Psyllid ID: psy731


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----
MIFLLPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKNKSITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVCDEM
cccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccccHHHHHHHHHccccccccccEEEEEEccccEEEEEcccccccccccEEEEccccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEcccccccccccccEEEEEEcccccEEEEEEcccccccccccccEEEEEEEEcccccccEEEEEccccccEEEEEcccccEEEEEccccccccccccccccccccEEEEccccccccccccccEEEEEEEcccccccEEEEEcccccEEEEEEcccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEccccccccEEEEEEccccccEEEEEcHHHccccccccccccccEEccccccccccccEEEEccccEEEEEEcccccEEEEEcccccccccccEEEEEEEccEEEccccEEEccccEEEEEEccccHHHccccccccccEEEEEEEHHHHHcccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccEEEEEEcccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEccccccccccccEEEEEEEEccccccEEEcccccccccccccEEEEEEEccccccccEEEEEEccccEEEEEEccccccEEEEEccccccccccEEEcccccEEEEEccccccccccccEEEEEEEccccccccEEEEEccccccEEEEEEEccccEEEEEccccccccccccEEEccEEEEEcccEEEEEEccccccccEEEEEEccccccEEEEcHHHcccccccccccccccEEEccccccccccHcEEcccccEEEEEEEccccEEEEcccccccccHcccEEEEccccEEEEccccEEccccEEEEEEccccHHHcccccccccEEEEEEccHHHHHcccccccc
MIFLLPRVLLAILVVAILSLtahfsqssrlteifnwkqvdfafpnEEERRLAQTRGQfvaenclpvsldkwhdrlflavprhkngvpstlnyvmlpnsnnknksitspilmpypswesnvrEARNLTSVVKvqsdpcdrlwaldsgvvegkmeqppsvqvyDLRQQMQIRFFQlkektdyteeskfSNMVVDVTSANCDNAFLYIADSGHNHIVVYnyrtndshiihhnylhfdplfgdftiggeyseffqlkektdyteeskfSNMVVDVTSANCDDAFLYIADSGHNHIVVYnyrtndshiihhnylhfdplfgdftiggvnfqwqtgihgmslspltrdnfrvmyfhplastteFAVTTKVLQnrsldfsrsnfdfkvmgsrgtgsqsgassldeeTGVIFYALLVKSGvgcwntfrgeeyneksmglvaednatliypsdirvdRTGVLWVLSnklpvflysklkpedinVRIFKSTVRNaikgtvcdem
MIFLLPRVLLAILVVAILSLTAhfsqssrltEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPnsnnknksitspilmpyPSWESNVREARNLTSVvkvqsdpcdrLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQnrsldfsrsnfdfkvmgsrgtgsqsgassldEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLpvflysklkpedinvrifkstvrnaikgtvcdem
MifllprvllailvvailsltaHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKNKSITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVCDEM
*IFLLPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVML************PILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEG*******VQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDF********************TGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTV****
****LPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKN*SITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGS************DEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVC***
MIFLLPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKNKSITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMG************LDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVCDEM
MIFLLPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNN***SITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVC***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFLLPRVLLAILVVAILSLTAHFSQSSRLTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDKWHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKNKSITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVCDEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query494
FB|FBgn0041713438 yellow-c "yellow-c" [Drosophil 0.564 0.636 0.412 2.2e-78
FB|FBgn0032601453 yellow-b "yellow-b" [Drosophil 0.459 0.501 0.422 7.4e-50
FB|FBgn0038105452 yellow-f2 "yellow-f2" [Drosoph 0.455 0.497 0.413 2.6e-49
FB|FBgn0041710447 yellow-f "yellow-f" [Drosophil 0.455 0.503 0.391 4.7e-48
FB|FBgn0004034 541 y "yellow" [Drosophila melanog 0.463 0.423 0.375 8.4e-42
UNIPROTKB|Q8MZM5462 dce "Dopachrome conversion enz 0.451 0.482 0.356 1.1e-41
FB|FBgn0039896463 yellow-h "yellow-h" [Drosophil 0.473 0.505 0.344 8.3e-35
UNIPROTKB|O18330432 MRJP1 "Major royal jelly prote 0.530 0.606 0.268 9.3e-24
FB|FBgn0038151426 yellow-e2 "yellow-e2" [Drosoph 0.425 0.492 0.314 2.6e-23
FB|FBgn0034856412 yellow-d2 "yellow-d2" [Drosoph 0.491 0.589 0.313 4.2e-23
FB|FBgn0041713 yellow-c "yellow-c" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 590 (212.7 bits), Expect = 2.2e-78, Sum P(2) = 2.2e-78
 Identities = 122/296 (41%), Positives = 175/296 (59%)

Query:   198 CDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTD 257
             CD   L++ D+G   I+    +   + I+  + L  D L   FTI  +     Q KE   
Sbjct:   158 CDR--LWVLDTGLADILGSPKQITPNSILVFD-LKTDTLLRRFTIPAD-----QTKE--- 206

Query:   258 YTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGD 317
                +S F+N+VVD   + C DAF YI D G   ++VY+ R + S+ + HN+ HFDPL GD
Sbjct:   207 ---DSFFANIVVDADRSECQDAFAYIPDLGAYGVIVYSLRNDKSYRVKHNFFHFDPLHGD 263

Query:   318 FTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRS-LDFSRSN 376
             F +GGVNFQW  G+ G+++ P+  D+ + +YFH LAST EF V+ +VLQN S +    S 
Sbjct:   264 FNVGGVNFQWTDGVFGLAVGPMNPDHSKDIYFHALASTKEFKVSNRVLQNESHVTAGDSY 323

Query:   377 FDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDN 436
             +DFK +G RG   QS A   D ETGVIFY  + K  + CWN  R   Y   + GL+  D+
Sbjct:   324 YDFKYVGDRGMNGQSTAEVFDPETGVIFYTQVNKDAIACWNIKR--PYTPDTQGLIDSDS 381

Query:   437 ATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVCD 492
              TL++P+D+++D  G +WVLS+K+P +LY +L P  +N RI     R+ IKGT C+
Sbjct:   382 HTLVFPNDMKIDNEGTIWVLSDKMPTYLYKELDPSAVNYRILMGQNRDLIKGTPCE 437


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
GO:0016853 "isomerase activity" evidence=IBA
GO:0048067 "cuticle pigmentation" evidence=IBA
GO:0042438 "melanin biosynthetic process" evidence=IBA
GO:0005576 "extracellular region" evidence=IBA
FB|FBgn0032601 yellow-b "yellow-b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038105 yellow-f2 "yellow-f2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0041710 yellow-f "yellow-f" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004034 y "yellow" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MZM5 dce "Dopachrome conversion enzyme" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0039896 yellow-h "yellow-h" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O18330 MRJP1 "Major royal jelly protein 1" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
FB|FBgn0038151 yellow-e2 "yellow-e2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034856 yellow-d2 "yellow-d2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query494
pfam03022285 pfam03022, MRJP, Major royal jelly protein 6e-72
pfam03022285 pfam03022, MRJP, Major royal jelly protein 2e-28
>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information
 Score =  229 bits (586), Expect = 6e-72
 Identities = 99/239 (41%), Positives = 148/239 (61%), Gaps = 7/239 (2%)

Query: 254 EKTDYTEESKFSNMVVDVTSANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDP 313
                   S+  N+VVDV    CDD F+YIAD+    ++VY+   + S  + HN  + DP
Sbjct: 53  PADVAKGNSRLVNLVVDVGDDTCDDTFVYIADAKGRGLIVYDLADDKSWRVEHNTFYPDP 112

Query: 314 LFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFS 373
            FG FTI G +FQ   GI G++LSP T D  R +YFHPLAST  ++V T+VL+N +   +
Sbjct: 113 DFGKFTIAGESFQLDDGIFGLALSPRTPDG-RTLYFHPLASTRLYSVPTEVLRNETNWGN 171

Query: 374 RSNF-DFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLV 432
            + + DFK +G R T  QS A ++D   GV+F+ L+ ++ VGCWNT     Y+  ++G+V
Sbjct: 172 NAQYEDFKDLGDRNT--QSTALAVD-PNGVLFFGLVGQNAVGCWNTST--PYSRANLGVV 226

Query: 433 AEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVC 491
           A ++ TL +PSD+++D+   LWVLSN++  FLY+ L  +++N RI  + V   I+ TVC
Sbjct: 227 ARNSDTLQFPSDLKIDKEEYLWVLSNRMQKFLYNDLDYDEVNFRILGANVDLLIRNTVC 285


Royal jelly is the food of queen bee larvae, and is responsible for the high reproductive ability of the queen. Major royal jelly proteins make up around 90% of larval jelly proteins. This family also the sequence-related yellow protein of drosophila which controls pigmentation of the adult cuticle and larval mouth parts. Length = 285

>gnl|CDD|217322 pfam03022, MRJP, Major royal jelly protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 494
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 100.0
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 99.7
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.44
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.12
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.9
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.77
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.68
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.37
PRK11028330 6-phosphogluconolactonase; Provisional 98.29
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.28
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.12
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.12
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.09
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.07
PRK11028330 6-phosphogluconolactonase; Provisional 98.07
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.03
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 98.0
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.76
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.61
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.42
COG3391381 Uncharacterized conserved protein [Function unknow 97.33
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.31
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.3
KOG4659|consensus 1899 97.13
COG3391381 Uncharacterized conserved protein [Function unknow 97.03
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.67
KOG4499|consensus310 96.63
KOG1214|consensus1289 96.12
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.03
KOG1539|consensus 910 95.98
PRK02888 635 nitrous-oxide reductase; Validated 95.7
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.65
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 95.52
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.49
KOG1520|consensus376 95.45
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 95.22
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.62
KOG1520|consensus376 94.5
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 94.08
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.03
PF0005842 Ldl_recept_b: Low-density lipoprotein receptor rep 93.79
PRK04922433 tolB translocation protein TolB; Provisional 93.77
COG4247364 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosph 93.68
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 93.63
PRK00178430 tolB translocation protein TolB; Provisional 93.39
PRK05137435 tolB translocation protein TolB; Provisional 93.31
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 93.23
PRK04922433 tolB translocation protein TolB; Provisional 93.0
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.73
KOG0291|consensus 893 92.71
PRK05137435 tolB translocation protein TolB; Provisional 92.64
COG5276370 Uncharacterized conserved protein [Function unknow 92.41
PRK04043419 tolB translocation protein TolB; Provisional 91.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.87
PRK04792448 tolB translocation protein TolB; Provisional 91.8
PRK03629429 tolB translocation protein TolB; Provisional 91.59
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.55
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.43
PRK04792448 tolB translocation protein TolB; Provisional 91.36
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.45
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 90.23
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 90.05
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 89.68
KOG4499|consensus310 89.63
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 89.27
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 89.03
COG3204316 Uncharacterized protein conserved in bacteria [Fun 88.79
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 88.78
PRK04043419 tolB translocation protein TolB; Provisional 88.72
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 88.47
KOG1214|consensus 1289 87.92
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 87.26
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 87.14
smart0013543 LY Low-density lipoprotein-receptor YWTD domain. T 86.88
KOG0268|consensus433 86.78
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 86.22
PF05787524 DUF839: Bacterial protein of unknown function (DUF 85.04
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 84.65
COG4946668 Uncharacterized protein related to the periplasmic 83.81
KOG1539|consensus 910 82.52
PRK01742429 tolB translocation protein TolB; Provisional 80.48
PRK01029428 tolB translocation protein TolB; Provisional 80.18
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
Probab=100.00  E-value=2.5e-72  Score=567.22  Aligned_cols=280  Identities=40%  Similarity=0.760  Sum_probs=231.4

Q ss_pred             eEEeeEEEcCCCeEEEEeCCCCCC----CCCCCCEEEEEECCCCcEEEEEEcCCCccccccCCccceEEEeecCCCCCcE
Q psy731          127 TSVVKVQSDPCDRLWALDSGVVEG----KMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAF  202 (494)
Q Consensus       127 vsV~~i~iD~~~~LwvlD~G~~~~----~~~~~Pklv~~dl~t~~vi~~~~lp~~~~~~~~S~l~d~vVD~~~~~c~~~~  202 (494)
                      +||++++||+|+||||||+|..+.    .+.|+|||++|||+|++++|+|.||+                          
T Consensus         1 ~sV~~v~iD~~~rLWVlD~G~~~~~~~~~~~~~pKLv~~Dl~t~~li~~~~~p~--------------------------   54 (287)
T PF03022_consen    1 VSVQRVQIDECGRLWVLDSGRPNGLQPPKQVCPPKLVAFDLKTNQLIRRYPFPP--------------------------   54 (287)
T ss_dssp             S-EEEEEE-TTSEEEEEE-CCHSSSSTTGHTS--EEEEEETTTTCEEEEEE--C--------------------------
T ss_pred             CcccEEEEcCCCCEEEEeCCCcCCCCCCCCCCCcEEEEEECCCCcEEEEEECCh--------------------------
Confidence            699999999999999999999872    24999999999999999999999999                          


Q ss_pred             EEEeeCCCCeEEEEEccCCceeEEecCccccCCCCCccccCCccceeeeecccccccccccceeeEEeeecCCCCCcEEE
Q psy731          203 LYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLY  282 (494)
Q Consensus       203 vYItDs~~~~iIVyd~~~~~~~rv~~~~~~~dp~~~~f~i~g~~~~~f~l~~~~~~~~~s~~~~i~VD~~~~~c~~~~~Y  282 (494)
                                                                           +++++.++|++|+||.+..+|+++|||
T Consensus        55 -----------------------------------------------------~~~~~~s~lndl~VD~~~~~~~~~~aY   81 (287)
T PF03022_consen   55 -----------------------------------------------------DIAPPDSFLNDLVVDVRDGNCDDGFAY   81 (287)
T ss_dssp             -----------------------------------------------------CCS-TCGGEEEEEEECTTTTS-SEEEE
T ss_pred             -----------------------------------------------------HHcccccccceEEEEccCCCCcceEEE
Confidence                                                                 334455566666666666679999999


Q ss_pred             EecCCCCeEEEEEcCCCcEEEEecCCcccCCCCcceEEcCEEeeeecceeeeeeccCCCCCceeEEEeeCCCcceEeeec
Q psy731          283 IADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTT  362 (494)
Q Consensus       283 I~D~~~~gliVydl~~~~swrv~~~~~~~dP~~~~~~v~G~~f~~~~Gi~gIaLsp~~~~g~r~LYf~plss~~ly~V~T  362 (494)
                      |+|++.+||||||++++++||++|++|+++|.++.|+++|+.|+|++|++||||+|...+| |+||||||+|+++|+|+|
T Consensus        82 ItD~~~~glIV~dl~~~~s~Rv~~~~~~~~p~~~~~~i~g~~~~~~dg~~gial~~~~~d~-r~LYf~~lss~~ly~v~T  160 (287)
T PF03022_consen   82 ITDSGGPGLIVYDLATGKSWRVLHNSFSPDPDAGPFTIGGESFQWPDGIFGIALSPISPDG-RWLYFHPLSSRKLYRVPT  160 (287)
T ss_dssp             EEETTTCEEEEEETTTTEEEEEETCGCTTS-SSEEEEETTEEEEETTSEEEEEE-TTSTTS--EEEEEETT-SEEEEEEH
T ss_pred             EeCCCcCcEEEEEccCCcEEEEecCCcceeccccceeccCceEecCCCccccccCCCCCCc-cEEEEEeCCCCcEEEEEH
Confidence            9999999999999999999999999999999999999999999999999999999977777 999999999999999999


Q ss_pred             hhhcCCCcCccc-cccceEEecccCCCCCCCeEEeeCCCCeEEEeccCCCeEEEEeCCCCccccccceeeeeecCCeEec
Q psy731          363 KVLQNRSLDFSR-SNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIY  441 (494)
Q Consensus       363 ~~L~~~~~~~~~-~~~~v~~~G~~G~~~qs~g~~~D~~~G~ly~~~~~~~aI~~w~~~~~~~~~~~~~~~v~~d~~~l~~  441 (494)
                      ++|+|+++...+ +.+.|+.+|+||  +|++||++| ++|+|||++++++||+|||+++  +|.++|+++|++|+++|+|
T Consensus       161 ~~L~~~~~~~~~~~~~~v~~lG~k~--~~s~g~~~D-~~G~ly~~~~~~~aI~~w~~~~--~~~~~~~~~l~~d~~~l~~  235 (287)
T PF03022_consen  161 SVLRDPSLSDAQALASQVQDLGDKG--SQSDGMAID-PNGNLYFTDVEQNAIGCWDPDG--PYTPENFEILAQDPRTLQW  235 (287)
T ss_dssp             HHHCSTT--HHH-HHHT-EEEEE-----SECEEEEE-TTTEEEEEECCCTEEEEEETTT--SB-GCCEEEEEE-CC-GSS
T ss_pred             HHhhCccccccccccccceeccccC--CCCceEEEC-CCCcEEEecCCCCeEEEEeCCC--CcCccchheeEEcCceeec
Confidence            999999986655 678999999996  789999999 8999999999999999999999  9999999999999777999


Q ss_pred             ccceEEcC--CceEEEEecCchhhhcCCCCCCcccEEEEEEechhhhcCCCC
Q psy731          442 PSDIRVDR--TGVLWVLSNKLPVFLYSKLKPEDINVRIFKSTVRNAIKGTVC  491 (494)
Q Consensus       442 pd~~~id~--~g~Lwvlsnrl~~~~~~~~~~~~~nfrI~r~~~~~~i~~t~C  491 (494)
                      ||++++++  +|+|||++||||++.+++++.+|+|||||+++++++|+||+|
T Consensus       236 pd~~~i~~~~~g~L~v~snrl~~~~~~~~~~~e~nfri~~~~v~~~~~~t~C  287 (287)
T PF03022_consen  236 PDGLKIDPEGDGYLWVLSNRLQRFAYGNLNPDEVNFRIWRARVDELIKGTVC  287 (287)
T ss_dssp             EEEEEE-T--TS-EEEEE-S--SSTGGG---SS-SEEEEES-HHHHHTTSTT
T ss_pred             cceeeeccccCceEEEEECcchHhhccCCCCCccEEeEEEeCHHHHhcCCCC
Confidence            99999999  999999999999999999999999999999999999999999



5% of the mass, and 82-90% of the protein content [], of honeybee (Apis mellifera) royal jelly. Royal jelly is a substance secreted by the cephalic glands of nurse bees [] and it is used to trigger development of a queen bee from a bee larva. The biological function of the MRJPs is unknown, but they are believed to play a major role in nutrition due to their high essential amino acid content []. Two royal jelly proteins, MRJP3 and MRJP5, contain a tandem repeat that results from a high genetic variablility. This polymorphism may be useful for genotyping individual bees [].; PDB: 3Q6P_B 3Q6K_A 3Q6T_A 2QE8_B.

>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4247 Phy 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase) [Lipid metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>smart00135 LY Low-density lipoprotein-receptor YWTD domain Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF05787 DUF839: Bacterial protein of unknown function (DUF839); InterPro: IPR008557 This family consists of bacterial proteins of unknown function Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query494
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 2e-92
2qe8_A343 Uncharacterized protein; structural genomics, join 6e-26
2qe8_A343 Uncharacterized protein; structural genomics, join 8e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Length = 381 Back     alignment and structure
 Score =  285 bits (729), Expect = 2e-92
 Identities = 101/468 (21%), Positives = 174/468 (37%), Gaps = 98/468 (20%)

Query: 31  TEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLP--VSLDKWHDRLFLAVPRHKNGVPS 88
           T+ + WKQ+ +              G +  +N +    + D   ++LFLAVPR    VP 
Sbjct: 3   TQGYKWKQLLYNNVTP---------GSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPY 53

Query: 89  TLNYVMLPNSNNKNKSITSPILMPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVV 148
           TL  V    ++   K   SP+L  +   ++     + LTS+ +   D C RLW       
Sbjct: 54  TLAEVDT-KNSLGVKGKHSPLLNKFSGHKTG----KELTSIYQPVIDDCRRLW------- 101

Query: 149 EGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADS 208
                                                    VVD+ S    +       S
Sbjct: 102 -----------------------------------------VVDIGSVEYRSRGAKDYPS 120

Query: 209 GHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMV 268
               IV Y+ +  +   +   Y                             + + F    
Sbjct: 121 HRPAIVAYDLKQPNYPEVVRYYFPTR----------------------LVEKPTYFGGFA 158

Query: 269 VDVT--SANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQ 326
           VDV     +C + F+YI +     + +Y+++  DS  + H     +     F  GG  ++
Sbjct: 159 VDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAER-PTKFDYGGKEYE 217

Query: 327 WQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRG 386
           ++ GI G++L     +  R  Y+   ++   ++V TK L+ +         + +++G+RG
Sbjct: 218 FKAGIFGITLGDRDSEGNRPAYYLAGSAIKVYSVNTKELKQKG-----GKLNPELLGNRG 272

Query: 387 TGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDIR 446
             + + A + D +T VIF+A      V CWNT +           V   ++  ++ +DI 
Sbjct: 273 KYNDAIALAYDPKTKVIFFAEANTKQVSCWNTQK--MPLRMKNTDVVYTSSRFVFGTDIS 330

Query: 447 VDRTGVLWVLSNKLPVFLYS-KLKPEDINVRIFK-STVRNAIKGTVCD 492
           VD  G LW +SN  P    S K K +    R+ +    + AI GT CD
Sbjct: 331 VDSKGGLWFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIAGTACD 378


>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Length = 343 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query494
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 100.0
2qe8_A343 Uncharacterized protein; structural genomics, join 100.0
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 99.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.53
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.53
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 99.49
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.49
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.47
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.47
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.44
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 99.42
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.4
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.39
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.37
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.3
3v65_B386 Low-density lipoprotein receptor-related protein; 99.28
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.28
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.28
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.27
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.26
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.26
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.26
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.23
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 99.23
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.2
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.19
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.17
3kya_A496 Putative phosphatase; structural genomics, joint c 99.17
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.17
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.17
3v65_B386 Low-density lipoprotein receptor-related protein; 99.16
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.14
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.13
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.13
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.12
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.1
3p5b_L400 Low density lipoprotein receptor variant; B-propel 99.1
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.08
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 99.03
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.03
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.02
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.02
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.02
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 99.0
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.0
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.97
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.92
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.91
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.84
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.82
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.82
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.8
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.8
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.78
2qe8_A343 Uncharacterized protein; structural genomics, join 98.73
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.67
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.66
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.64
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.61
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.61
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.6
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.59
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.51
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.51
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.49
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.46
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.46
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.43
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.42
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.42
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.4
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.39
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.36
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.36
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.34
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.32
3kya_A496 Putative phosphatase; structural genomics, joint c 98.3
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.28
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.24
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.24
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.2
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.17
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.16
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.12
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.1
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.09
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.06
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.02
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.01
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.0
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.0
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.99
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.95
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.93
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.89
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.87
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.87
2ece_A462 462AA long hypothetical selenium-binding protein; 97.87
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.85
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.81
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.8
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.8
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.77
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.77
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.76
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.71
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.7
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.67
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.62
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.62
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.6
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.54
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.5
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.5
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.47
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.41
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.36
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.22
2ece_A462 462AA long hypothetical selenium-binding protein; 97.19
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.18
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 97.18
3ott_A 758 Two-component system sensor histidine kinase; beta 97.05
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.05
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.05
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.05
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.95
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.93
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.92
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.84
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.82
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.75
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.72
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 96.59
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.59
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.51
3ott_A 758 Two-component system sensor histidine kinase; beta 96.51
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.5
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.48
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.46
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.46
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.4
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.23
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 96.21
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.1
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.09
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.06
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.83
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 95.66
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.64
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.3
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.18
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 95.17
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 95.13
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.04
3ow8_A321 WD repeat-containing protein 61; structural genomi 94.98
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 94.94
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 94.89
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 94.86
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.77
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.77
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 94.76
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.71
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 94.63
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.54
4g56_B357 MGC81050 protein; protein arginine methyltransfera 94.47
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 94.42
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.39
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 94.38
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 94.35
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.29
3jrp_A379 Fusion protein of protein transport protein SEC13 93.91
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 93.83
4e54_B435 DNA damage-binding protein 2; beta barrel, double 93.75
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 93.74
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.71
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 93.67
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.52
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 93.49
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.38
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 93.32
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 93.15
3jro_A 753 Fusion protein of protein transport protein SEC13 93.07
1k32_A 1045 Tricorn protease; protein degradation, substrate g 93.04
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 92.99
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.92
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 92.81
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 92.53
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 92.18
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.05
1k32_A 1045 Tricorn protease; protein degradation, substrate g 92.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 91.85
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.76
2xyi_A430 Probable histone-binding protein CAF1; transcripti 91.45
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 91.24
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 91.06
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 90.82
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 90.61
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 90.35
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 90.29
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 90.21
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 90.11
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 89.94
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 89.55
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 89.49
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 88.56
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.18
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 88.14
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 87.93
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 87.83
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 87.69
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 87.41
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 87.25
2ymu_A577 WD-40 repeat protein; unknown function, two domain 87.04
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 86.72
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 86.61
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 86.35
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 85.85
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 85.78
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 85.67
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 85.51
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 85.46
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 85.46
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 85.42
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 85.19
2ymu_A577 WD-40 repeat protein; unknown function, two domain 85.14
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 84.64
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 84.34
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 84.05
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 83.88
4e54_B435 DNA damage-binding protein 2; beta barrel, double 83.86
3jrp_A379 Fusion protein of protein transport protein SEC13 83.66
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 83.32
3jro_A 753 Fusion protein of protein transport protein SEC13 83.2
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 83.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 82.57
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 82.32
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 81.41
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 81.31
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 80.77
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 80.74
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 80.72
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 80.51
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 80.21
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
Probab=100.00  E-value=2.9e-94  Score=750.03  Aligned_cols=361  Identities=28%  Similarity=0.492  Sum_probs=327.0

Q ss_pred             ceEEEEEeeeeeeCCCHHHHHHhhccCCcccCCCeeeeeee--eCCcEEEEecCCCCCCCceeEEEEccCCCCCCC-CCC
Q psy731           30 LTEIFNWKQVDFAFPNEEERRLAQTRGQFVAENCLPVSLDK--WHDRLFLAVPRHKNGVPSTLNYVMLPNSNNKNK-SIT  106 (494)
Q Consensus        30 ~~~~~~W~~~df~~p~~~~r~~~~~~g~y~p~~~~p~gv~v--~~gRlFvt~PR~~~gvp~TL~~v~~~~~~~~~~-~~~  106 (494)
                      +|++||||+|||+         |+.+|.|+|+|++|+||++  ++||+|||+|||+.|+|+||++|..+..   ++ ...
T Consensus         2 ~~~~~~Wk~ld~~---------ai~~g~y~p~n~~P~gv~vd~~~gRiFvt~PR~~~gvp~TL~~v~~~~~---~~~~~~   69 (381)
T 3q6k_A            2 DTQGYKWKQLLYN---------NVTPGSYNPDNMISTAFAYDAEGEKLFLAVPRKLPRVPYTLAEVDTKNS---LGVKGK   69 (381)
T ss_dssp             CCEEEEESSCCBT---------TSCTTSSCGGGCCCCEEEEETTTTEEEEECCTTSTTCSCSEEEEEHHHH---TTCTTC
T ss_pred             cceEEEEEeeccc---------cccCCCcccCccceeeeeeecCCCcEEEEeCCCCCCCCcEEEEEeCCCC---cccccC
Confidence            6899999999996         9999999999999999999  8999999999999999999999986532   10 012


Q ss_pred             CCcc-ccCCCcccccccCCCceEEeeEEEcCCCeEEEEeCCCCC----CCC---CCCCEEEEEECCCC--cEEEEEEcCC
Q psy731          107 SPIL-MPYPSWESNVREARNLTSVVKVQSDPCDRLWALDSGVVE----GKM---EQPPSVQVYDLRQQ--MQIRFFQLKE  176 (494)
Q Consensus       107 sp~l-~PYP~~~~n~~~~~~lvsV~~i~iD~~~~LwvlD~G~~~----~~~---~~~Pklv~~dl~t~--~vi~~~~lp~  176 (494)
                      +|+| +|||+|    .+|++|+||+++++|+|+||||||+|..+    +.+   .|+|||++|||+|+  +++|+|+||+
T Consensus        70 ~p~ll~PYP~w----~~~~~lvsV~~v~iD~~~rLWVLDtG~~~~~~~~~~~~~~~~pkLv~~DL~t~~~~li~~y~~p~  145 (381)
T 3q6k_A           70 HSPLLNKFSGH----KTGKELTSIYQPVIDDCRRLWVVDIGSVEYRSRGAKDYPSHRPAIVAYDLKQPNYPEVVRYYFPT  145 (381)
T ss_dssp             SSCCBEECTTC----SSSCSSSCEEEEEECTTCEEEEEECSSCSSCSTTGGGSCCCCCEEEEEESSSTTCCEEEEEECCG
T ss_pred             CcccccCCCCC----ccccceEEeeEEEEcCCCcEEEEeCCCcCcCCCccccCCCCCceEEEEECCCCCceeEEEEECCH
Confidence            6888 999998    37999999999999999999999999987    246   89999999999999  9999999998


Q ss_pred             CccccccCCccceEEEeecCCCCCcEEEEeeCCCCeEEEEEccCCceeEEecCccccCCCCCccccCCccceeeeecccc
Q psy731          177 KTDYTEESKFSNMVVDVTSANCDNAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKT  256 (494)
Q Consensus       177 ~~~~~~~S~l~d~vVD~~~~~c~~~~vYItDs~~~~iIVyd~~~~~~~rv~~~~~~~dp~~~~f~i~g~~~~~f~l~~~~  256 (494)
                      +                                                                               
T Consensus       146 ~-------------------------------------------------------------------------------  146 (381)
T 3q6k_A          146 R-------------------------------------------------------------------------------  146 (381)
T ss_dssp             G-------------------------------------------------------------------------------
T ss_pred             H-------------------------------------------------------------------------------
Confidence            3                                                                               


Q ss_pred             cccccccceeeEEeee-c-CCCCCcEEEEecCCCCeEEEEEcCCCcEEEEecCCcccCCCCcceEEcCEEeeeecceeee
Q psy731          257 DYTEESKFSNMVVDVT-S-ANCDDAFLYIADSGHNHIVVYNYRTNDSHIIHHNYLHFDPLFGDFTIGGVNFQWQTGIHGM  334 (494)
Q Consensus       257 ~~~~~s~~~~i~VD~~-~-~~c~~~~~YI~D~~~~gliVydl~~~~swrv~~~~~~~dP~~~~~~v~G~~f~~~~Gi~gI  334 (494)
                      ++.++|+|++|+||+. + ++|+++||||+|++.+||||||++++++||++|++|+|| ..+.|+|+|++|+|++|+|||
T Consensus       147 ~~~~~S~l~di~VD~~~~~~~c~~~~aYItD~~~~gLIVydl~~~~swRv~~~~~~pd-~~~~~~i~G~~~~~~~Gi~gI  225 (381)
T 3q6k_A          147 LVEKPTYFGGFAVDVANPKGDCSETFVYITNFLRGALFIYDHKKQDSWNVTHPTFKAE-RPTKFDYGGKEYEFKAGIFGI  225 (381)
T ss_dssp             GCCCGGGEEEEEEEESCTTTTSCSEEEEEEETTTTEEEEEETTTTEEEEEECGGGSCC-SCEEEEETTEEEEECCCEEEE
T ss_pred             hcccCCccceEEEecccCCCCCCccEEEEEcCCCCcEEEEECCCCcEEEEccCCCccc-cCcceEECCEEeEeccCceEE
Confidence            3334445555555522 2 379999999999999999999999999999999999999 678999999999999999999


Q ss_pred             eeccCCCCCceeEEEeeCCCcceEeeechhhcCCCcCccccccceEEecccCCCCCCCeEEeeCCCCeEEEeccCCCeEE
Q psy731          335 SLSPLTRDNFRVMYFHPLASTTEFAVTTKVLQNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVG  414 (494)
Q Consensus       335 aLsp~~~~g~r~LYf~plss~~ly~V~T~~L~~~~~~~~~~~~~v~~~G~~G~~~qs~g~~~D~~~G~ly~~~~~~~aI~  414 (494)
                      ||||++.+|+|+||||||+|++||+|+|++|+|+++     ..+|+.+|+||+++|+.|+++|+++|+|||++++++||+
T Consensus       226 aLsp~~~~~~~~LYf~plss~~ly~V~T~~L~~~~~-----~~~v~~~G~kg~~s~~~~~~~D~~~G~ly~~~~~~~aI~  300 (381)
T 3q6k_A          226 TLGDRDSEGNRPAYYLAGSAIKVYSVNTKELKQKGG-----KLNPELLGNRGKYNDAIALAYDPKTKVIFFAEANTKQVS  300 (381)
T ss_dssp             EECCCCTTSCCEEEEEESSCSEEEEEEHHHHSSTTC-----CCCCEEEEECCTTCCEEEEEECTTTCEEEEEESSSSEEE
T ss_pred             EecCCcCCCCeEEEEEECCCCcEEEEEHHHhhCcch-----hhceEEeeecCCCCCcceEEEeCCCCeEEEEeccCCeEE
Confidence            999998888899999999999999999999999874     578999999987788889999768999999999999999


Q ss_pred             EEeCCCCccccccceeeeeecCCeEecccceEEcCCceEEEEecCchhhhcCCC-CCCcccEEEEEE-echhhhcCCCCC
Q psy731          415 CWNTFRGEEYNEKSMGLVAEDNATLIYPSDIRVDRTGVLWVLSNKLPVFLYSKL-KPEDINVRIFKS-TVRNAIKGTVCD  492 (494)
Q Consensus       415 ~w~~~~~~~~~~~~~~~v~~d~~~l~~pd~~~id~~g~Lwvlsnrl~~~~~~~~-~~~~~nfrI~r~-~~~~~i~~t~C~  492 (494)
                      |||+++. +|+++|+++|++|+ +|+||+++++|.+|+|||++||||+|+++++ |.+++||||||+ +++++|+||+|+
T Consensus       301 ~w~~~~~-~~~~~n~~~l~~d~-~l~~pd~~~i~~~g~Lwv~sn~l~~~~~g~l~d~~~~nfrI~r~~~~~~~i~~t~C~  378 (381)
T 3q6k_A          301 CWNTQKM-PLRMKNTDVVYTSS-RFVFGTDISVDSKGGLWFMSNGFPPIRKSEKFKYDFPRYRLMRIMDTQEAIAGTACD  378 (381)
T ss_dssp             EEETTSC-SBCGGGEEEEEECT-TCCSEEEEEECTTSCEEEEECSCCSSTTGGGCCCSSCSEEEEEESCHHHHHTTSTTS
T ss_pred             EEeCCCC-ccccCceEEEEECC-CccccCeEEECCCCeEEEEECcchHhhcCCcCCCCcCCEEEEEecCHHHHhcCCCCC
Confidence            9999853 79999999999996 9999999999999999999999999999998 999999999999 999999999998


Q ss_pred             C
Q psy731          493 E  493 (494)
Q Consensus       493 ~  493 (494)
                      +
T Consensus       379 ~  379 (381)
T 3q6k_A          379 M  379 (381)
T ss_dssp             C
T ss_pred             C
Confidence            6



>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query494
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.47
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.42
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.39
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.37
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.36
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.16
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.12
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.86
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.83
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.81
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.79
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.78
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.69
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.55
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.53
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.3
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.28
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.14
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.99
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.84
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.82
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.69
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.65
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.62
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.51
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.33
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 97.22
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.17
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.03
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.76
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.69
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.47
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.33
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 96.13
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 96.12
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.93
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 95.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.8
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.68
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.66
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 95.64
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 95.47
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.29
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 94.11
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.61
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 93.39
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.9
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 92.64
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 90.83
d1tbga_340 beta1-subunit of the signal-transducing G protein 90.2
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 85.86
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 80.62
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Calcium-dependent phosphotriesterase
family: All0351-like
domain: Hypothetical protein All0351 homologue
species: Nostoc punctiforme [TaxId: 272131]
Probab=99.47  E-value=3.8e-11  Score=116.08  Aligned_cols=259  Identities=11%  Similarity=0.088  Sum_probs=176.1

Q ss_pred             EeeEEEcCCCeEEEEeCCCCCCCCCCCCEEEEEECCCCcEEEEEEcCCCccccccCCccceEEEeecCCCCCcEEEEeeC
Q psy731          129 VVKVQSDPCDRLWALDSGVVEGKMEQPPSVQVYDLRQQMQIRFFQLKEKTDYTEESKFSNMVVDVTSANCDNAFLYIADS  208 (494)
Q Consensus       129 V~~i~iD~~~~LwvlD~G~~~~~~~~~Pklv~~dl~t~~vi~~~~lp~~~~~~~~S~l~d~vVD~~~~~c~~~~vYItDs  208 (494)
                      +.++.++++|+||+.|....        +|.++|.... ......++.        ..+.+++|      .++.+||++.
T Consensus        30 ~e~iAv~pdG~l~vt~~~~~--------~I~~i~p~g~-~~~~~~~~~--------~~~gla~~------~dG~l~v~~~   86 (302)
T d2p4oa1          30 LENLASAPDGTIFVTNHEVG--------EIVSITPDGN-QQIHATVEG--------KVSGLAFT------SNGDLVATGW   86 (302)
T ss_dssp             EEEEEECTTSCEEEEETTTT--------EEEEECTTCC-EEEEEECSS--------EEEEEEEC------TTSCEEEEEE
T ss_pred             cCCEEECCCCCEEEEeCCCC--------EEEEEeCCCC-EEEEEcCCC--------CcceEEEc------CCCCeEEEec
Confidence            45789999999999999876        8999996654 333344333        45667775      3566999998


Q ss_pred             CCCeEEEEEccCC--ceeEEecCccccCCCCCccccCCccceeeeecccccccccccceeeEEeeecCCCCCcEEEEecC
Q psy731          209 GHNHIVVYNYRTN--DSHIIHHNYLHFDPLFGDFTIGGEYSEFFQLKEKTDYTEESKFSNMVVDVTSANCDDAFLYIADS  286 (494)
Q Consensus       209 ~~~~iIVyd~~~~--~~~rv~~~~~~~dp~~~~f~i~g~~~~~f~l~~~~~~~~~s~~~~i~VD~~~~~c~~~~~YI~D~  286 (494)
                      ..+.+.++++...  ...++.                             ........+++++|.      ++.+|++|.
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~-----------------------------~~~~~~~~n~i~~~~------~g~~~v~~~  131 (302)
T d2p4oa1          87 NADSIPVVSLVKSDGTVETLL-----------------------------TLPDAIFLNGITPLS------DTQYLTADS  131 (302)
T ss_dssp             CTTSCEEEEEECTTSCEEEEE-----------------------------ECTTCSCEEEEEESS------SSEEEEEET
T ss_pred             CCceEEEEEecccccceeecc-----------------------------ccCCccccceeEEcc------CCCEEeecc
Confidence            8888777776543  333331                             122344567888873      467899999


Q ss_pred             CCCeEEEEEcCCCcEEEEecCC-cccCCCCcceEEcCEEeeeecceeeeeeccCCCCCceeEEEeeCCCcceEeeechhh
Q psy731          287 GHNHIVVYNYRTNDSHIIHHNY-LHFDPLFGDFTIGGVNFQWQTGIHGMSLSPLTRDNFRVMYFHPLASTTEFAVTTKVL  365 (494)
Q Consensus       287 ~~~gliVydl~~~~swrv~~~~-~~~dP~~~~~~v~G~~f~~~~Gi~gIaLsp~~~~g~r~LYf~plss~~ly~V~T~~L  365 (494)
                      ....+..+|..++..+.+.... ........          .....+||+.+.      ..||+......++|+++....
T Consensus       132 ~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~ngi~~~~------~~l~~~~~~~~~i~~~~~~~~  195 (302)
T d2p4oa1         132 YRGAIWLIDVVQPSGSIWLEHPMLARSNSES----------VFPAANGLKRFG------NFLYVSNTEKMLLLRIPVDST  195 (302)
T ss_dssp             TTTEEEEEETTTTEEEEEEECGGGSCSSTTC----------CSCSEEEEEEET------TEEEEEETTTTEEEEEEBCTT
T ss_pred             ccccceeeeccCCcceeEecCCccceeeccC----------cccccccccccC------CceeeecCCCCeEEecccccc
Confidence            9999999999999888776442 22211111          112456777652      489999999989999876433


Q ss_pred             cCCCcCccccccceEEecccCCCCCCCeEEeeCCCCeEEEeccCCCeEEEEeCCCCccccccceeeeeecCCeEecccce
Q psy731          366 QNRSLDFSRSNFDFKVMGSRGTGSQSGASSLDEETGVIFYALLVKSGVGCWNTFRGEEYNEKSMGLVAEDNATLIYPSDI  445 (494)
Q Consensus       366 ~~~~~~~~~~~~~v~~~G~~G~~~qs~g~~~D~~~G~ly~~~~~~~aI~~w~~~~~~~~~~~~~~~v~~d~~~l~~pd~~  445 (494)
                      ....        ..+...+.   ...+|+++| .+|+||++....++|.++++++  .     ...+++....+.+|+.+
T Consensus       196 ~~~~--------~~~~~~~~---~~pdgia~d-~dG~l~va~~~~~~V~~i~p~G--~-----~~~~~~~~~~~~~pt~v  256 (302)
T d2p4oa1         196 DKPG--------EPEIFVEQ---TNIDDFAFD-VEGNLYGATHIYNSVVRIAPDR--S-----TTIIAQAEQGVIGSTAV  256 (302)
T ss_dssp             SCBC--------CCEEEEES---CCCSSEEEB-TTCCEEEECBTTCCEEEECTTC--C-----EEEEECGGGTCTTEEEE
T ss_pred             cccc--------ccccccCC---CCCcceEEC-CCCCEEEEEcCCCcEEEECCCC--C-----EEEEEecCCCCCCceEE
Confidence            2111        11111111   236899999 8999999999999999999998  3     34555554567899999


Q ss_pred             EEcC---Cc-eEEEEecCchhhhcCCCCCCcccEEEEEEech
Q psy731          446 RVDR---TG-VLWVLSNKLPVFLYSKLKPEDINVRIFKSTVR  483 (494)
Q Consensus       446 ~id~---~g-~Lwvlsnrl~~~~~~~~~~~~~nfrI~r~~~~  483 (494)
                      .++.   |+ .|||.++.-.....   .....+-+|+|+++.
T Consensus       257 afg~~~~D~~~Lyvtt~~g~~~~~---~~~~~~~~~~~~~~~  295 (302)
T d2p4oa1         257 AFGQTEGDCTAIYVVTNGGMFLPP---PTGVVPANVVRLEVG  295 (302)
T ss_dssp             EECCSTTTTTEEEEEECTTSSSCC---TTCCCCEEEEEEECS
T ss_pred             EEcCCCCCCCEEEEECCCCccCCC---cCCcCCCeEEEEeCC
Confidence            9953   33 69999987433222   224667899998754



>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure