VTl~tnd~Yl~ga~VL~~SLr~~~s~~~lvvLvt~~vs~~~r~~L~~~~~~v~~V~~l~~~d~~~l~~~~rp~~ 83 (518)
++.+||||+++|++|++||+||++||+++++.++++||++++++++.++.|+..+..++.|++++..+..+.....+.++
T Consensus 1 ~~~~A~vt~~t~d~Yl~~a~vl~~SL~~~~~~~~~vvl~~~~i~~~~~~~L~~~~~~~~~v~~i~~~~~~~~~~~~~~~~ 80 (263)
T d1ll2a_ 1 MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTSRRLAVLTTPQVSDTMRKALEIVFDEVITVDILDSGDSAHLTLMKRPEL 80 (263)
T ss_dssp CCSEEEEEEESSHHHHHHHHHHHHHHHHTTCCSEEEEEECTTSCHHHHHHHHHHCSEEEECCTTSTTSTTHHHHHHCGGG
T ss_pred CCccEEEEEEeCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHhCCcceeEEeecCcchhhhhhhccccc
Confidence 47899999999999999999999999999999999999999999999999999999999998887766655554555567
Q ss_pred hhhhHhHhhhhccCcCeEEEecCCeEEcCCChhhhCCCCcccccCCCCCCCCCceEEEEeCChHHHHHHHHHHHhcCCCC
Q psy7288 84 GITFTKIHAWRLTQYSKCVFLDADVLIVQNCDELFDREELSAAPDAGWPDCFNSGVFVFKPSESTYNALVEFALVNGSFD 163 (518)
Q Consensus 84 ~~tftKL~~w~L~eydKVVYLDaD~LVl~nIDeLF~~~elaAapD~gwp~~FNSGVmVi~Ps~~~~~~Ll~~~~~~~s~d 163 (518)
..+|+||++|+|.+||||||||||+||++|||+||+.+.++|+++.+++.||||||||++|+.++++.|.+.+.+...+.
T Consensus 81 ~~ty~Kl~i~~l~~ydkvlYLDaD~lv~~~id~Lf~~~~~~a~~~~~~~~~~nsGv~l~~p~~~~~~~i~~~~~~~~~~~ 160 (263)
T d1ll2a_ 81 GVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHVASEQGSFD 160 (263)
T ss_dssp HHHHHHGGGGGCTTCSEEEEECTTEEECSCCGGGGGSCSSEEEECSSSTTSEEEEEEEECCCHHHHHHHHHHHHHTCCTT
T ss_pred hhhhHHHHHhhhcccceEEEeCCCEEEecCHHHHhcCCccceeccCCCcccccCCcEEECccHHHHHHHHHHHHhhCCCC
Confidence 88999999999999999999999999999999999999999999999999999999999999999999999999988888
Q ss_pred cCccccccccccCCCCCcccCCCCCCCCCCCCCccccCCCCCCCCcccccccccccc----cccCCCceEEcccCCCCCC
Q psy7288 164 DATRQLQKPLNMRNLPKSFFQPPSTGSRSPSVSSISHSRENSADSAFGTSTITSTSS----SVSGGGLQIAHPRAHSSPA 239 (518)
Q Consensus 164 ~~DQdl~~pL~mr~lpN~~F~~~~~~di~p~~~~i~~Lr~~s~p~~YN~~~~~~y~y----~~~~~~~kIiHf~g~~KPW 239 (518)
++||++ | |.+|.+...... +..| ++.||+.....+.+ .....+++||||+|..|||
T Consensus 161 ~~dq~~---l------n~~~~~~~~~~~------~~~l-----~~~~~~~~~~~~~~~~~~~~~~~~~~iIHf~g~~KPW 220 (263)
T d1ll2a_ 161 GGDQGL---L------NTFFNSWATTDI------RKHL-----PFIYNLSSISIYSYLPAFKAFGANAKVVHFLGQTKPW 220 (263)
T ss_dssp SSHHHH---H------HHHTTTTTTSCG------GGBC-----CGGGSEETTHHHHTHHHHHHHGGGCSEEECCSSCCGG
T ss_pred hhhhhH---H------HHHHHhhhccCc------cccc-----CHHHhhhhhhhhhhhHhHHhhcCCeEEEEeCCCCCCC
Confidence 999999 9 999987642111 2445 89999887654443 2235789999999999999
Q ss_pred Cccccch-----h---hhhhhhhHHHhhhhhhhc
Q psy7288 240 SLQQTYA-----S---AQQQHQQHLKQRSYDITT 265 (518)
Q Consensus 240 ~~~~~~~-----~---~~~~~~~~~~~~WWdi~~ 265 (518)
+...... . .....+..+++.||++|+
T Consensus 221 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~Ww~~~~ 254 (263)
T d1ll2a_ 221 NYTYDTKTKSVRSEGHDPTMTHPQFLNVWWDIFT 254 (263)
T ss_dssp GSCEETTTTEEC--------CCHHHHHHHHHHHH
T ss_pred CCCCCCCccccccchhhccccHHHHHHHHHHHHh
Confidence 8632110 0 012345688999999995
|
| >d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|