Psyllid ID: psy7300

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980------
PPAKKRRVDCELEVEVEEEEHKQLNNTTCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
ccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHcccEEEEccccHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEcccccHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEcccccEEEEEEcccccEEEEccccccccEEEEEcccccccccEEEccccccccccccEEEEEEccccccccccccEEEEEEcccEEEEcccccccccccccEEEEEEcccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHccEEEccccccHHHHHcccccccccccccccEEEEEccccccccccccEEcccccccccHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEccccccccEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccEEEcccHHHHccccccHHHHHHHHHHHcccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHccEEEEEEEc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcHHHHHHHcHHHHHHHHHccEEEEccccHHHHHHHHHHHHcccEEEEEcccccEHccccHcccccHHHccccHHHHHHHHHHHHcccccEEEEcccccHHHHHcccEEEEEcccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEccccEEEEccccccccEEEEEEEccccccEEEEEcccccccccccEEEEEEEcccHHHcccccEEEEEcccEEEEEcccccccccccccEEEEEEccEEEEcccHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHccccccccccEEEEEcHHHHHHHHHccEEEEcccHHHHHHHHHHHHHccccccccEEEEEcccHHEHcccccHHcEccccccccHHHHHHHHHHHHccccEEEEcccccccccHHcccHHHHHcccHHHHHcccccHHHHHHccEEEEcccccccccccccccEEEEEcccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccccEEEEEcccccccccccccHHHHHHHHHHccccHHcccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccEcccEEEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEc
ppakkrrvdcelEVEVEEEEHkqlnnttcetfnmesvanhqngssatamdqdideglYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGvksvtlhdttatslsdlssqfylsekdvgrnraevshtnlsqlnpyvstkaytGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFcdfgnnftvvdttgenpvSVIIAGVTREAEGVVTCldetrhgfedgdyvtfsevqgmtqlngieprkvkvlgpytfsigdttkfdeyvsggiatqvkqpkilkflplpealqqpefvmtdfakfespanlHVAFSTLHNFvksfgyapkpwnsadADQFLALAKESKLNNGELDEKLLQLFAKTaagncnpvnaVIGGIVAQEVMKAcsgkfhpifqwLYFDavecideniaetdaivngsryegqvAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAmmgvgagpggqifvtdmdlieksnlnrqflfrphdvqqpksaTAAKAIKvmnpnvnityhenrvgpetekVYDDLFFESLDGIANALDNVEARIYMdrrcvysrkpllesgtlgtkgnsqvvvphltesysssqdppeksipictlknfpnAIEHTLQWARDNFEGIFRQSAENAAeyledpnfVERVmklpgsqplemLENVKHAlvderplniKDCVAWARNHWQDQYNNQIRQLLfnfppeqvtssgqpfwsgpkrcpkplefdvtdplhlqYIYTGANLkaelygipqvrnLDAIAQMVKQVvvpeftpksgvTIAVTDaqlqnsngdydqdRLGQlknelpsiqelqglhitplefekdddtnLHMDFIVAASNLraanygitpadrhtskliagkiipaiATTTSVVAGLvskkkiepHVRALVFELCcqdesgedvETTIVAVVAYCWskgapklkyydvewtlwdrfeINQEMTLKQFLDYFQNEHKLEITILLLF
ppakkrrvdceleveveeeehkqlnnttCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHdttatslsdlssqFYLSEKDVGRNRAEvshtnlsqlnpyvSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGmtqlngieprkvkvLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKpllesgtlgtkgnsqVVVPHLTEsysssqdppeKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
PPAKKRRVDCeleveveeeeHKQLNNTTCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVtlhdttatslsdlssQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
*****************************************************DEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYL***************NLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHD*********AKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTL***************************IPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLP***PLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQV*****PFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDA***********************IQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLL*
***KKR**************************************************LYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMT**NGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENI****AIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQ***G*HITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
***********************LNNTTCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTE**********KSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
***************************************************DIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDA*******DYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PPAKKRxxxxxxxxxxxxxxxxxxxxxTCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDENIAETDAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query986
FB|FBgn00231431191 Uba1 "Ubiquitin activating enz 0.961 0.795 0.620 0.0
ZFIN|ZDB-GENE-040426-20091058 uba1 "ubiquitin-like modifier 0.981 0.914 0.593 5.49999999906e-315
UNIPROTKB|A3KMV51058 UBA1 "Ubiquitin-like modifier- 0.947 0.882 0.590 2e-308
UNIPROTKB|P223141058 UBA1 "Ubiquitin-like modifier- 0.947 0.882 0.591 1.6e-306
RGD|13593271058 Uba1 "ubiquitin-like modifier 0.947 0.882 0.586 1.7e-304
UNIPROTKB|F1RWX81058 UBA1 "Uncharacterized protein" 0.946 0.881 0.587 2.2e-304
MGI|MGI:988901058 Uba1 "ubiquitin-like modifier 0.947 0.882 0.585 2.2e-304
UNIPROTKB|E2RGH51057 UBA1 "Uncharacterized protein" 0.946 0.882 0.582 6.3e-298
UNIPROTKB|K7GRY0970 UBA1 "Uncharacterized protein" 0.922 0.938 0.588 6.3e-298
MGI|MGI:988911058 Uba1y "ubiquitin-activating en 0.938 0.874 0.563 9.1e-290
FB|FBgn0023143 Uba1 "Ubiquitin activating enzyme 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 3098 (1095.6 bits), Expect = 0., Sum P(2) = 0.
 Identities = 601/968 (62%), Positives = 742/968 (76%)

Query:    25 NNTTCETFNMESVANHQNGSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLG 84
             NN+   T N +   +     ++ A   DIDE LYSRQLYVLGHDAMRRMA+SD+L+SGLG
Sbjct:   167 NNSNNSTNNRQLEGSSNMAGNSAAAGGDIDESLYSRQLYVLGHDAMRRMANSDILLSGLG 226

Query:    85 GLGVEIAKNVILSGVKSVXXXXXXXXXXXXXXXQFYLSEKDVGRNRAEVSHTNLSQLNPY 144
             GLG+EIAKNVIL GVKS+               QFYL+E D+G+NRAE S   L++LN Y
Sbjct:   227 GLGLEIAKNVILGGVKSITLHDTATCGLHDLSSQFYLTEADIGKNRAEASCAQLAELNNY 286

Query:   145 VSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVFCD 204
             V T ++TG L+E F++KFRVVVLTNS  +EQ  I++  H N IALIIA+TRGLFA+VFCD
Sbjct:   287 VRTVSHTGPLTEEFLRKFRVVVLTNSDGEEQQRIAKFAHENGIALIIAETRGLFAKVFCD 346

Query:   205 FGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNG 264
             FG +FT+ D  G  P+S +IA +T +A+GVVTCLDETRHGF DGDYVTFSEVQGM +LNG
Sbjct:   347 FGESFTIYDQDGTQPISTMIASITHDAQGVVTCLDETRHGFNDGDYVTFSEVQGMQELNG 406

Query:   265 IEPRKVKVLGPYTFSIGDTTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFA 324
              +P K+ VLGPYTFSIGDT+KF EY SGG+ATQVK PK + F PL +A ++PEF+++DFA
Sbjct:   407 CQPLKITVLGPYTFSIGDTSKFGEYKSGGVATQVKMPKTISFKPLAQATEEPEFLISDFA 466

Query:   325 KFESPANLHVAFSTLHNFVKSF-GYAPKPWNSADADQFLALAKESKLNNGELDEKLLQLF 383
             K +SPA LHVAF+ L  + K+  G  P+PWN  DA+ FL + + S  +N E+DEKL+  F
Sbjct:   467 KLDSPATLHVAFNALSCYRKAHNGALPRPWNEEDANSFLEVVRAS--SNAEVDEKLVLQF 524

Query:   384 AKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECID-ENIAETDAIVNG 442
             AK  +GN  P++A +GGIVAQEV+KACSGKF PI+QWLYFDA+EC+  E + E DA   G
Sbjct:   525 AKICSGNTCPLDAAVGGIVAQEVLKACSGKFTPIYQWLYFDALECLPTEGVEEADAQPVG 584

Query:   443 SRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLI 502
             SRY+ Q+AIFGK FQEKL   K+F+VGAGAIGCELLKNF M+G+G G  GQIFVTDMDLI
Sbjct:   585 SRYDSQIAIFGKKFQEKLADSKWFIVGAGAIGCELLKNFGMLGLGTG-NGQIFVTDMDLI 643

Query:   503 EKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESL 562
             EKSNLNRQFLFRPHDVQ+PKS TAA AIK MNP VN+T +E RVG ETEKV+ + FF  L
Sbjct:   644 EKSNLNRQFLFRPHDVQKPKSMTAADAIKRMNPEVNVTAYELRVGAETEKVFSEDFFGKL 703

Query:   563 DGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKS 622
             DG+ANALDNV+ARIYMDR+C+++R PL+E+GTLGT GN QV+VP  TESYSSSQDPPEKS
Sbjct:   704 DGVANALDNVDARIYMDRKCIFNRIPLVETGTLGTLGNVQVIVPFATESYSSSQDPPEKS 763

Query:   623 IPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEML 682
             IPICTLKNFPNAIEHTLQWARD FEG+F+QSAENAA+Y+ DP F ER+ KLPG QPLE+L
Sbjct:   764 IPICTLKNFPNAIEHTLQWARDAFEGVFKQSAENAAQYIADPQFTERIAKLPGIQPLEIL 823

Query:   683 ENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRC 742
             +++K AL+D++P +   CV WAR +W+DQY NQI+QLLFNFPP+Q+TSSGQPFWSGPKRC
Sbjct:   824 DSIKKALIDDKPKSFAHCVEWARLYWEDQYVNQIKQLLFNFPPDQITSSGQPFWSGPKRC 883

Query:   743 PKPLEFDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIA 802
             P PL FDV DP+HL +IY  ANL+AE+YGI QVRN + IA++V++V VPEF P+SGV I 
Sbjct:   884 PDPLVFDVNDPMHLDFIYAAANLRAEVYGIEQVRNRETIAELVQKVKVPEFKPRSGVKIE 943

Query:   803 VTDAQLQNS-----NGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIV 857
               +A    S     +G+ DQDR+ ++ +EL    + +   ITPLEFEKDDD+NLHMDFIV
Sbjct:   944 TNEAAAAASANNFDDGELDQDRVDKIISELLKNAD-KSSKITPLEFEKDDDSNLHMDFIV 1002

Query:   858 AASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHV--RALVFEL 915
             A SNLRAANY I PADRH SKLIAGKIIPAIATTTSV++GL   + I+  V  R LV   
Sbjct:  1003 ACSNLRAANYKIPPADRHKSKLIAGKIIPAIATTTSVLSGLAVLEVIKLIVGHRDLV--- 1059

Query:   916 CCQDESGEDVETTIVAVVAYCWSKGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNE 975
               + ++G       +  +A+     A K  YY  EWTLWDRFE+  E++L++FL+YF+  
Sbjct:  1060 --KFKNG--FANLALPFMAFSEPLPAAKNTYYGKEWTLWDRFEVTGELSLQEFLNYFEEN 1115

Query:   976 HKLEITIL 983
              KL+IT+L
Sbjct:  1116 EKLKITML 1123
GO:0004839 "ubiquitin activating enzyme activity" evidence=ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=NAS
GO:0016322 "neuron remodeling" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0030425 "dendrite" evidence=IMP
GO:0016567 "protein ubiquitination" evidence=IMP
GO:0043067 "regulation of programmed cell death" evidence=IGI;IMP
GO:0040008 "regulation of growth" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
GO:0019915 "lipid storage" evidence=IDA
GO:0046578 "regulation of Ras protein signal transduction" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
ZFIN|ZDB-GENE-040426-2009 uba1 "ubiquitin-like modifier activating enzyme 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV5 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P22314 UBA1 "Ubiquitin-like modifier-activating enzyme 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1359327 Uba1 "ubiquitin-like modifier activating enzyme 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWX8 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98890 Uba1 "ubiquitin-like modifier activating enzyme 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH5 UBA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7GRY0 UBA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98891 Uba1y "ubiquitin-activating enzyme, Chr Y" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query986
TIGR014081008 TIGR01408, Ube1, ubiquitin-activating enzyme E1 0.0
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 0.0
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 1e-136
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 2e-80
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 1e-50
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 5e-42
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 8e-42
pfam00899134 pfam00899, ThiF, ThiF family 3e-41
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 6e-40
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 1e-38
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 2e-36
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 2e-34
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 8e-32
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 4e-30
pfam0213466 pfam02134, UBACT, Repeat in ubiquitin-activating ( 4e-25
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 2e-23
pfam1058544 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e 6e-22
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 4e-21
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 2e-19
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 4e-18
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 4e-18
pfam00899134 pfam00899, ThiF, ThiF family 1e-17
pfam09358124 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e 4e-17
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-16
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 3e-16
smart00985128 smart00985, UBA_e1_C, Ubiquitin-activating enzyme 3e-15
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 8e-15
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 1e-14
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 1e-14
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 2e-14
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-13
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 2e-13
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 3e-13
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 3e-13
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 7e-13
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 1e-12
cd01489312 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E 8e-12
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 8e-12
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 8e-12
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 2e-11
PRK08328231 PRK08328, PRK08328, hypothetical protein; Provisio 4e-11
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 5e-11
pfam0213466 pfam02134, UBACT, Repeat in ubiquitin-activating ( 1e-10
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 1e-10
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 5e-10
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 6e-10
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 6e-10
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 6e-10
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 3e-09
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 3e-09
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 1e-08
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 3e-08
PTZ00245287 PTZ00245, PTZ00245, ubiquitin activating enzyme; P 8e-08
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 1e-07
smart00985128 smart00985, UBA_e1_C, Ubiquitin-activating enzyme 3e-07
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 5e-07
PRK15116268 PRK15116, PRK15116, sulfur acceptor protein CsdL; 5e-07
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 9e-07
cd01491286 cd01491, Ube1_repeat1, Ubiquitin activating enzyme 1e-06
cd01492197 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E 4e-06
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 4e-06
cd01485198 cd01485, E1-1_like, Ubiquitin activating enzyme (E 5e-06
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 5e-06
PRK14852989 PRK14852, PRK14852, hypothetical protein; Provisio 5e-06
pfam09358124 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e 1e-05
COG1179263 COG1179, COG1179, Dinucleotide-utilizing enzymes i 2e-05
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 2e-05
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 2e-05
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 2e-05
PRK14851 679 PRK14851, PRK14851, hypothetical protein; Provisio 2e-05
cd01490435 cd01490, Ube1_repeat2, Ubiquitin activating enzyme 7e-05
cd00755231 cd00755, YgdL_like, Family of activating enzymes ( 7e-05
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 2e-04
PRK08223287 PRK08223, PRK08223, hypothetical protein; Validate 2e-04
TIGR03736244 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr 3e-04
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 0.001
cd01493425 cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( 0.002
cd01486307 cd01486, Apg7, Apg7 is an E1-like protein, that ac 0.002
>gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 Back     alignment and domain information 
 Score = 1089 bits (2818), Expect = 0.0
 Identities = 459/958 (47%), Positives = 609/958 (63%), Gaps = 42/958 (4%)

Query: 52  DIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATS 111
           +IDE LYSRQLYVLG +AM++MA S+VLISG+GGLG+EIAKN++L+GVKSVTLHDT    
Sbjct: 1   EIDEALYSRQLYVLGDEAMQKMAKSNVLISGMGGLGLEIAKNLVLAGVKSVTLHDTEKCQ 60

Query: 112 LSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNST 171
             DLSS F+LSE DVGRNRAE     L++LNPYV   + +   +E F+ KF+ VVLT  +
Sbjct: 61  AWDLSSNFFLSEDDVGRNRAEAVVKKLAELNPYVHVSSSSVPFNEEFLDKFQCVVLTEMS 120

Query: 172 YDEQLAISQITHAN--DIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTR 229
              Q  I+   H+    IA I AD RGLF  +FCDFG+ F V+DT GE P +  IA +T+
Sbjct: 121 LPLQKEINDFCHSQCPPIAFISADVRGLFGSLFCDFGDEFEVLDTDGEEPKTGFIASITQ 180

Query: 230 EAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEY 289
              G+VTCL+  RH  E GD+VTF EV GMT LN   PRK+ V+ PY+FSIGDTT+   Y
Sbjct: 181 ANPGIVTCLENHRHKLETGDFVTFREVNGMTGLNDGSPRKITVISPYSFSIGDTTELGPY 240

Query: 290 VSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYA 349
           + GGIATQVK PK + F  L E L+ P+ ++ DF+K E P  +H AF  L  F + +   
Sbjct: 241 LHGGIATQVKTPKTVFFKSLREQLKDPKCLIVDFSKPERPPEIHTAFQALDQFQEKYSRK 300

Query: 350 PKPWNSADADQFLALAKESKLNNG------ELDEKLLQLFAKTAAGNCNPVNAVIGGIVA 403
           P      DA++ L LA    ++        ++D KL+   + TA G  +P+ A +GG+V+
Sbjct: 301 PNVGCQQDAEELLKLAT--SISETLEEKVPDVDAKLVHWLSWTAQGFLSPMAAAVGGVVS 358

Query: 404 QEVMKACSGKFHPIFQWLYFDAVECIDENIA--ETDAIVNGSRYEGQVAIFGKNFQEKLG 461
           QEV+KA +GKF P+ QW YFD+ E +         + +  G RY+ Q+A+FG  FQ+KL 
Sbjct: 359 QEVLKAVTGKFSPLCQWFYFDSAESLPSLGKPECEEFLPRGDRYDAQIAVFGDTFQQKLQ 418

Query: 462 KLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQP 521
            L  F+VG GAIGCE+LKNFA+MGVG G  G I VTD DLIEKSNLNRQFLFRPH + +P
Sbjct: 419 NLNIFLVGCGAIGCEMLKNFALMGVGTGKKGMITVTDPDLIEKSNLNRQFLFRPHHIGKP 478

Query: 522 KSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRR 581
           KS TAA A   +NP + I  H+NRVGPETE +++D F+E LD + NALDNVEAR Y+D R
Sbjct: 479 KSYTAADATLKINPQIKIDAHQNRVGPETETIFNDEFYEKLDVVINALDNVEARRYVDSR 538

Query: 582 CVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQW 641
           C+   KPLLESGTLGTKGN+QVVVPHLTESY SS+DPPEK IP CTLK+FP AIEHT+QW
Sbjct: 539 CLAFLKPLLESGTLGTKGNTQVVVPHLTESYGSSRDPPEKEIPFCTLKSFPAAIEHTIQW 598

Query: 642 ARDNFEGIFRQSAENAAEYLEDPN-FVERVMKLPGSQPLEMLENVKHALVDERPLNIKDC 700
           ARD FEG+F        +YL  P+   E + K+      E LE +   L  E+P N   C
Sbjct: 599 ARDKFEGLFSHKPSLVNKYLSSPSSAEEVLQKIQSGHSREGLEQIIKLLSKEKPRNFSQC 658

Query: 701 VAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLHLQYIY 760
           V WAR  ++  +NN+  QLL  FP +  TS+G PFWS PKR P PL+FD+ +PLHL +I 
Sbjct: 659 VEWARLKFEKYFNNKALQLLHCFPLDIRTSTGSPFWSSPKRPPSPLKFDLNEPLHLSFIQ 718

Query: 761 TGANLKAELYGIP---QVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTD-AQLQNSNGDYD 816
             A L A +YGIP   +  + DA+  ++ +V +PEF P+S   I   + A+  ++  + D
Sbjct: 719 AAAKLYATVYGIPFAEEDLSADALLNILSEVKIPEFKPRSNKKIQTDETARKPDTAPEDD 778

Query: 817 QDRLGQLKNELPSIQELQG-LHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRH 875
           ++ + QL+  + S +  +    + PL FEKDDD N H+DFI AASNLRA NY I PADR 
Sbjct: 779 RNAIFQLEKAILSNEATKSDFRMAPLSFEKDDDHNGHIDFITAASNLRAKNYSIEPADRF 838

Query: 876 TSKLIAGKIIPAIATTTSVVAGLVS---------KKKIEPHVRALVFELCCQDESGEDVE 926
            +K IAGKIIPAIAT+T+ V+GLV            K E + +     L           
Sbjct: 839 KTKFIAGKIIPAIATSTATVSGLVCLELIKVTDGGYKFEVY-KNCFLNLA---------- 887

Query: 927 TTIVAVVAYCWSKGAPKLKYYDVEW-TLWDRFEINQEMTLKQFLDYFQNEHKLEITIL 983
              + +  +       K K  +    T+WDR+ ++ + TL +F++  + ++ LE T++
Sbjct: 888 ---IPLFVFTEPTEVRKTKIRNGISFTIWDRWTLHGDFTLLEFINAVKEKYGLEPTMV 942

This model represents the full length, over a thousand amino acids, of a multicopy family of eukaryotic proteins, many of which are designated ubiquitin-activating enzyme E1. Members have two copies of the ThiF family domain (pfam00899), a repeat found in ubiquitin-activating proteins (pfam02134), and other regions. Length = 1008
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|220201 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|214955 smart00985, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>gnl|CDD|140272 PTZ00245, PTZ00245, ubiquitin activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|214955 smart00985, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|220201 pfam09358, UBA_e1_C, Ubiquitin-activating enzyme e1 C-terminal domain Back     alignment and domain information
>gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 986
KOG2012|consensus1013 100.0
TIGR014081008 Ube1 ubiquitin-activating enzyme E1. This model re 100.0
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 100.0
KOG2013|consensus 603 100.0
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 100.0
KOG2014|consensus331 100.0
KOG2015|consensus422 100.0
KOG2016|consensus523 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
PRK08223287 hypothetical protein; Validated 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK08328231 hypothetical protein; Provisional 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
KOG2017|consensus427 100.0
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.98
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 99.98
PRK08223287 hypothetical protein; Validated 99.98
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 99.98
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 99.97
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.97
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 99.97
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 99.97
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.97
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.97
PRK07411390 hypothetical protein; Validated 99.97
PRK14851 679 hypothetical protein; Provisional 99.97
PRK14852 989 hypothetical protein; Provisional 99.97
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 99.97
PRK08328231 hypothetical protein; Provisional 99.97
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.97
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 99.97
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.97
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.96
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 99.96
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.96
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 99.96
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 99.96
PRK07877722 hypothetical protein; Provisional 99.96
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.96
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.95
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.95
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.95
TIGR014081008 Ube1 ubiquitin-activating enzyme E1. This model re 99.95
PRK14852989 hypothetical protein; Provisional 99.95
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.95
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 99.95
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.95
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 99.95
KOG2017|consensus427 99.94
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.94
PRK14851679 hypothetical protein; Provisional 99.94
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.94
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.94
KOG2013|consensus603 99.94
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.94
PTZ00245287 ubiquitin activating enzyme; Provisional 99.94
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.94
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.93
cd01490435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.93
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 99.93
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.93
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.92
KOG2018|consensus430 99.91
PTZ00245287 ubiquitin activating enzyme; Provisional 99.91
PRK07877722 hypothetical protein; Provisional 99.91
KOG2015|consensus422 99.91
KOG2014|consensus331 99.91
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 99.9
PRK06153393 hypothetical protein; Provisional 99.9
KOG2016|consensus523 99.89
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 99.89
KOG2336|consensus422 99.89
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.89
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 99.87
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.87
KOG2018|consensus430 99.83
PRK06153393 hypothetical protein; Provisional 99.82
KOG2012|consensus1013 99.81
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 99.8
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.78
KOG2336|consensus422 99.69
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 99.54
PF1058545 UBA_e1_thiolCys: Ubiquitin-activating enzyme activ 99.52
PF09358125 UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina 99.5
KOG2337|consensus669 99.46
KOG2337|consensus669 99.36
TIGR03693637 ocin_ThiF_like putative thiazole-containing bacter 99.2
PF0213467 UBACT: Repeat in ubiquitin-activating (UBA) protei 98.45
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 98.27
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 97.9
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.64
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.57
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.36
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.33
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.31
PRK06719157 precorrin-2 dehydrogenase; Validated 97.22
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.22
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.2
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.19
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.19
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.19
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.19
PRK05562223 precorrin-2 dehydrogenase; Provisional 97.14
PRK06719157 precorrin-2 dehydrogenase; Validated 97.03
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.93
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.71
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.51
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 96.31
PRK10637457 cysG siroheme synthase; Provisional 96.25
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.22
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.17
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 95.79
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.65
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.62
PRK13940414 glutamyl-tRNA reductase; Provisional 95.56
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.52
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.49
PRK04148134 hypothetical protein; Provisional 95.43
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.42
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.37
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.35
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.32
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.2
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.19
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.18
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.12
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.08
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 95.04
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.01
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.01
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.0
PRK10637457 cysG siroheme synthase; Provisional 94.87
PRK04148134 hypothetical protein; Provisional 94.82
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.81
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.71
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.68
PRK13940414 glutamyl-tRNA reductase; Provisional 94.68
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.56
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.51
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 94.51
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.42
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.35
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 94.32
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.28
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 94.12
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 94.1
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.04
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.01
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.93
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 93.85
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.84
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.77
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.65
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 93.59
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 93.55
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 93.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.52
PLN00203519 glutamyl-tRNA reductase 93.47
KOG4169|consensus261 93.45
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 93.43
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 93.39
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 93.34
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 93.28
PLN02602350 lactate dehydrogenase 93.24
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 93.19
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.18
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 93.17
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 93.16
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 93.14
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.05
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.03
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 92.88
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.57
PTZ00082321 L-lactate dehydrogenase; Provisional 92.56
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 92.55
PRK07063260 short chain dehydrogenase; Provisional 92.51
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 92.49
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 92.49
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 92.45
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 92.43
PRK06197306 short chain dehydrogenase; Provisional 92.37
PF1058545 UBA_e1_thiolCys: Ubiquitin-activating enzyme activ 92.35
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 92.33
PRK00048257 dihydrodipicolinate reductase; Provisional 92.3
PLN02206442 UDP-glucuronate decarboxylase 92.26
PRK05854313 short chain dehydrogenase; Provisional 92.23
PLN03209576 translocon at the inner envelope of chloroplast su 92.21
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.2
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 92.2
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 92.17
KOG4169|consensus261 92.14
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.07
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 92.06
PRK05479330 ketol-acid reductoisomerase; Provisional 91.99
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 91.96
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 91.93
PRK05708305 2-dehydropantoate 2-reductase; Provisional 91.87
COG0300265 DltE Short-chain dehydrogenases of various substra 91.78
PLN00203519 glutamyl-tRNA reductase 91.76
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 91.75
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 91.7
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 91.7
PTZ00117319 malate dehydrogenase; Provisional 91.65
PRK13403335 ketol-acid reductoisomerase; Provisional 91.6
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 91.56
PRK11730715 fadB multifunctional fatty acid oxidation complex 91.56
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.49
PLN02206442 UDP-glucuronate decarboxylase 91.47
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 91.45
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 91.37
PRK09496453 trkA potassium transporter peripheral membrane com 91.34
PRK11908347 NAD-dependent epimerase/dehydratase family protein 91.34
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.15
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.1
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 91.09
PRK09242257 tropinone reductase; Provisional 91.06
PTZ00082321 L-lactate dehydrogenase; Provisional 91.04
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 91.02
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.01
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.01
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.99
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 90.96
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.85
PRK11154708 fadJ multifunctional fatty acid oxidation complex 90.78
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 90.77
PRK06141314 ornithine cyclodeaminase; Validated 90.76
PLN02166436 dTDP-glucose 4,6-dehydratase 90.61
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 90.52
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 90.52
PRK08618325 ornithine cyclodeaminase; Validated 90.52
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 90.48
PRK08618325 ornithine cyclodeaminase; Validated 90.44
PRK09496453 trkA potassium transporter peripheral membrane com 90.34
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.33
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 90.31
PLN02427386 UDP-apiose/xylose synthase 90.26
PRK07340304 ornithine cyclodeaminase; Validated 90.09
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 90.06
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 90.04
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 90.02
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 90.02
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 90.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.99
PRK07062265 short chain dehydrogenase; Provisional 89.99
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.97
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.91
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 89.89
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 89.84
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 89.83
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 89.8
PLN02602350 lactate dehydrogenase 89.76
PLN02780320 ketoreductase/ oxidoreductase 89.73
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 89.68
PTZ00325321 malate dehydrogenase; Provisional 89.63
PRK07502307 cyclohexadienyl dehydrogenase; Validated 89.62
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 89.6
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 89.5
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 89.43
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 89.42
PLN02240352 UDP-glucose 4-epimerase 89.36
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.35
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.33
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 89.33
PRK12550272 shikimate 5-dehydrogenase; Reviewed 89.32
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 89.22
PLN02166436 dTDP-glucose 4,6-dehydratase 89.21
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 89.19
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 89.11
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.09
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 89.07
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 89.05
PRK07831262 short chain dehydrogenase; Provisional 89.05
PRK00048257 dihydrodipicolinate reductase; Provisional 89.02
PTZ00431260 pyrroline carboxylate reductase; Provisional 89.01
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 88.95
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 88.92
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.92
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 88.89
PRK03562621 glutathione-regulated potassium-efflux system prot 88.89
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 88.88
PRK13403335 ketol-acid reductoisomerase; Provisional 88.87
PRK06487317 glycerate dehydrogenase; Provisional 88.86
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.85
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 88.85
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 88.84
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 88.77
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 88.72
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 88.65
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 88.65
PRK06932314 glycerate dehydrogenase; Provisional 88.63
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 88.61
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 88.48
PRK12550272 shikimate 5-dehydrogenase; Reviewed 88.48
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 88.44
PRK08251248 short chain dehydrogenase; Provisional 88.44
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 88.41
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 88.4
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 88.33
PTZ00431260 pyrroline carboxylate reductase; Provisional 88.29
PRK08655437 prephenate dehydrogenase; Provisional 88.23
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 88.16
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 88.15
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.14
PRK07576264 short chain dehydrogenase; Provisional 88.12
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 88.12
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 88.11
PLN03139386 formate dehydrogenase; Provisional 88.1
PRK07417279 arogenate dehydrogenase; Reviewed 88.04
PRK05479330 ketol-acid reductoisomerase; Provisional 88.02
PRK06197306 short chain dehydrogenase; Provisional 88.01
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 87.92
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 87.86
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 87.77
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.77
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 87.74
PRK05708305 2-dehydropantoate 2-reductase; Provisional 87.73
PRK05875276 short chain dehydrogenase; Provisional 87.73
PRK13302271 putative L-aspartate dehydrogenase; Provisional 87.68
PRK07680273 late competence protein ComER; Validated 87.68
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 87.66
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 87.65
PRK08339263 short chain dehydrogenase; Provisional 87.65
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 87.54
PRK09186256 flagellin modification protein A; Provisional 87.47
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 87.34
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.33
PLN02253280 xanthoxin dehydrogenase 87.29
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 87.24
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 87.2
KOG0069|consensus336 87.17
PRK06141314 ornithine cyclodeaminase; Validated 87.17
PRK08291330 ectoine utilization protein EutC; Validated 87.03
PRK05867253 short chain dehydrogenase; Provisional 87.03
PRK07478254 short chain dehydrogenase; Provisional 87.01
PRK07523255 gluconate 5-dehydrogenase; Provisional 86.96
PRK05866293 short chain dehydrogenase; Provisional 86.91
PRK11908347 NAD-dependent epimerase/dehydratase family protein 86.91
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 86.9
PRK06194287 hypothetical protein; Provisional 86.88
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 86.87
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.85
PRK13304265 L-aspartate dehydrogenase; Reviewed 86.85
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 86.83
PRK08291330 ectoine utilization protein EutC; Validated 86.82
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 86.79
PRK03659601 glutathione-regulated potassium-efflux system prot 86.75
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 86.74
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.73
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 86.69
PLN02427386 UDP-apiose/xylose synthase 86.66
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 86.65
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.59
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.57
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 86.54
PRK06223307 malate dehydrogenase; Reviewed 86.51
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 86.49
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 86.43
PRK06436303 glycerate dehydrogenase; Provisional 86.39
PRK12921305 2-dehydropantoate 2-reductase; Provisional 86.38
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 86.34
PRK06523260 short chain dehydrogenase; Provisional 86.33
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 86.2
PLN02695370 GDP-D-mannose-3',5'-epimerase 86.18
PRK06138252 short chain dehydrogenase; Provisional 86.17
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 86.17
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 86.12
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 86.0
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 85.9
PRK07340304 ornithine cyclodeaminase; Validated 85.89
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 85.87
PLN02240352 UDP-glucose 4-epimerase 85.85
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 85.84
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 85.78
PRK06139330 short chain dehydrogenase; Provisional 85.7
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 85.58
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 85.55
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 85.55
PRK12367245 short chain dehydrogenase; Provisional 85.53
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 85.52
PLN02653340 GDP-mannose 4,6-dehydratase 85.4
PRK06567 1028 putative bifunctional glutamate synthase subunit b 85.37
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 85.37
PRK03659601 glutathione-regulated potassium-efflux system prot 85.35
PRK12939250 short chain dehydrogenase; Provisional 85.33
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 85.33
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 85.25
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 85.21
PRK06249313 2-dehydropantoate 2-reductase; Provisional 85.21
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 85.21
PLN00016378 RNA-binding protein; Provisional 85.18
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 85.15
PLN03209576 translocon at the inner envelope of chloroplast su 85.14
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 85.07
PLN02896353 cinnamyl-alcohol dehydrogenase 85.05
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 84.98
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 84.95
PRK12829264 short chain dehydrogenase; Provisional 84.94
PLN02214342 cinnamoyl-CoA reductase 84.91
PRK06125259 short chain dehydrogenase; Provisional 84.91
PRK06249313 2-dehydropantoate 2-reductase; Provisional 84.85
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 84.83
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 84.83
PRK05854313 short chain dehydrogenase; Provisional 84.75
PRK03562621 glutathione-regulated potassium-efflux system prot 84.73
PRK06172253 short chain dehydrogenase; Provisional 84.72
PRK13304265 L-aspartate dehydrogenase; Reviewed 84.68
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 84.67
PRK06940275 short chain dehydrogenase; Provisional 84.65
PRK08229341 2-dehydropantoate 2-reductase; Provisional 84.57
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 84.53
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 84.49
PLN02688266 pyrroline-5-carboxylate reductase 84.43
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.43
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.42
PTZ00117319 malate dehydrogenase; Provisional 84.42
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 84.41
PLN00106323 malate dehydrogenase 84.4
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 84.34
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 84.33
PRK05442326 malate dehydrogenase; Provisional 84.22
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 84.18
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 84.17
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 84.16
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 84.13
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 84.12
PRK12480330 D-lactate dehydrogenase; Provisional 84.1
PRK07453322 protochlorophyllide oxidoreductase; Validated 84.06
PRK15076431 alpha-galactosidase; Provisional 84.05
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 84.02
PRK08374336 homoserine dehydrogenase; Provisional 83.96
PRK07814263 short chain dehydrogenase; Provisional 83.96
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 83.94
PRK10669558 putative cation:proton antiport protein; Provision 83.93
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 83.92
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 83.88
KOG1205|consensus282 83.81
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 83.77
PRK13529563 malate dehydrogenase; Provisional 83.7
PRK14982340 acyl-ACP reductase; Provisional 83.67
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 83.65
PRK07102243 short chain dehydrogenase; Provisional 83.63
PRK07063260 short chain dehydrogenase; Provisional 83.6
PRK07067257 sorbitol dehydrogenase; Provisional 83.57
PLN02383344 aspartate semialdehyde dehydrogenase 83.51
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 83.5
PRK06181263 short chain dehydrogenase; Provisional 83.5
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 83.48
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.48
PRK12827249 short chain dehydrogenase; Provisional 83.43
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 83.42
PRK15059292 tartronate semialdehyde reductase; Provisional 83.4
PRK09242257 tropinone reductase; Provisional 83.4
PLN03129581 NADP-dependent malic enzyme; Provisional 83.33
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 83.31
PLN02650351 dihydroflavonol-4-reductase 83.31
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 83.26
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 83.25
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 83.25
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 83.22
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 83.22
PTZ00317559 NADP-dependent malic enzyme; Provisional 83.2
PRK13302271 putative L-aspartate dehydrogenase; Provisional 83.18
PRK13243333 glyoxylate reductase; Reviewed 83.16
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 83.15
PRK05872296 short chain dehydrogenase; Provisional 83.14
PLN02494477 adenosylhomocysteinase 83.12
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 83.11
PRK05876275 short chain dehydrogenase; Provisional 83.1
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 83.09
CHL00194317 ycf39 Ycf39; Provisional 83.03
PRK10537393 voltage-gated potassium channel; Provisional 82.94
PRK00676338 hemA glutamyl-tRNA reductase; Validated 82.92
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 82.89
KOG0069|consensus336 82.84
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 82.84
PLN02572442 UDP-sulfoquinovose synthase 82.81
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 82.77
PRK06720169 hypothetical protein; Provisional 82.69
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 82.62
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 82.6
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 82.58
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 82.5
COG0300265 DltE Short-chain dehydrogenases of various substra 82.49
>KOG2012|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.1e-243  Score=2051.85  Aligned_cols=931  Identities=60%  Similarity=0.994  Sum_probs=903.3

Q ss_pred             CCCCCCCchhhhhhccccchhcccHHHHHHhhcCcEEEEcCChhHHHHHHHHHHhCCCeEEEEeCCCCCccCCCcccccC
Q psy7300          43 GSSATAMDQDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLS  122 (986)
Q Consensus        43 ~~~~~~~~~~i~~~~y~Rqi~l~G~~~q~kL~~s~VlIiG~gglGseiaknLvl~GVg~itlvD~d~V~~sdl~rqf~~~  122 (986)
                      .|....++.+||+++||||++++|.++|+||..++|||.||+|||.||||||+|+||+++||+|...+.++||+.|||++
T Consensus         5 ~~~~~~a~~~IDE~LYSRQLYVlG~eAM~~m~~S~VLisGl~GLGvEIAKNliLaGVksvTlhD~~~~~~~DLssqf~L~   84 (1013)
T KOG2012|consen    5 MMDGNSASQEIDESLYSRQLYVLGHEAMRRMQGSNVLISGLQGLGVEIAKNLILAGVKSVTLHDPRPVQLSDLSSQFYLS   84 (1013)
T ss_pred             ccccCcchhhhhhhhhhhhhhhccHHHHHHHhhCcEEEecCCcccHHHHhhHhhhccceEEeeCCCcccHHhhccceeee
Confidence            34455567899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccCchHHHHHHHHHhhcCCCCEEEeecCCCCHhhhccccEEEEecCCHHHHHHHHHHHHHcCCcEEEeecccceEEEE
Q psy7300         123 EKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNSTYDEQLAISQITHANDIALIIADTRGLFAQVF  202 (986)
Q Consensus       123 ~~diGk~Ka~a~~~~L~~lNp~V~v~~~~~~~~~~~l~~~dvVI~~~~~~~~~~~i~~~c~~~~ip~I~~~~~G~~G~vf  202 (986)
                      ++|||++||+++.++|++||++|.|.++++.++++++++|++||.|..+.+.+.+|+++||+++|.||.+.++|++|++|
T Consensus        85 E~DigknRA~as~~~LaeLN~yV~V~v~t~~~~~e~L~~FqvVVlt~~~le~q~~i~~fch~~~i~fi~ad~RGLfg~lF  164 (1013)
T KOG2012|consen   85 EEDIGKNRAEASVEKLAELNNYVPVVVLTGPLTEEFLSDFQVVVLTDASLEEQLKINDFCHSHGIAFIAADTRGLFGQLF  164 (1013)
T ss_pred             HHhcCCchHHHHHHHHHHhhcceeeEEecCcccHHHHhCCcEEEEecCchHHHHHHHHHHHhcCeEEEEeccchhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecCCceEEEcCCCCCCceeEEeceecccCcccccccccccCCCCCceEEEEeeccccccCCCCCeeeEEeCceeeecCC
Q psy7300         203 CDFGNNFTVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGD  282 (986)
Q Consensus       203 ~d~g~~f~v~~~~~e~p~~~~i~~i~~~~~~~v~~~~~~~h~~~~gd~v~f~ev~g~~~~n~~~~~~i~~~~~~~~~i~d  282 (986)
                      ||||++|+|.|++|+.|.+.+|++|+++++|+|+|+++.+|++++||.|+|+|++||.++|+|+|++|++++|++|+|+|
T Consensus       165 CDFG~eF~v~D~tGeeP~t~mI~~Is~d~pGvvT~ld~~rH~lEdGd~V~FsEveGm~eLN~~~P~kI~v~~p~sf~Igd  244 (1013)
T KOG2012|consen  165 CDFGEEFTVLDPTGEEPLTGMIASISQDNPGVVTCLDGARHGFEDGDLVTFSEVEGMTELNDCKPRKITVLGPYSFSIGD  244 (1013)
T ss_pred             ccCCCceEEeCCCCCcchhhHHhhccCCCCceEEEecCccccCccCCEEEEEeeccccccCCCCceEEEEecCceEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccceecceeeEecCCccccCCChHhhhcCCccccccccccCCchhHHHHHHHHHHHHHHhCCCCCCCCHHhHHHHH
Q psy7300         283 TTKFDEYVSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSFGYAPKPWNSADADQFL  362 (986)
Q Consensus       283 ~~~f~~y~~gg~~~qvk~p~~i~f~sL~~~l~~p~~~~~d~~k~~~~~~l~~~~~al~~F~~~~gr~P~~~~~~D~~~~~  362 (986)
                      ++.|.+|..||+++|||+|++++|+||+++|.+|+++.+|+.|+++|.++|++|+||++|.+.|||+|.||+++|+++|+
T Consensus       245 t~~f~~y~~GGi~tQVK~Pk~isfKsL~~~L~~P~fl~~df~k~~rp~~lH~af~AL~~F~~~~Gr~P~p~~e~DA~~l~  324 (1013)
T KOG2012|consen  245 TTEFGEYKKGGIFTQVKVPKTISFKSLREALKEPEFLISDFAKFDRPPQLHLAFQALHQFQEAHGRLPRPGNEEDAEELV  324 (1013)
T ss_pred             ccchhhhhcCceeEEeecCceEecccHHHhhcCCCeeeeccccccccHHHHHHHHHHHHHHHHhCCCCCCCChhhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhh---cCCCccHHHHHHHHHhhcCCCCchhhhhhchhHHHHHHhhhCCCccccccccccchhhhcc---ccccc
Q psy7300         363 ALAKESKL---NNGELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDE---NIAET  436 (986)
Q Consensus       363 ~l~~~~~~---~~~~ide~lv~~~~~~~~~el~pvaA~iGGi~AQEvIKaiT~kf~Pi~q~~~fD~~e~l~~---~~~~~  436 (986)
                      +++.++.+   ..+++++++|++|+..+++.|.||+|++||+|||||+|++||||+||.||||||+.|+|++   +++++
T Consensus       325 ~l~~~i~~~~~~~~~vde~Lir~~s~~a~g~L~pm~A~~GG~vaQEvlKa~sgKF~PL~Q~lYfDale~LP~d~~~~~e~  404 (1013)
T KOG2012|consen  325 ELARDISEGLGLEEDVDEKLIRHFSFSARGDLNPMVAFFGGIVAQEVLKACSGKFTPLKQWLYFDALESLPSDNLPPSEE  404 (1013)
T ss_pred             HHHHHhhhhccccccchHHHHHHHHHhhccCcchHHHHHhhhhHHHHHHhhccCccchhHheehhhHhhCCCcCCCCCHH
Confidence            99999876   2458999999999999999999999999999999999999999999999999999999964   68899


Q ss_pred             ccccccCccchhhhccCHHHHHHHhcCcEEEEecChhhHHHHHHHHHcCCCcCCCCeEEEEeCCccccccCccccCcCCC
Q psy7300         437 DAIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPH  516 (986)
Q Consensus       437 ~~~~~~~rydrqi~~~G~~~q~~L~~~~VlvvGaGgiG~e~lknLa~~Gv~~g~~g~i~ivD~D~Ie~sNLnRqflf~~~  516 (986)
                      +|+|+++|||.||++||...|+||.++++++|||||||||+|||+|+||+|||..|.|+|+|||.||.||||||||||+.
T Consensus       405 d~~prgsRYD~qiavfG~~fqeKL~~~~~FlVGaGAIGCE~LKN~am~Gvg~g~~g~ItVTDmD~IEkSNLnRQFLFR~~  484 (1013)
T KOG2012|consen  405 DCQPRGSRYDGQIAVFGAKFQEKLADQKVFLVGAGAIGCELLKNFALMGVGCGNSGKITVTDMDHIEKSNLNRQFLFRPW  484 (1013)
T ss_pred             HcccccCccccchhhhchHHHHHHhhCcEEEEccchhhHHHHHhhhheeeccCCCCceEEeccchhhhccccceeecccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHHHHhhCCCceEEEEEcccCCccccccccccccCCCEEEEcCCCHHHHHHHHHHHHHcCCcEEEEeecC
Q psy7300         517 DVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTLG  596 (986)
Q Consensus       517 diG~~Ka~~a~~~l~~~np~~~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~a~Dn~~ar~~l~~~c~~~~~pli~~g~~G  596 (986)
                      |||++|+++|++++..|||+++|+++..++++++|.+|+++||++.|+|.+|+||++||+|++++|+.+.+||+++||.|
T Consensus       485 dVgk~KSe~AA~A~~~mNp~l~I~a~~~rvgpeTE~If~D~Ff~~ld~VanALDNVdAR~YvD~RCv~~~kPLLESGTlG  564 (1013)
T KOG2012|consen  485 DVGKPKSEVAAAAARGMNPDLNIIALQNRVGPETEHIFNDEFFENLDGVANALDNVDARRYVDRRCVYYRKPLLESGTLG  564 (1013)
T ss_pred             ccCchHHHHHHHHHHhcCCCceeeehhhccCcccccccchhHHhhhHHHHHhhcchhhhhhhhhhhhhhccchhhccCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcceEEEEeCCCCccccCCCCCCCCCCCcccccCCCCcchhhHHHHHHHhhhHhhhhHHHHHhhhCChhHHHHhhcCCCC
Q psy7300         597 TKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGS  676 (986)
Q Consensus       597 ~~G~v~~~~p~~t~cy~c~~~~~~~~~p~Ctl~~~P~~~~h~i~wa~~~F~~~F~~~~~~~~~~l~~~~~~~~~~~~~~~  676 (986)
                      ++|++|+++|+.|++|++++|||++++|+||+++||+.++|||+|||+.||++|.++++++|+||++|.|.++.++..+.
T Consensus       565 TKGntQVvvPhlTEsY~SS~DPPEksiP~CTlknFPn~IeHTiqWAR~eFEg~F~~~~e~vN~yls~p~f~e~sl~~~~~  644 (1013)
T KOG2012|consen  565 TKGNTQVVVPHLTESYGSSRDPPEKSIPVCTLKSFPNAIEHTIQWARDEFEGLFKQSAENVNKYLSDPVFYETSLKLIGE  644 (1013)
T ss_pred             CccceeEEeccccccccccCCCcccCCceeeeccCchHHHHHHHHHHHHHHHHhhCCHHHHHHHhcCchHHHHHHhhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998888776665


Q ss_pred             Cc-hhhHHHHHHhhhccCCCChhHhHHHHHHHHHHHHHHHHHHHHhcCCcccccCCCCCCcCCCCCCCCccccCCCCCcc
Q psy7300         677 QP-LEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLH  755 (986)
Q Consensus       677 ~~-~~~l~~~~~~l~~~~p~~~~~c~~~a~~~f~~~F~~~I~~ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~~~~~h  755 (986)
                      ++ ++.|+.+.+.|. .+|.+|++|++|||..|+++|+++|+|||++||+|.+|++|+||||||||||+|++||.+|++|
T Consensus       645 ~~~~~~l~~v~~~l~-~rp~~~~dCv~warl~f~~~f~~~ikqLl~~FP~d~~t~~G~pFWs~pKr~P~pl~Fd~n~~~h  723 (1013)
T KOG2012|consen  645 PQSLETLERVVDCLS-ERPQNWQDCVEWARLHFEKYFHNRIKQLLHNFPPDAKTSDGAPFWSGPKRCPRPLEFDVNDPLH  723 (1013)
T ss_pred             cchhHHHHHHHHHhh-cCCccHHHHHHHHHHHHHHHhhHHHHHhhcCCCcccccCCCCcCCCCCCCCCCceeecCCCchh
Confidence            54 589999999998 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHhhhHHHHHHHhCCCCCCcHHHHHHHHhccccCcccCCCCCceecchhhhhccCCCchH-HHHHHHHhhCcchhhcc
Q psy7300         756 LQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQ-DRLGQLKNELPSIQELQ  834 (986)
Q Consensus       756 ~~fi~~~a~l~a~~~~i~~~~d~~~~~~~~~~~~~~~f~~~~~~~i~~~~~~~~~~~~~~d~-~~~~~l~~~l~~~~~~~  834 (986)
                      +.||.+||+|||++|||++..|+..++.+++.+++|+|+|+++++|.+++++....+.++|+ +++.+|...++.++...
T Consensus       724 l~fv~Aaa~l~a~~~gi~~~~d~~~~~~~~~~v~~p~f~P~~~~~i~~~~~~~~~~~~s~d~~~~i~~l~~~l~~~~~~~  803 (1013)
T KOG2012|consen  724 LNFVQAAANLRAEVYGIPGSQDREALAELLERVIVPEFEPKQKVKIVVEEAELAASSASVDDSAAIDQLNKALPSPSVLP  803 (1013)
T ss_pred             HHHHHHHHHHHHHhcCCCcccCHHHhhhhHhhcCCCccccccCCeecccccccccccccCCchHHHHHHhhcccccccCC
Confidence            99999999999999999999999999999999999999999999999999988777777764 58999999999998888


Q ss_pred             CCccccceecccCCCchhhHHHHHHhhhhhhccCCCCCChhhHhhhhCCcccccchhhhHHhhhhhhhhc--cCccccce
Q psy7300         835 GLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKI--EPHVRALV  912 (986)
Q Consensus       835 ~~~~~~~~FeKDDd~n~hidFi~aasNLRa~ny~I~~~~~~~~k~iAG~IIPAiaTTtA~VaGl~~lEl~--~~~~~~~~  912 (986)
                      +++|.|+.||||||+|+|||||+|||||||.||+||++||+++|+|||+||||||||||+|+||+|+|+|  +.|+++++
T Consensus       804 ~~~~~p~~FEKDDDsN~H~dfi~aasnlRA~nY~I~~adr~k~K~IaGkIIPAIATtTa~v~Glv~LElyKv~~G~~~~e  883 (1013)
T KOG2012|consen  804 SFKMKPLDFEKDDDSNFHMDFITAASNLRAQNYSIPPADRLKTKRIAGKIIPAIATTTAAVSGLVCLELYKVVDGKRPVE  883 (1013)
T ss_pred             CCceeeeeeccccccccchHHHHHHhhhhhhccCCCccchhhhheeeeeEEEEEeehhHHHHHHHHhhhhhhccCCCchH
Confidence            8899999999999999999999999999999999999999999999999999999999999999999999  68888899


Q ss_pred             eeccccCCCCCccccce--eeccccccc--CCCCCccccCc-eeeeeeEEEeCCCCCHHHHHHHHHHHcCCeEEEEEe
Q psy7300         913 FELCCQDESGEDVETTI--VAVVAYCWS--KGAPKLKYYDV-EWTLWDRFEINQEMTLKQFLDYFQNEHKLEITILLL  985 (986)
Q Consensus       913 ~~~~~~~~~~~~~rn~f--la~p~~~~~--~~~~~~~~~~~-~~t~wd~~~~~~~~tl~~~~~~~~~~~~~~~~~~~~  985 (986)
                                 .|||+|  ||+|+|.++  .++|+.+++.. +||+||||++.|++||++|++++++++|++|+||++
T Consensus       884 -----------~~Kn~flnLAlp~f~~~ep~~~pk~~~~~~~~~tlWdR~~v~g~~tL~~~L~~~~~~~gl~i~mls~  950 (1013)
T KOG2012|consen  884 -----------AYKNTFLNLALPFFSFAEPLAAPKVQYHNDLSWTLWDRWEVKGEPTLREFLDHLEEQHGLEITMLSQ  950 (1013)
T ss_pred             -----------HhhhhhhcccccceeecccCCCcceeeecccceeeeEEEEecCCCCHHHHHHHHhhhcCceEEEEec
Confidence                       999999  999999999  77788876654 999999999999999999999999999999999985

>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>KOG2014|consensus Back     alignment and domain information
>KOG2015|consensus Back     alignment and domain information
>KOG2016|consensus Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2013|consensus Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>KOG2015|consensus Back     alignment and domain information
>KOG2014|consensus Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2016|consensus Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>KOG2018|consensus Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG2012|consensus Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>KOG2336|consensus Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised Back     alignment and domain information
>KOG2337|consensus Back     alignment and domain information
>KOG2337|consensus Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00317 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query986
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 0.0
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 8e-26
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 3e-08
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 1e-141
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 6e-14
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 1e-113
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 5e-26
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 1e-110
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 2e-94
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 5e-24
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 1e-11
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 3e-92
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 3e-22
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 3e-13
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 9e-64
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 5e-51
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 6e-31
2v31_A112 Ubiquitin-activating enzyme E1 X; ligase, phosphor 3e-51
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 2e-21
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 5e-06
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 9e-21
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 1e-09
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 2e-20
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 7e-09
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 2e-20
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 2e-09
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 3e-20
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-09
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-20
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
 Score =  959 bits (2480), Expect = 0.0
 Identities = 437/959 (45%), Positives = 625/959 (65%), Gaps = 39/959 (4%)

Query: 51  QDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTAT 110
            +IDE LYSRQLYVLG +AM +M +S+VLI GL GLGVEIAKNV+L+GVKS+T+ D    
Sbjct: 3   GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPV 62

Query: 111 SLSDLSSQFYLSEKDVGRNRAEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNS 170
            L+DLS+QF+L+EKD+G+ R +V+   L++LN YV             + +F+VVV T++
Sbjct: 63  QLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDT 122

Query: 171 -TYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNFTVVDTTGENPVSVIIAGVTR 229
            + ++++ I++  H++ I  I ++TRGLF   F D G+ FTV+D TGE P + +++ +  
Sbjct: 123 VSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEEPRTGMVSDIEP 182

Query: 230 EAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEY 289
             +G VT LD+ RHG EDG++V FSEV+G+ +LN     KV+VLGP+ F IG   ++ EY
Sbjct: 183 --DGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEY 240

Query: 290 VSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNF-VKSFGY 348
             GGI T+VK P+ + F  L + L  PEFV +DFAKF+  A LH+ F  LH F V+  G 
Sbjct: 241 KKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGE 300

Query: 349 APKPWNSADADQFLALAKE-------SKLNNGELDEKLLQLFAKTAAGNCNPVNAVIGGI 401
            P+  N  DA++ + L  +             +++E L++  +  A G+   V A  GG+
Sbjct: 301 LPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGL 360

Query: 402 VAQEVMKACSGKFHPIFQWLYFDAVECI----DENIAETDAIVNGSRYEGQVAIFGKNFQ 457
           VAQEV+KACSGKF P+ Q++YFD++E +    +    E       SRY+ Q+A+FG +FQ
Sbjct: 361 VAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQIAVFGLDFQ 420

Query: 458 EKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHD 517
           +K+   K F+VG+GAIGCE+LKN+A++G+G+G  G I VTD D IEKSNLNRQFLFRP D
Sbjct: 421 KKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKD 480

Query: 518 VQQPKSATAAKAIKVMNPNVNITY--HENRVGPETEKVYDDLFFESLDGIANALDNVEAR 575
           V + KS  AA+A+  MNP++        ++VGPETE++++D F+ESLD + NALDNV+AR
Sbjct: 481 VGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDAR 540

Query: 576 IYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAI 635
            Y+DRRCV+ RKPLLESGTLGTKGN+QV++P LTESYSSS+DPPEKSIP+CTL++FPN I
Sbjct: 541 TYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKI 600

Query: 636 EHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQPLEMLENVKHALVDERPL 695
           +HT+ WA+  F+G F  SAEN   YL  PNFVE+ +K  G     +LE++    +  +P 
Sbjct: 601 DHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVK-GVLESI-SDSLSSKPH 658

Query: 696 NIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLH 755
           N +DC+ WAR  ++ ++N+ I+QLLFNFP +  TS+G+PFWSG KR P PLEFD+ +  H
Sbjct: 659 NFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDH 718

Query: 756 LQYIYTGANLKAELYGIPQ-----VRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQ- 809
             ++  GA+L+A  YGI         N+D    ++  +++PEFTP + + I V D     
Sbjct: 719 FHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDP 778

Query: 810 NSNGDYDQDRLGQLKNELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGI 869
           N+N     D + QL + LP    L G  + P++FEKDDDTN H++FI A SN RA NY I
Sbjct: 779 NANAANGSDEIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFI 838

Query: 870 TPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKIEPHVRALVFELCCQDESGEDVETTI 929
             ADR  +K IAG+IIPAIATTTS+V GLV+   +E      +++L       E  +   
Sbjct: 839 ETADRQKTKFIAGRIIPAIATTTSLVTGLVN---LE------LYKLIDNKTDIEQYKNGF 889

Query: 930 V----AVVAYCWSKGAPKLKYYDVEW-TLWDRFEINQEMTLKQFLDYFQNEHKLEITIL 983
           V        +     +PK +Y + ++  +WDRF+I  ++ L   +++F+ +  LEIT+L
Sbjct: 890 VNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITML 948
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Length = 112 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query986
3cmm_A1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 100.0
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 100.0
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 100.0
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 99.98
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.98
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 99.98
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 99.97
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 99.97
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.97
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.96
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.96
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 99.96
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 99.95
1y8q_B640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.95
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 99.95
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 99.93
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 99.92
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 99.92
2v31_A112 Ubiquitin-activating enzyme E1 X; ligase, phosphor 99.89
1z7l_A276 Ubiquitin-activating enzyme E1 1; SCCH, second cat 98.4
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.39
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.14
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.11
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.98
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.96
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.88
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.81
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.77
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.76
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.76
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.71
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.68
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.62
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.56
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 96.41
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.39
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.26
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.22
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.14
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.13
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 96.12
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.11
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.07
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.03
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.02
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.01
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 95.88
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.82
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 95.8
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.77
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.52
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.46
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.46
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 95.29
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.27
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.26
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 95.25
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.11
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 95.09
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.03
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.02
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.01
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.98
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.98
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 94.98
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.88
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.87
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 94.87
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.86
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.83
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 94.77
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 94.64
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 94.59
4g65_A461 TRK system potassium uptake protein TRKA; structur 94.55
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.55
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.41
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.4
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 94.37
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 94.32
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 94.24
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.24
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 94.23
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 94.22
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 94.21
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 94.15
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 94.14
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.09
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 94.08
3ius_A286 Uncharacterized conserved protein; APC63810, silic 94.05
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 94.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.87
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 93.82
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.82
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.79
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.79
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.76
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.74
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 93.71
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.7
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 93.67
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.67
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 93.63
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 93.61
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.61
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 93.55
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 93.54
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.52
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 93.48
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.46
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.43
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 93.43
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.41
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.39
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 93.38
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 93.38
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.37
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 93.34
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 93.29
3slg_A372 PBGP3 protein; structural genomics, seattle struct 93.29
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 93.27
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.25
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 93.23
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 93.17
4g65_A461 TRK system potassium uptake protein TRKA; structur 93.15
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 93.06
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.04
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 93.04
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.98
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 92.97
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 92.96
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 92.95
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.87
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 92.86
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.8
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 92.78
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 92.78
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 92.77
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 92.75
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 92.74
4ezb_A317 Uncharacterized conserved protein; structural geno 92.73
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 92.72
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.68
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 92.67
4ezb_A317 Uncharacterized conserved protein; structural geno 92.66
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.62
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.57
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 92.57
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 92.56
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 92.43
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 92.42
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 92.42
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 92.41
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 92.37
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 92.36
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 92.35
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 92.31
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 92.31
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 92.28
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 92.28
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 92.28
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 92.27
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 92.26
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.24
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 92.19
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 92.19
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 92.1
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.02
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 92.0
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 91.93
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 91.92
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 91.89
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 91.88
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 91.88
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.87
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 91.84
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 91.76
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 91.76
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 91.72
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 91.7
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 91.69
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 91.67
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 91.6
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 91.6
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 91.57
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 91.49
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 91.49
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 91.47
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 91.47
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 91.42
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.42
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 91.3
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 91.24
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 91.24
4f6c_A427 AUSA reductase domain protein; thioester reductase 91.23
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 91.22
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 91.16
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.15
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 91.12
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 91.12
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.09
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 91.07
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 91.07
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 91.06
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 91.05
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 91.02
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 90.99
3tjr_A301 Short chain dehydrogenase; structural genomics, se 90.97
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 90.96
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 90.96
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 90.9
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 90.89
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 90.88
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 90.87
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.85
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 90.84
3qlj_A322 Short chain dehydrogenase; structural genomics, se 90.83
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 90.83
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 90.82
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 90.81
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 90.81
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.77
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.75
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 90.74
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 90.71
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 90.67
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 90.66
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.65
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 90.63
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 90.62
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 90.62
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 90.61
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.6
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 90.6
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 90.58
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 90.56
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 90.55
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 90.54
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 90.52
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 90.51
1xq6_A253 Unknown protein; structural genomics, protein stru 90.5
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 90.48
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 90.39
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 90.39
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 90.37
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 90.36
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 90.36
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 90.36
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 90.34
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 90.33
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 90.33
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 90.32
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 90.31
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 90.29
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 90.29
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 90.26
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 90.25
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 90.24
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 90.22
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 90.16
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 90.14
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 90.11
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 90.09
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 90.07
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 90.07
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 90.07
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 90.06
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 90.03
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 90.02
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 89.99
3e03_A274 Short chain dehydrogenase; structural genomics, PS 89.94
3imf_A257 Short chain dehydrogenase; structural genomics, in 89.94
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 89.93
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 89.9
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 89.9
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 89.89
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.89
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 89.88
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 89.85
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 89.83
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 89.81
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 89.81
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 89.8
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 89.79
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 89.73
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 89.73
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 89.69
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 89.68
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 89.68
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 89.66
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 89.65
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 89.64
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 89.64
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 89.63
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 89.62
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 89.59
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 89.55
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 89.55
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 89.55
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 89.54
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 89.45
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 89.44
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 89.43
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 89.4
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 89.38
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 89.38
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 89.38
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 89.37
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 89.35
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 89.34
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.27
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 89.24
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 89.21
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 89.18
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 89.17
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 89.16
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 89.08
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 89.08
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 89.06
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 89.06
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 89.03
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 89.01
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 88.94
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.92
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 88.91
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 88.9
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 88.89
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 88.88
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 88.86
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 88.85
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 88.84
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 88.83
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 88.82
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 88.78
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 88.78
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 88.76
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 88.76
3tsc_A277 Putative oxidoreductase; structural genomics, seat 88.75
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 88.73
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 88.67
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 88.66
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.63
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 88.63
3tox_A280 Short chain dehydrogenase; structural genomics, PS 88.58
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 88.54
1spx_A278 Short-chain reductase family member (5L265); paral 88.53
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 88.5
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 88.5
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 88.49
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 88.43
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 88.42
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 88.41
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 88.4
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 88.38
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 88.38
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 88.38
2ywl_A180 Thioredoxin reductase related protein; uncharacter 88.37
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 88.36
1nff_A260 Putative oxidoreductase RV2002; directed evolution 88.36
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 88.36
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 88.31
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 88.31
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 88.3
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 88.3
3rih_A293 Short chain dehydrogenase or reductase; structural 88.3
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 88.22
1xq1_A266 Putative tropinone reducatse; structural genomics, 88.15
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 88.15
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 88.14
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 88.11
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 88.1
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 88.1
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 88.08
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.07
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 88.06
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 88.05
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 88.05
4hb9_A412 Similarities with probable monooxygenase; flavin, 88.05
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 88.04
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 87.97
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 87.95
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 87.95
1xkq_A280 Short-chain reductase family member (5D234); parra 87.95
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 87.94
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 87.93
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 87.92
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 87.9
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 87.86
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 87.86
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 87.85
2wm3_A299 NMRA-like family domain containing protein 1; unkn 87.84
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 87.83
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 87.81
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 87.77
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 87.77
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 87.77
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 87.76
3cxt_A291 Dehydrogenase with different specificities; rossma 87.75
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 87.74
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 87.72
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 87.71
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 87.64
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 87.6
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.58
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 87.56
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 87.56
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 87.56
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 87.55
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 87.54
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 87.52
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 87.49
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 87.43
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 87.43
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 87.43
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 87.42
4gx0_A565 TRKA domain protein; membrane protein, ION channel 87.41
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 87.41
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 87.39
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 87.38
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 87.35
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 87.31
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 87.26
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 87.26
1xhl_A297 Short-chain dehydrogenase/reductase family member 87.25
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 87.21
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 87.2
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 87.19
1o0s_A605 NAD-ME, NAD-dependent malic enzyme; oxidoreductase 87.17
1lnq_A336 MTHK channels, potassium channel related protein; 87.16
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.09
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 87.06
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 87.05
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 87.05
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 87.03
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 86.99
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 86.97
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 86.9
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 86.89
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 86.89
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 86.84
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 86.83
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.83
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 86.79
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 86.78
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 86.78
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 86.71
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 86.69
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 86.68
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 86.67
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 86.66
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 86.65
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 86.65
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 86.65
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 86.65
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 86.64
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 86.63
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 86.62
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 86.61
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 86.56
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 86.53
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 86.51
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 86.49
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 86.47
1gq2_A555 Malic enzyme; oxidoreductase, pigeon liver, NADP-d 86.46
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 86.45
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 86.41
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 86.41
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 86.38
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 86.26
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 86.2
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 86.2
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 86.19
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 86.19
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 86.16
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 86.14
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 86.11
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 86.1
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 86.06
3euw_A344 MYO-inositol dehydrogenase; protein structure init 86.04
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 86.01
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 86.0
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 85.97
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 85.93
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 85.92
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 85.92
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 85.92
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.9
3qha_A296 Putative oxidoreductase; seattle structural genomi 85.9
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 85.82
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 85.79
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=4.1e-202  Score=1871.27  Aligned_cols=920  Identities=47%  Similarity=0.846  Sum_probs=871.7

Q ss_pred             hhhhhhccccchhcccHHHHHHhhcCcEEEEcCChhHHHHHHHHHHhCCCeEEEEeCCCCCccCCCcccccCcCccCchH
Q psy7300          51 QDIDEGLYSRQLYVLGHDAMRRMASSDVLISGLGGLGVEIAKNVILSGVKSVTLHDTTATSLSDLSSQFYLSEKDVGRNR  130 (986)
Q Consensus        51 ~~i~~~~y~Rqi~l~G~~~q~kL~~s~VlIiG~gglGseiaknLvl~GVg~itlvD~d~V~~sdl~rqf~~~~~diGk~K  130 (986)
                      .+++++|||||+++||.++|+||++++|+|+|+||||+++||||+++|||+|+|+|+|.|+.+||+||||++.+|||++|
T Consensus         3 ~~id~~rY~Rqi~l~G~~~q~rL~~s~VlIvG~GGlGseiak~La~aGVg~itlvD~D~V~~sNL~RQ~l~~~~dvG~~K   82 (1015)
T 3cmm_A            3 GEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGVKSMTVFDPEPVQLADLSTQFFLTEKDIGQKR   82 (1015)
T ss_dssp             CCCCHHHHHHHHHHSCHHHHHHHTTCEEEEECCSHHHHHHHHHHHHHCCSEEEEECCSBCCGGGGGTCTTCCGGGTTSBH
T ss_pred             hhhhhHhccchHhhcCHHHHHHHhcCEEEEECCChHHHHHHHHHHHcCCCeEEEecCCEechhhhccccccChhhcChHH
Confidence            46889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCCEEEeecCCCCHhhhccccEEEEecC-CHHHHHHHHHHHHHcCCcEEEeecccceEEEEeecCCce
Q psy7300         131 AEVSHTNLSQLNPYVSTKAYTGELSEAFIKKFRVVVLTNS-TYDEQLAISQITHANDIALIIADTRGLFAQVFCDFGNNF  209 (986)
Q Consensus       131 a~a~~~~L~~lNp~V~v~~~~~~~~~~~l~~~dvVI~~~~-~~~~~~~i~~~c~~~~ip~I~~~~~G~~G~vf~d~g~~f  209 (986)
                      |++++++|+++||+|+|+++...++++++++||+||+|.+ +.+.+..|+++|+++++|||++++.|++|++|+|+|+||
T Consensus        83 a~a~~~~L~~lNP~v~v~~~~~~l~~~~l~~~DvVv~~~d~~~~~r~~ln~~c~~~~iplI~~~~~G~~G~v~~d~~~~~  162 (1015)
T 3cmm_A           83 GDVTRAKLAELNAYVPVNVLDSLDDVTQLSQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEF  162 (1015)
T ss_dssp             HHHHHHHHTTSCTTSCEEECCCCCCSTTGGGCSEEEECTTSCHHHHHHHHHHHHHHTCEEEEEEEETTEEEEEEECCSCE
T ss_pred             HHHHHHHHHHHCCCCeEEEecCCCCHHHHhcCCEEEEcCCCCHHHHHHHHHHHHHcCCCEEEEEecccEEEEEecCCCce
Confidence            9999999999999999999999998899999999999999 999999999999999999999999999999999999999


Q ss_pred             EEEcCCCCCCceeEEeceecccCcccccccccccCCCCCceEEEEeeccccccCCCCCeeeEEeCceeeecCCccccccc
Q psy7300         210 TVVDTTGENPVSVIIAGVTREAEGVVTCLDETRHGFEDGDYVTFSEVQGMTQLNGIEPRKVKVLGPYTFSIGDTTKFDEY  289 (986)
Q Consensus       210 ~v~~~~~e~p~~~~i~~i~~~~~~~v~~~~~~~h~~~~gd~v~f~ev~g~~~~n~~~~~~i~~~~~~~~~i~d~~~f~~y  289 (986)
                      .|+++++++|.++++.+|  +.++.+++++..+|++++|+++.|++++||.++|++++.++++.+|++|.|+|++.|.+|
T Consensus       163 ~c~~~~~~~p~~~~i~~i--~~p~~v~~l~~~~h~~~~gd~v~F~ev~gm~elN~~e~~~i~~~~p~~f~I~Dts~~~~y  240 (1015)
T 3cmm_A          163 TVLDPTGEEPRTGMVSDI--EPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRIGSVKEYGEY  240 (1015)
T ss_dssp             EESBSSCCCCCEEEEEEE--CTTCEEEESTTCCCCCCTTCEEEEECCBTSGGGGSSCCEECEEEETTEEECSCCTTTCCC
T ss_pred             EEeeCCCCCCccccccCC--CCCceeEeeecccccCCCCCeEEEEeeccchhhcCccceeeEEcCCceeEecccchhhhh
Confidence            999999999999999999  557899999999999999999999999999999999999999999999999999999999


Q ss_pred             eecceeeEecCCccccCCChHhhhcCCccccccccccCCchhHHHHHHHHHHHHHHh-CCCCCCCCHHhHHHHHHHHHHh
Q psy7300         290 VSGGIATQVKQPKILKFLPLPEALQQPEFVMTDFAKFESPANLHVAFSTLHNFVKSF-GYAPKPWNSADADQFLALAKES  368 (986)
Q Consensus       290 ~~gg~~~qvk~p~~i~f~sL~~~l~~p~~~~~d~~k~~~~~~l~~~~~al~~F~~~~-gr~P~~~~~~D~~~~~~l~~~~  368 (986)
                      ++||.++|+|.|++++|++|++++.+|.++.+++.++.++.++|++||||++|+++| ||+|.+++.+|++++.++++++
T Consensus       241 v~~g~~~qvk~p~~i~f~~l~~~l~~p~~l~~d~~k~~~~~~l~~~~~Al~~F~~~~~gr~P~~~~~~D~~~l~~~a~~~  320 (1015)
T 3cmm_A          241 KKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALHQFAVRHNGELPRTMNDEDANELIKLVTDL  320 (1015)
T ss_dssp             CBCCEEEECCCCEEECCCCHHHHHHSCCBCCSCGGGTHHHHHHHHHHHHHHHHHHHTTTCCCCTTCHHHHHHHHHHHHHH
T ss_pred             hcCceeEEecCCcccCHHHHHHHHcChHHHHHHHhccCcchHHHHHHHHHHHHHHhcCCCCCCCCCHHHHHHHHHHHHHH
Confidence            999999999999999999999999999988889999889999999999999999999 9999999999999999999998


Q ss_pred             hhcC-------CCccHHHHHHHHHhhcCCCCchhhhhhchhHHHHHHhhhCCCccccccccccchhhhcc----cccccc
Q psy7300         369 KLNN-------GELDEKLLQLFAKTAAGNCNPVNAVIGGIVAQEVMKACSGKFHPIFQWLYFDAVECIDE----NIAETD  437 (986)
Q Consensus       369 ~~~~-------~~ide~lv~~~~~~~~~el~pvaA~iGGi~AQEvIKaiT~kf~Pi~q~~~fD~~e~l~~----~~~~~~  437 (986)
                      ..+.       .+++++++++|+++++++|||||||+||+|||||||+|||||+||+||||||++++++.    .+++++
T Consensus       321 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~el~pvaA~iGGivAQEVIKaiT~kf~Pi~~~~~~d~~~~~~~~~~~~~~~~~  400 (1015)
T 3cmm_A          321 SVQQPEVLGEGVDVNEDLIKELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKT  400 (1015)
T ss_dssp             HHHCHHHHCTTCCCCHHHHHHHHHTTTCCCHHHHHHHHHHHHHHHHHHHHCBSCCCCSEEEEECGGGSCCTTTSCCSTTT
T ss_pred             HHhcCCCccccccCcHHHHHHHHHhcCcccCcHHHHhcchHHHHHHHHhccCCCcccceEEecchhhccccccCCCChhh
Confidence            7521       36899999999999999999999999999999999999999999999999999999972    468888


Q ss_pred             cccccCccchhhhccCHHHHHHHhcCcEEEEecChhhHHHHHHHHHcCCCcCCCCeEEEEeCCccccccCccccCcCCCC
Q psy7300         438 AIVNGSRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHD  517 (986)
Q Consensus       438 ~~~~~~rydrqi~~~G~~~q~~L~~~~VlvvGaGgiG~e~lknLa~~Gv~~g~~g~i~ivD~D~Ie~sNLnRqflf~~~d  517 (986)
                      +.|.++||+||+++||.++|++|+++||+||||||+||++|++||++|||+|+.|+|+|+|+|+|+.|||||||||+.+|
T Consensus       401 ~~~~~~Ry~rq~~l~G~~~q~kL~~~~VlvVGaGGlGsevlk~La~~Gv~~g~~G~i~lvD~D~Ve~SNLnRQ~lf~~~d  480 (1015)
T 3cmm_A          401 TQPVNSRYDNQIAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLNRQFLFRPKD  480 (1015)
T ss_dssp             TSCCSSTTHHHHHHHCHHHHHHHHTCEEEEECCSHHHHHHHHHHHHHTTTCSTTCEEEEECCCBCCGGGTTTCTTCCGGG
T ss_pred             ccchhhhhhhHHHhcCHHHHHHHhcCeEEEEecCHHHHHHHHHHHHcCcCcCCCCeEEEEeCCEeccccccccccCChhh
Confidence            88989999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHhhCCCc--eEEEEEcccCCccccccccccccCCCEEEEcCCCHHHHHHHHHHHHHcCCcEEEEeec
Q psy7300         518 VQQPKSATAAKAIKVMNPNV--NITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCVYSRKPLLESGTL  595 (986)
Q Consensus       518 iG~~Ka~~a~~~l~~~np~~--~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~a~Dn~~ar~~l~~~c~~~~~pli~~g~~  595 (986)
                      ||++||++|+++++++||++  +|+++..++.++++.+|+++||+++|+||+|+||+++|+++|++|+.+++|+|++|+.
T Consensus       481 vG~~Ka~~aa~~l~~iNP~v~~~v~~~~~~i~~~~~~~~~~~~~~~~D~Vi~a~Dn~~aR~~ln~~c~~~~~Pli~~g~~  560 (1015)
T 3cmm_A          481 VGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVTNALDNVDARTYVDRRCVFYRKPLLESGTL  560 (1015)
T ss_dssp             TTSBHHHHHHHHHHHHCGGGTTTEEEECCCCSGGGTTTSCHHHHHHCSEEEECCSSHHHHHHHHHHHHHHTCCEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCcceEEEEecccCchhhhhccHhhhccCCEEEECCCCHHHHHHHHHHHHHcCCcEEEeCCC
Confidence            99999999999999999999  9999999999877777888999999999999999999999999999999999999999


Q ss_pred             CCcceEEEEeCCCCccccCCCCCCCCCCCcccccCCCCcchhhHHHHHHHhhhHhhhhHHHHHhhhCChhHHHHhhcCCC
Q psy7300         596 GTKGNSQVVVPHLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPG  675 (986)
Q Consensus       596 G~~G~v~~~~p~~t~cy~c~~~~~~~~~p~Ctl~~~P~~~~h~i~wa~~~F~~~F~~~~~~~~~~l~~~~~~~~~~~~~~  675 (986)
                      |+.|++++++|+.|+||+|..+|+++++|.||+++||+.++|||+|||++|+++|++.++++++|++||+|.+++.+..+
T Consensus       561 G~~G~v~v~~p~~t~cy~c~~dp~~~~~P~Ctl~~~P~~~~h~i~wa~~~f~~lf~~~~~~~~~~l~~~~~~~~~~~~~~  640 (1015)
T 3cmm_A          561 GTKGNTQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSG  640 (1015)
T ss_dssp             TTEEEEEEECTTTBCCGGGSCCCCCCCCCHHHHHTCCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHCTTHHHHHHC---
T ss_pred             ccccceEEEeCCCCCccCCCCCCCCCCCCcccccCCCCCcHHHHHHHHHHHHHHHhhhhhhhhhhccCchhHHHHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988877665


Q ss_pred             CCchhhHHHHHHhhhccCCCChhHhHHHHHHHHHHHHHHHHHHHHhcCCcccccCCCCCCcCCCCCCCCccccCCCCCcc
Q psy7300         676 SQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLEFDVTDPLH  755 (986)
Q Consensus       676 ~~~~~~l~~~~~~l~~~~p~~~~~c~~~a~~~f~~~F~~~I~~ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~~~~~h  755 (986)
                      .+. +.|+.+++.| ..+|++|++|++||+.+|+++|+++|+|||++||+|++|++|+|||+++||||+||+||++|++|
T Consensus       641 ~~~-~~l~~~~~~l-~~~~~~~~~c~~~a~~~f~~~F~~~I~~Ll~~~p~d~~~~~g~~fW~~~kr~P~pl~fd~~~~~h  718 (1015)
T 3cmm_A          641 DVK-GVLESISDSL-SSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEFDIYNNDH  718 (1015)
T ss_dssp             CCH-HHHHHHHHHH-HSCCSSHHHHHHHHHHHHHHHHTHHHHHHHHHSCTTCBCSTTCBSSCTTCCCCCCCCCCTTSHHH
T ss_pred             hhH-HHHHHHHHHh-hcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccCcccccCCCCCCCCcccCCCCHHH
Confidence            553 7788888887 78999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHhhhHHHHHHHhCCCC-----CCcHHHHHHHHhccccCcccCCCCCceecchhhhhccCCCc-hHHHHHHHHhhCcc
Q psy7300         756 LQYIYTGANLKAELYGIPQ-----VRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDY-DQDRLGQLKNELPS  829 (986)
Q Consensus       756 ~~fi~~~a~l~a~~~~i~~-----~~d~~~~~~~~~~~~~~~f~~~~~~~i~~~~~~~~~~~~~~-d~~~~~~l~~~l~~  829 (986)
                      ++||.++|+|+|++|||++     ..|.+.+.++++++.+|+|.|++|+||..+|++.++.+.+. +.+.+++|..+|++
T Consensus       719 ~~fi~~~a~l~a~~~~i~~~~~~~~~~~~~~~~~~~~~~v~~f~~~~~~ki~~~~~~~~~~~~~~~~~~~~~~l~~~l~~  798 (1015)
T 3cmm_A          719 FHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQVNDDDPDPNANAANGSDEIDQLVSSLPD  798 (1015)
T ss_dssp             HHHHHHHHHHHHHHHTCCCSSTTSSCCHHHHHHHHTTCCCCCCCCCSSCCCCSSTTSSCC---------CCHHHHTTSCC
T ss_pred             HHHHHHHHHhHHHhcCCCCccccccCCHHHHHHHHhhCcCCCcCCccCceeccchhhhcccccccccHHHHHHHHHHhcc
Confidence            9999999999999999997     46899999999999999999999999999888765443333 45667889999988


Q ss_pred             hhhccCCccccceecccCCCchhhHHHHHHhhhhhhccCCCCCChhhHhhhhCCcccccchhhhHHhhhhhhhhc--cCc
Q psy7300         830 IQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKI--EPH  907 (986)
Q Consensus       830 ~~~~~~~~~~~~~FeKDDd~n~hidFi~aasNLRa~ny~I~~~~~~~~k~iAG~IIPAiaTTtA~VaGl~~lEl~--~~~  907 (986)
                      +....+.++.|++||||||+|+|||||+|||||||+||+||++|||++|+|||||||||||||||||||+|+|+|  ++|
T Consensus       799 ~~~~~~~~~~~~~FeKDDd~n~h~dFi~aasNlRa~ny~I~~~~~~~~k~iaG~IIPAIaTT~AivaGl~~lE~~K~~~~  878 (1015)
T 3cmm_A          799 PSTLAGFKLEPVDFEKDDDTNHHIEFITACSNCRAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDN  878 (1015)
T ss_dssp             GGGGTTCCCCCCCCCTTCTTSSHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHTT
T ss_pred             chhcccCCCCceeeecCCCchhHHHHHHHHHHHHHHHcCCCccCHHHHHHHhCCcCccchhHHHHHHHHHHHHHHHHHhc
Confidence            776667789999999999999999999999999999999999999999999999999999999999999999999  677


Q ss_pred             cccceeeccccCCCCCccccce--eeccccccc--CCCCCccccCcee-eeeeEEEeCCCCCHHHHHHHHHHHcCCeEEE
Q psy7300         908 VRALVFELCCQDESGEDVETTI--VAVVAYCWS--KGAPKLKYYDVEW-TLWDRFEINQEMTLKQFLDYFQNEHKLEITI  982 (986)
Q Consensus       908 ~~~~~~~~~~~~~~~~~~rn~f--la~p~~~~~--~~~~~~~~~~~~~-t~wd~~~~~~~~tl~~~~~~~~~~~~~~~~~  982 (986)
                      +++++           .|||+|  ||+|++.++  .+||+++|++++| |+||||+++++|||++|+++|+++||++++|
T Consensus       879 ~~~~~-----------~~kn~f~nla~~~~~~~~p~~~~~~~~~~~~~~t~wd~~~v~~~~Tl~~li~~~~~~~~~~~~~  947 (1015)
T 3cmm_A          879 KTDIE-----------QYKNGFVNLALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITM  947 (1015)
T ss_dssp             CCCGG-----------GCCEEEEETTTTEEEEECCCBCCEEEETTEEEETTTCEEEEESCCBHHHHHHHHHHTTCCEEEE
T ss_pred             ccchh-----------hhhhHHHhccCCceeecCCCCCCCCCCCCCCCCeEEEEEEECCCCcHHHHHHHHHHHhCCccee
Confidence            77788           999999  899999998  7788888999999 9999999999999999999999999999999


Q ss_pred             EEe
Q psy7300         983 LLL  985 (986)
Q Consensus       983 ~~~  985 (986)
                      |++
T Consensus       948 i~~  950 (1015)
T 3cmm_A          948 LSY  950 (1015)
T ss_dssp             EEE
T ss_pred             ecc
Confidence            975
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2v31_A Ubiquitin-activating enzyme E1 X; ligase, phosphorylation, catalytic domain, heteronuclear first catalytic cysteine half-domain, E1 protein; NMR {Mus musculus} Back     alignment and structure
>1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 986
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 9e-60
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 5e-44
d1yova1529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 7e-26
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 4e-48
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 1e-22
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 2e-17
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 0.002
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 4e-19
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 2e-14
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  211 bits (539), Expect = 9e-60
 Identities = 66/508 (12%), Positives = 150/508 (29%), Gaps = 66/508 (12%)

Query: 443 SRYEGQVAIFGKNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLI 502
            +Y+ Q+ ++G + QE L      ++ A A G E+LKN  + G+G        + D + +
Sbjct: 6   QKYDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIG-----SFTIIDGNQV 60

Query: 503 EKSNLNRQFLFRPHDVQQPKSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESL 562
              +    F  +   + + ++  A + ++ +N +V+ ++ E       +   D  FF   
Sbjct: 61  SGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLD--NDPSFFCRF 118

Query: 563 DGIANALDNVEARIYMDRRCVYSRKPLLESGTLGTKGNSQVVVPHLTESYSSSQDPPEKS 622
             +          + +      S+ PLL   T G  G  ++++    E       P    
Sbjct: 119 TVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIK---EHPVIESHPDNAL 175

Query: 623 IPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFVERVMKLPGSQP---- 678
             +   K FP   EH   +  D+ E        +    +    ++ +       +     
Sbjct: 176 EDLRLDKPFPELREHFQSYDLDHMEKKDH---SHTPWIVIIAKYLAQWYSETNGRIPKTY 232

Query: 679 ---------LEMLENVKHALVDERPLNIKDCVAWARNHWQD-QYNNQIRQLLFNFPPEQV 728
                    +            E   N ++ +          Q  + I  +  +     +
Sbjct: 233 KEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINI 292

Query: 729 TSSGQPFW----------SGPKRCPKPLEFDVTDP-------LHLQYIY----------- 760
           T     FW          +   +   P+   + D        + LQ +Y           
Sbjct: 293 TKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAV 352

Query: 761 --TGANLKAELYGIPQVRNLDAIAQMVK---QVVVPEFTPKSGVTIAVTDAQLQNSNGDY 815
               A L   +   P+  +   +  +      + V      +      T  + +  +   
Sbjct: 353 GNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMD 412

Query: 816 DQDRLGQLK---NELPSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPA 872
           + D    L      +    + QG +     ++ ++D       +         +  +   
Sbjct: 413 NPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDD 472

Query: 873 DRHTSKLIAGKIIPAIATTTSVVAGLVS 900
             H            IA   + + G  +
Sbjct: 473 YVHEFCRYGAAEPHTIA---AFLGGAAA 497
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query986
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1yova1529 Amyloid beta precursor protein-binding protein 1, 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 99.97
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.72
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.6
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 97.07
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.04
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.81
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.63
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.56
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.52
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.44
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.4
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 96.31
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.31
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.3
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.21
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.07
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.97
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.95
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.95
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.9
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.87
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.86
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.8
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.78
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.74
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.69
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.69
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.64
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.63
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.61
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.6
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.59
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.59
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.58
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.55
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 95.48
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.4
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.37
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 95.29
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.17
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.11
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.1
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.07
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.05
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 95.0
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 94.99
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 94.96
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.95
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.95
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.88
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.88
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.85
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.83
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.8
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.8
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.8
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.79
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.73
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.52
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.46
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.43
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.42
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.4
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.38
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.37
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.34
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.3
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.3
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.27
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.26
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.15
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 94.15
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 94.12
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 94.11
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.11
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 94.02
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 94.01
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.86
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.83
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 93.8
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.73
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 93.71
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 93.66
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.49
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 93.47
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 93.46
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 93.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.38
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.36
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 93.34
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 93.32
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 93.32
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.31
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 93.27
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 93.2
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.19
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.15
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 93.13
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.12
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.06
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 93.06
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 93.05
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 93.02
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 92.92
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.91
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 92.9
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.89
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 92.86
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.85
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.79
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 92.74
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.74
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.73
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 92.73
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 92.71
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 92.69
d1id1a_153 Rck domain from putative potassium channel Kch {Es 92.68
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.67
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.67
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.66
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 92.58
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.48
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.48
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.34
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 92.33
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 92.28
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.23
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.21
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.14
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 92.1
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.07
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 92.01
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 92.01
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 91.93
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.91
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 91.91
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 91.84
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.81
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.77
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.74
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.67
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 91.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.65
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 91.61
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 91.57
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 91.54
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 91.51
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 91.32
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 91.29
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.23
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 91.13
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 91.11
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 91.05
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 91.03
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 91.01
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 90.99
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 90.99
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 90.96
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.9
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 90.87
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 90.86
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 90.81
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 90.77
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 90.77
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.74
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.71
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 90.66
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.5
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 90.46
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 90.23
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 90.2
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 90.15
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 90.13
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 90.04
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 90.0
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.79
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 89.76
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 89.7
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 89.69
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.6
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 89.53
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 89.48
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 89.45
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.43
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 89.37
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 89.18
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.14
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.99
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 88.96
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 88.86
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 88.84
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 88.74
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 88.73
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 88.65
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 88.33
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 88.32
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 88.3
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.25
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 88.13
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 88.1
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.03
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 87.99
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 87.96
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 87.93
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 87.89
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.89
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.81
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 87.8
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 87.75
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 87.74
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 87.61
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.59
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.57
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 87.43
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 87.38
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 87.3
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 87.21
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 87.19
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.15
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 87.12
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 87.09
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.93
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 86.93
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 86.91
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 86.88
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 86.78
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.7
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 86.66
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 86.61
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 86.58
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 86.52
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.5
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 86.48
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.36
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 86.27
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 86.25
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 86.13
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 86.0
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 85.89
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 85.87
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.87
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 85.8
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 85.8
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.69
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 85.66
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 85.62
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.57
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 85.49
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 85.49
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 85.45
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 85.44
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 85.15
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 85.09
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 85.07
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.94
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 84.92
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 84.89
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 84.86
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 84.82
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 84.79
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 84.71
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 84.69
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 84.48
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 84.4
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.39
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 84.35
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 84.21
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 84.09
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 84.08
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.06
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 83.98
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 83.82
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 83.77
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 83.74
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 83.63
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.58
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 83.56
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 83.52
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 83.47
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 83.45
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 83.31
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.28
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 83.14
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 83.11
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 83.05
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 82.96
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 82.91
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 82.85
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 82.83
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 82.73
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 82.65
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 82.62
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 82.55
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 82.5
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 82.44
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 82.39
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 82.36
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 82.36
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 82.28
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 82.28
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 82.28
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 82.28
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 82.19
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 82.15
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 82.13
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 82.05
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 82.04
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 81.79
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 81.74
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.69
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 81.65
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 81.58
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 81.56
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 81.53
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 81.28
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 81.25
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 81.21
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 81.2
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 81.07
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 81.05
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 81.01
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 81.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 80.95
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 80.87
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 80.75
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 80.6
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 80.59
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.57
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 80.39
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 80.39
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 80.36
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 80.36
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 80.34
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 80.3
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 80.26
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 80.2
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: UBA3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.8e-61  Score=555.30  Aligned_cols=328  Identities=31%  Similarity=0.540  Sum_probs=265.7

Q ss_pred             CccchhhhccC-HHHHHHHhcCcEEEEecChhhHHHHHHHHHcCCCcCCCCeEEEEeCCccccccCccccCcCCCCCCCc
Q psy7300         443 SRYEGQVAIFG-KNFQEKLGKLKYFVVGAGAIGCELLKNFAMMGVGAGPGGQIFVTDMDLIEKSNLNRQFLFRPHDVQQP  521 (986)
Q Consensus       443 ~rydrqi~~~G-~~~q~~L~~~~VlvvGaGgiG~e~lknLa~~Gv~~g~~g~i~ivD~D~Ie~sNLnRqflf~~~diG~~  521 (986)
                      .+|.++.-.-| +..|.+|+++||+||||||+|||+||+|+++||     |+|+|+|+|+|+.|||||||||+.+|||++
T Consensus        17 ~~~~~~~~~~~~e~~~~~l~~~kVlvvG~GglG~ei~k~L~~~Gv-----g~i~lvD~D~Ve~sNL~RQflf~~~diG~~   91 (426)
T d1yovb1          17 GPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGF-----RQIHVIDMDTIDVSNLNRQFLFRPKDIGRP   91 (426)
T ss_dssp             CTTCCTTCCCCSSHHHHHHHHCCEEEECSSTTHHHHHHHHHTTTC-----CCEEEECCCBCCGGGGGTCTTCCGGGTTSB
T ss_pred             CCCcCcccccChHHHHHHHhcCeEEEECCCHHHHHHHHHHHHcCC-----CeEEEEECCCcchhhhcccccCChhHcCcH
Confidence            45666554445 455888999999999999999999999999999     899999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhCCCceEEEEEcccCCccccccccccccCCCEEEEcCCCHHHHHHHHHHHH------------HcCCcE
Q psy7300         522 KSATAAKAIKVMNPNVNITYHENRVGPETEKVYDDLFFESLDGIANALDNVEARIYMDRRCV------------YSRKPL  589 (986)
Q Consensus       522 Ka~~a~~~l~~~np~~~i~~~~~~v~~~~~~~~~~~f~~~~DvVi~a~Dn~~ar~~l~~~c~------------~~~~pl  589 (986)
                      ||++|+++++++||+++|+++..++.+     ++++|++++|+|++|+||+++|+++|++|+            ..++|+
T Consensus        92 Ka~~a~~~l~~~np~v~i~~~~~~i~~-----~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~~~~~~~~~~iPl  166 (426)
T d1yovb1          92 KAEVAAEFLNDRVPNCNVVPHFNKIQD-----FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPL  166 (426)
T ss_dssp             HHHHHHHHHHHHSTTCCCEEECSCGGG-----BCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEETTEECGGGCCCE
T ss_pred             HHHHHHHHHHhhCCCCceEeeeccccc-----hHHHHHHhcchheeccCcHHHHHHHHHHHHHhhcccccccccccCCce
Confidence            999999999999999999999988853     346899999999999999999999999998            457899


Q ss_pred             EEEeecCCcceEEEEeCCCCccccCCCC--CCCCCCCcccccCCCCcchhhHHHHHHHhhhHhhhhHHHHHhhhCChhHH
Q psy7300         590 LESGTLGTKGNSQVVVPHLTESYSSSQD--PPEKSIPICTLKNFPNAIEHTLQWARDNFEGIFRQSAENAAEYLEDPNFV  667 (986)
Q Consensus       590 i~~g~~G~~G~v~~~~p~~t~cy~c~~~--~~~~~~p~Ctl~~~P~~~~h~i~wa~~~F~~~F~~~~~~~~~~l~~~~~~  667 (986)
                      |++|+.|+.|++++++|+.|+||.|..+  |+++++|+||++++|+.++|||+|||.+.                     
T Consensus       167 I~gg~~G~~G~~~vi~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~---------------------  225 (426)
T d1yovb1         167 IDGGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ---------------------  225 (426)
T ss_dssp             EEEEEETTEEEEEEECTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTH---------------------
T ss_pred             EEeEEeeeEEEEEEECCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhc---------------------
Confidence            9999999999999999999999999643  77899999999999999999999997630                     


Q ss_pred             HHhhcCCCCCchhhHHHHHHhhhccCCCChhHhHHHHHHHHHHHHHHHHHHHHhcCCcccccCCCCCCcCCCCCCCCccc
Q psy7300         668 ERVMKLPGSQPLEMLENVKHALVDERPLNIKDCVAWARNHWQDQYNNQIRQLLFNFPPEQVTSSGQPFWSGPKRCPKPLE  747 (986)
Q Consensus       668 ~~~~~~~~~~~~~~l~~~~~~l~~~~p~~~~~c~~~a~~~f~~~F~~~I~~ll~~~p~d~~~~~g~~fW~~~kr~P~pl~  747 (986)
                                                                                          |...+  |    
T Consensus       226 --------------------------------------------------------------------~~~~~--~----  231 (426)
T d1yovb1         226 --------------------------------------------------------------------WPKEQ--P----  231 (426)
T ss_dssp             --------------------------------------------------------------------HHHSC--T----
T ss_pred             --------------------------------------------------------------------ccccc--c----
Confidence                                                                                00000  0    


Q ss_pred             cCCCCCcchhhHhhhHHHHHHHhCCCCCCcHHHHHHHHhccccCcccCCCCCceecchhhhhccCCCchHHHHHHHHhhC
Q psy7300         748 FDVTDPLHLQYIYTGANLKAELYGIPQVRNLDAIAQMVKQVVVPEFTPKSGVTIAVTDAQLQNSNGDYDQDRLGQLKNEL  827 (986)
Q Consensus       748 fd~~~~~h~~fi~~~a~l~a~~~~i~~~~d~~~~~~~~~~~~~~~f~~~~~~~i~~~~~~~~~~~~~~d~~~~~~l~~~l  827 (986)
                                                                   |                                  
T Consensus       232 ---------------------------------------------~----------------------------------  232 (426)
T d1yovb1         232 ---------------------------------------------F----------------------------------  232 (426)
T ss_dssp             ---------------------------------------------T----------------------------------
T ss_pred             ---------------------------------------------c----------------------------------
Confidence                                                         0                                  


Q ss_pred             cchhhccCCccccceecccCCCchhhHHHHHHhhhhhhccCCCCCChhhHhhhhCCcccccchhhhHHhhhhhhhhc--c
Q psy7300         828 PSIQELQGLHITPLEFEKDDDTNLHMDFIVAASNLRAANYGITPADRHTSKLIAGKIIPAIATTTSVVAGLVSKKKI--E  905 (986)
Q Consensus       828 ~~~~~~~~~~~~~~~FeKDDd~n~hidFi~aasNLRa~ny~I~~~~~~~~k~iAG~IIPAiaTTtA~VaGl~~lEl~--~  905 (986)
                                .....||+||+  .||+||++++|+||.+|+|+..+++.+|++|||||||||||||||||++++|++  +
T Consensus       233 ----------~~~~~~d~dd~--~~i~~i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~~E~iK~l  300 (426)
T d1yovb1         233 ----------GEGVPLDGDDP--EHIQWIFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIA  300 (426)
T ss_dssp             ----------STTCCCCTTCH--HHHHHHHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHH
T ss_pred             ----------cccCCCCCCCH--HHHHHHHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHHHHHHHHH
Confidence                      00223677665  599999999999999999999999999999999999999999999999999999  4


Q ss_pred             CccccceeeccccCCCCCcccccee---eccccccc-CCCCCccccCceeeeeeEEEeCCCCCHHHHHHHHHHHcCCeE
Q psy7300         906 PHVRALVFELCCQDESGEDVETTIV---AVVAYCWS-KGAPKLKYYDVEWTLWDRFEINQEMTLKQFLDYFQNEHKLEI  980 (986)
Q Consensus       906 ~~~~~~~~~~~~~~~~~~~~rn~fl---a~p~~~~~-~~~~~~~~~~~~~t~wd~~~~~~~~tl~~~~~~~~~~~~~~~  980 (986)
                      .+..  .           ..+|-|+   ..+.+..+ ...+++.|..|.- .|-.++++.++||+||+++++++|++++
T Consensus       301 t~~~--~-----------p~~n~~~~~~~~~~~~~~~~~~k~~~C~vC~~-~~~~~~~~~~~tL~~li~~~~~~~~l~~  365 (426)
T d1yovb1         301 TSAY--I-----------PLNNYLVFNDVDGLYTYTFEAERKENCPACSQ-LPQNIQFSPSAKLQEVLDYLTNSASLQM  365 (426)
T ss_dssp             HCSS--C-----------CCCSEEEEECSBSCEEEEECCCCCTTCTTTCS-SCBCCC------CTTHHHHTTTCSSSCC
T ss_pred             hcCC--c-----------cccceEEEecCCCceEeeeeccCCCCCCeeCC-ceEEEEECCCCCHHHHHHHHHHhhCcCc
Confidence            3321  1           1233331   22333333 3446666665543 2334566678999999999999988764
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure