Psyllid ID: psy7292

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--
MKTKSLDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
cccccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEccccccccccc
ccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEHHHHccccccccEEEEEccccccccc
mktksldiAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLhvlggrplhwppg
mktksldiailGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHvlggrplhwppg
MKTKSLDIAILGHLMIvakkvaakkLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
*****LDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLH****
*KTKSLDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPP*
MKTKSLDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
MKTKSLDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHW**G
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooo
iiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTKSLDIAILGHLMIVAKKVAAKKLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query62
UNIPROTKB|P49773126 HINT1 "Histidine triad nucleot 0.903 0.444 0.508 3.2e-10
UNIPROTKB|Q5RF69126 HINT1 "Histidine triad nucleot 0.870 0.428 0.509 6.6e-10
MGI|MGI:1321133126 Hint1 "histidine triad nucleot 0.903 0.444 0.508 6.6e-10
RGD|620960126 Hint1-ps1 "histidine triad nuc 0.903 0.444 0.508 6.6e-10
UNIPROTKB|D4A269126 D4A269 "Uncharacterized protei 0.903 0.444 0.508 6.6e-10
UNIPROTKB|J9P9J0126 HINT1 "Uncharacterized protein 0.903 0.444 0.491 1.1e-09
ZFIN|ZDB-GENE-040927-8126 hint1 "histidine triad nucleot 0.983 0.484 0.467 1.1e-09
FB|FBgn0031459150 CG2862 [Drosophila melanogaste 0.903 0.373 0.491 1.4e-09
UNIPROTKB|P62958126 HINT1 "Histidine triad nucleot 0.903 0.444 0.491 1.8e-09
UNIPROTKB|F1RKI3126 HINT1 "Uncharacterized protein 0.903 0.444 0.491 1.8e-09
UNIPROTKB|P49773 HINT1 "Histidine triad nucleotide-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 145 (56.1 bits), Expect = 3.2e-10, P = 3.2e-10
 Identities = 29/57 (50%), Positives = 36/57 (63%)

Query:     7 DIAILGHLMIXXXX-XXXXXLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 62
             D ++LGHLMI          L + YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct:    70 DESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 126
GO:0000166 "nucleotide binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0009154 "purine ribonucleotide catabolic process" evidence=IDA
GO:0016787 "hydrolase activity" evidence=IDA
GO:0072332 "intrinsic apoptotic signaling pathway by p53 class mediator" evidence=IMP
GO:0000118 "histone deacetylase complex" evidence=IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0005080 "protein kinase C binding" evidence=TAS
GO:0005856 "cytoskeleton" evidence=TAS
GO:0007165 "signal transduction" evidence=TAS
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|Q5RF69 HINT1 "Histidine triad nucleotide-binding protein 1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1321133 Hint1 "histidine triad nucleotide binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620960 Hint1-ps1 "histidine triad nucleotide binding protein 1, pseudogene 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A269 D4A269 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9J0 HINT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-8 hint1 "histidine triad nucleotide binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031459 CG2862 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P62958 HINT1 "Histidine triad nucleotide-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKI3 HINT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 2e-12
pfam0123097 pfam01230, HIT, HIT domain 1e-09
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 9e-09
COG0537138 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy 8e-07
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 2e-06
cd0046886 cd00468, HIT_like, HIT family: HIT (Histidine tria 1e-05
cd01277103 cd01277, HINT_subgroup, HINT (histidine triad nucl 5e-05
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score = 56.0 bits (136), Expect = 2e-12
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 7   DIAILGHLMIVAKKVAAKKLIRN--YRVVVNNGWEAVQFSGHLHLHVLGG 54
           D  +LGHL+  A KVA    I    YR+V+N G +  Q   HLHLH+LGG
Sbjct: 55  DEELLGHLLSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|238263 cd00468, HIT_like, HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 62
KOG3275|consensus127 99.92
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.81
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.78
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.73
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.63
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.62
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.58
KOG3379|consensus150 99.58
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.56
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.14
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 98.82
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 98.8
PLN02643336 ADP-glucose phosphorylase 98.68
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 98.67
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 97.91
KOG4359|consensus166 94.53
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 91.5
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 90.63
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 90.48
PLN02643 336 ADP-glucose phosphorylase 87.19
KOG3969|consensus310 86.52
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 86.36
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 83.76
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 83.33
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 81.07
>KOG3275|consensus Back     alignment and domain information 
Probab=99.92  E-value=6.6e-25  Score=133.50  Aligned_cols=61  Identities=56%  Similarity=0.867  Sum_probs=58.3

Q ss_pred             CCCcCCHHHHHHHHHHHHHHHHh-hccCceEEEEecCccCCcccceeeeeeeCCCCCCCCCC
Q psy7292           2 KTKSLDIAILGHLMIVAKKVAAK-KLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG   62 (62)
Q Consensus         2 ~l~~~~~~~~~~l~~~~~~~a~~-~~~~G~~i~~N~G~~aGQ~V~H~H~Hiip~~~l~~~~~   62 (62)
                      .+++.++++++++|.++|++|++ ++.+|||+++|||+.++|+|+|+|+|+|||++++||||
T Consensus        66 ~aed~~~e~Lg~ll~~~k~vak~~Gl~~gYrvv~NnG~~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen   66 KAEDRDDELLGHLLPVAKKVAKALGLEDGYRVVQNNGKDGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             hcccCCHHHHHHHHHHHHHHHHHhCcccceeEEEcCCcccceEEEEEEEEEeCCcccCCCCC
Confidence            35788999999999999999999 99999999999999999999999999999999999997

>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>KOG3379|consensus Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>KOG4359|consensus Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>KOG3969|consensus Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query62
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 2e-22
3oj7_A117 Putative histidine triad family protein; hydrolase 3e-21
4egu_A119 Histidine triad (HIT) protein; structural genomics 5e-19
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 4e-16
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 3e-15
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 3e-15
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 6e-14
3ksv_A149 Uncharacterized protein; HIT family, structural ge 3e-13
2eo4_A149 150AA long hypothetical histidine triad nucleotid 2e-11
3r6f_A135 HIT family protein; structural genomics, seattle s 2e-11
3imi_A147 HIT family protein; structural genomics, infectiou 6e-11
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 1e-10
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 1e-09
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 1e-08
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 2e-05
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score = 81.4 bits (202), Expect = 2e-22
 Identities = 32/57 (56%), Positives = 41/57 (71%), Gaps = 1/57 (1%)

Query: 7   DIAILGHLMIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 62
           D ++LGHLMIV KK AA   ++  YR+VVN G +  Q   H+HLHVLGGR ++WPPG
Sbjct: 70  DESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 99.88
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 99.84
3oj7_A117 Putative histidine triad family protein; hydrolase 99.83
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.78
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.76
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.72
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.7
3imi_A147 HIT family protein; structural genomics, infectiou 99.7
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.7
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.69
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.67
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.66
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.64
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.58
3r6f_A135 HIT family protein; structural genomics, seattle s 99.55
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.52
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.5
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.49
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.49
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.45
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.41
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.37
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.25
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.08
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 97.73
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 97.19
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 96.16
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 95.94
3vg8_G116 Hypothetical protein TTHB210; alpha and beta prote 91.35
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 87.88
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=99.88  E-value=3.6e-23  Score=124.00  Aligned_cols=61  Identities=54%  Similarity=0.915  Sum_probs=54.9

Q ss_pred             CCCcCCHHHHHHHHHHHHHHHHh-hccCceEEEEecCccCCcccceeeeeeeCCCCCCCCCC
Q psy7292           2 KTKSLDIAILGHLMIVAKKVAAK-KLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG   62 (62)
Q Consensus         2 ~l~~~~~~~~~~l~~~~~~~a~~-~~~~G~~i~~N~G~~aGQ~V~H~H~Hiip~~~l~~~~~   62 (62)
                      ++++.+.+++.+++.++++++++ ..++|||+++|+|+.|||+|+|+|+|||||++|+||||
T Consensus        65 dL~~~e~~~l~~l~~~~~~~~~~~~~~~g~ni~~n~g~~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A           65 AAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             GCCGGGHHHHHHHHHHHHHHHHHTTCTTCEEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             hCchhHHHHHHHHHHHHHHHHHHhCCCCCeEEEEecCCccCCccCEeEEEEeCCcccCCCCC
Confidence            45556667799999999999987 55789999999999999999999999999999999997
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>3vg8_G Hypothetical protein TTHB210; alpha and beta proteins (A+B), unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 62
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 3e-13
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 1e-04
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 56.6 bits (136), Expect = 3e-13
 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 1/55 (1%)

Query: 9   AILGHLMIVAKKVAAKKLIRN-YRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG 62
           ++LGHLMIV KK AA   +   YR+VVN G +  Q   H+HLHVLGGR +HWPPG
Sbjct: 57  SLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query62
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 99.87
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.72
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.71
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.71
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.65
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.24
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 98.99
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 98.9
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 98.43
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 95.95
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 94.0
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=2.5e-23  Score=121.42  Aligned_cols=60  Identities=57%  Similarity=0.940  Sum_probs=51.4

Q ss_pred             CCcCCHHHHHHHHHHHHHHHHh-hccCceEEEEecCccCCcccceeeeeeeCCCCCCCCCC
Q psy7292           3 TKSLDIAILGHLMIVAKKVAAK-KLIRNYRVVVNNGWEAVQFSGHLHLHVLGGRPLHWPPG   62 (62)
Q Consensus         3 l~~~~~~~~~~l~~~~~~~a~~-~~~~G~~i~~N~G~~aGQ~V~H~H~Hiip~~~l~~~~~   62 (62)
                      +++.+.+++..++..+++++++ ..++|||+.+|+|+.|||+|+|+|+|||||++++||||
T Consensus        51 l~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~~n~g~~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          51 AEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             CCGGGHHHHHHHHHHHHHHHHHTTCTTCEEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             hhhHHHHHHHHHHHHHHHHHHHhCCCCCEEEEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence            4444556777788888888776 44789999999999999999999999999999999998
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure