Psyllid ID: psy7389

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-

MQYEQEEFKPFQKDHKNFLEGFENIFDSNFVSLFNKDSDESKQGQQGKSVDSSDSHPAGSLEVNSYRSAEDVSHILGDTFLKAYDNTGHKKIPEQSNEGYDKDHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWILDR

cccccccccccHHHHHHHHHHccccccccEEEEEEccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccEEEEcccccccHHHHHHHHHHHcccccccccccccccEEEEEEcccccccccccccccccEEEcccEEEEEEEccccccccccEEEEEEEEEccEEEEEEEccEEEEEccccccHHHHHHcccccHHHHHHcccccEEccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccccccccEEEEEccccccccccccccccccccccccccccEEEEEEccccccEEEEEEccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccc

ccccHHcccccHHHHHHHHHcHHHHcccccEEEcccccccccccccccEcccccccHcHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccccccccccccccEEEEEcccHHHHHHHHHccccccEEEEEEccccccccccHHHHHHHccccccccEEEccccccHHHcccccEcccccccEEcccHHHHHEEEEcccHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHccccccccccccEEEcccccccHHHHHHHHHHHHcccccccccccccccccccEccHHHHHHHHHHHcccccEEEEEEEEEEEEEccccccccEEEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHHcEccHHHHHHHcccccEcccccEEEEccEEEEEEEEEccccccHHHHHccHHHHHHHHHcccccccccccEEEEEEEEcccccccccccEEEEEEcccEccccccHHHHHHHccccccccccEEEEEccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHccccccccccccccccccccHHHEEccccccHHHHHHHHHHccccEEcccccccccccccccccEccccEEcccEcEEEccccccccccccccHHHHHHHHHHHHHHHHHHHcccc

mqyeqeefkpfqKDHKNFLEGFENifdsnfvslfnkdsdeskqgqqgksvdssdshpagslevnsyrsaedvshILGDTFLkaydntghkkipeqsnegydkdhknnnreeqdgdmtfDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAgieepffadvpglaplisrsnidwnymtmpdphackarpngrcywargkvmggssTINYMIYArgnaedydeweamgnegwgYDEVLEYFKksednedkeiyhknpeyhgkggyqtvewlpyadknLPVLIKAWkekgyperdlnaenqvggficgdstngafirpirkkrknltiLTEAHVTRIifdktpnkhKKLVAKSVEFFYKKKLRRARAKKEVIssagainspkilmlsgigpkdhltslnIKTLVDLkvghnlqdhltsdgiviafpktatDRMYKKKVSDAFeykesrcgplastgplqcgvfaktkladsldvpdiqfhhdpmsvrdwitnpvnasstnmspfayydgitvrpillkpksrgyiqlnatdplwgpplifpkfftkkpdldvfvaddLKPWIKAIVKKDIVdmwnsippsnklkrikptvdswtssfrnnryeEVVLTRLRIGhtrvthnhlfkklpppicqcgsvltdLNKVFYKFGTWDYWACIAMQFtgtiqhpvgtckmgpkddpgsvvdARLRVHGvqnlrvvdasimpkivrgntnaptIMIAEKAADMIkedwildr

mqyeqeefkpfqkDHKNFLEGFENIFDSNFVSLFNKDSDESKqgqqgksvdssdshpAGSLEVNSYRSAEDVSHILGDTFLKAYDNTGhkkipeqsnegydkdhknnnrEEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIyhknpeyhgkgGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGdstngafirpirkkrknltilteahvtriifdktpnkhkklvakSVEFFYKKKLRRARAKkevissagainspkilMLSGIGPKDHLTSLNIKTLVDLKVGHNLQdhltsdgiviafpktatdRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKkdivdmwnsippsnklkrikptvdswtssfrnnryeeVVLTRLRIGHTRVThnhlfkklpppicQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGvqnlrvvdasimpkivrgntnaptimIAEKAadmikedwildr

MQYEQEEFKPFQKDHKNFLEGFENIFDSNFVSLFNKDSDESKQGQQGKSVDSSDSHPAGSLEVNSYRSAEDVSHILGDTFLKAYDNTGHKKIPEQSNEGYDKDHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYkkklrrarakkEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWILDR

****************NFLEGFENIFDSNFVSLF**************************************SHILGDTFLKAY*******************************MTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKK********IYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGP****GSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWI***

***********QKDHKNFLEGFENIFDSNFVSL************************AGSLEVNSYRSAEDVSHILGDTFLKAYDNTGHKKIPEQSNE******************TFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWIL**

MQYEQEEFKPFQKDHKNFLEGFENIFDSNFVSLFNKD*********************GSLEVNSYRSAEDVSHILGDTFLKAYDNTGHKKIPEQSNEGYDKDHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYKKK**********ISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWILDR

*QY*QEEFKPFQKDHKNFLEGFENIFDSNFVSLFN********************HPAGSLEVNSYRSAEDVSHILGDTFLKAYDNTGHKKIPEQSNEGYDKDHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPERDLNAENQVGGFICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWI***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		731	2.2.26 [Sep-21-2011]
P18173		625	Glucose dehydrogenase [ac	no	N/A	0.752	0.88	0.368	9e-99
P18172		625	Glucose dehydrogenase [ac	no	N/A	0.752	0.88	0.371	2e-96
P64264		528	Uncharacterized GMC-type	yes	N/A	0.701	0.971	0.309	2e-60
P64263		528	Uncharacterized GMC-type	yes	N/A	0.701	0.971	0.309	2e-60
Q1QXE1		560	Choline dehydrogenase OS=	no	N/A	0.688	0.898	0.324	8e-58
A4XPI5		565	Choline dehydrogenase OS=	no	N/A	0.700	0.906	0.323	4e-57
C6DKY4		559	Choline dehydrogenase OS=	yes	N/A	0.703	0.919	0.319	2e-56
Q6FDF9		553	Choline dehydrogenase OS=	yes	N/A	0.697	0.922	0.319	1e-55
Q5HL11		572	Choline dehydrogenase OS=	yes	N/A	0.696	0.889	0.316	2e-55
Q8CMY2		572	Choline dehydrogenase OS=	yes	N/A	0.696	0.889	0.314	2e-55

>sp\|P18173\|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3	Back alignment and function desciption

 Score =  361 bits (927), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 235/638 (36%), Positives = 324/638 (50%), Gaps = 88/638 (13%)

Query: 101 DKDHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVP 160
           D   + ++R   + D  +DFI+IG GSAG V+A+RLSE+ +WKVLL+EAG +EP  A +P
Sbjct: 48  DPCGRASSRFRSEPDYEYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIP 107

Query: 161 GLAPLISRSNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYD 220
            +      S+ID+ Y T P+P AC +    RCYW RGKV+GG+S +N M+Y RGN EDYD
Sbjct: 108 SMFLNFIGSDIDYRYNTEPEPMACLSSMEQRCYWPRGKVLGGTSVLNGMMYVRGNREDYD 167

Query: 221 EWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLI 280
           +W A GN GW Y++VL +FKKSEDN D +      EYH KGG   V   PY       ++
Sbjct: 168 DWAADGNPGWAYNDVLPFFKKSEDNLDLD--EVGTEYHAKGGLLPVGKFPYNPPLSYAIL 225

Query: 281 KAWKEKGYPERDLNAENQVGGFICG-DSTNG-------AFIRPIRKKRKNLTILTEAHVT 332
           KA +E G+   DLN +N  G  I    + NG       AF+RP R  R NL IL     T
Sbjct: 226 KAGEELGFSVHDLNGQNSTGFMIAQMTARNGIRYSSARAFLRPARM-RNNLHILLNTTAT 284

Query: 333 RIIFDKTPNKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHL 392
           +I+    P+    L  +  + F     R+   KKEV+ SAGA+NSP IL+LSG+GPKD L
Sbjct: 285 KILIH--PHTKNVLGVEVSDQF--GSTRKILVKKEVVLSAGAVNSPHILLLSGVGPKDEL 340

Query: 393 TSLNIKTLVDL-KVGHNLQDHLTSDGIVIAFPKTATDRMYKKKV--SDAFEYKESRCGPL 449
             +N++T+ +L  VG NL +H+T       F     D      +  + A EY   R G +
Sbjct: 341 QQVNVRTVHNLPGVGKNLHNHVTY------FTNFFIDDADTAPLNWATAMEYLLFRDGLM 394

Query: 450 ASTGPLQCGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITV 509
           + TG         T+ ADS + PD+Q +          T  V    +N S       I +
Sbjct: 395 SGTGISDVTAKLATRYADSPERPDLQLYFGGYLASCARTGQVGELLSNNS-----RSIQI 449

Query: 510 RPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVD 569
            P +L P+SRG+I L + DPL  PP I   + T +         D+K  ++ I  K ++ 
Sbjct: 450 FPAVLNPRSRGFIGLRSADPLE-PPRIVANYLTHE--------QDVKTLVEGI--KFVIR 498

Query: 570 MWNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQ 629
           +  + P      R+  TV                                        C+
Sbjct: 499 LSQTTPLKQYGMRLDKTVVKG-------------------------------------CE 521

Query: 630 CGSVLTDLNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGV 689
                       + FG+  YW C   Q TG   H  G+CKMGP  DP +VV+  LRVHG+
Sbjct: 522 A-----------HAFGSDAYWECAVRQNTGPENHQAGSCKMGPSHDPMAVVNHELRVHGI 570

Query: 690 QNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDW 727
           + LRV+D SIMPK+  GNT+AP +MIAEK A ++K  W
Sbjct: 571 RGLRVMDTSIMPKVSSGNTHAPAVMIAEKGAYLLKRAW 608

Essential for cuticular modification during development.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0

>sp\|P18172\|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4	Back alignment and function description

>sp\|P64264\|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1	Back alignment and function description

>sp\|P64263\|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1	Back alignment and function description

>sp\|Q1QXE1\|BETA1_CHRSD Choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|A4XPI5\|BETA_PSEMY Choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|C6DKY4\|BETA_PECCP Choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q6FDF9\|BETA_ACIAD Choline dehydrogenase OS=Acinetobacter sp. (strain ADP1) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q5HL11\|BETA_STAEQ Choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q8CMY2\|BETA_STAES Choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=betA PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		731
328720713		669	PREDICTED: glucose dehydrogenase [accept	0.757	0.828	0.572	0.0
242008457		635	glucose dehydrogenase precursor, putativ	0.746	0.859	0.485	1e-170
383860464		802	PREDICTED: glucose dehydrogenase [accept	0.751	0.684	0.510	1e-169
66499225		800	PREDICTED: glucose dehydrogenase [accept	0.849	0.776	0.456	1e-168
350401258		794	PREDICTED: glucose dehydrogenase [accept	0.753	0.693	0.488	1e-167
156551748		917	PREDICTED: glucose dehydrogenase [accept	0.789	0.629	0.478	1e-167
340720643		794	PREDICTED: glucose dehydrogenase [accept	0.753	0.693	0.488	1e-166
328726813		537	PREDICTED: glucose dehydrogenase [accept	0.596	0.811	0.638	1e-164
307206066		781	Glucose dehydrogenase [acceptor] [Harpeg	0.749	0.701	0.477	1e-164
91086973		665	PREDICTED: similar to AGAP003782-PA [Tri	0.800	0.879	0.435	1e-153

>gi\|328720713\|ref\|XP_001945176.2\| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/627 (57%), Positives = 429/627 (68%), Gaps = 73/627 (11%)

Query: 109 REEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISR 168
           R ++  D  +DF+I+GAGSAGCV+ANRLSEIK WKVLLLEAGIEEP F+ VPGLAPL   
Sbjct: 93  RRKRAVDDQYDFVIVGAGSAGCVVANRLSEIKDWKVLLLEAGIEEPEFSSVPGLAPLQLG 152

Query: 169 SNIDWNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNE 228
           S IDWNY T PD H C++RP G C WARGKVMGGSSTINYMIY RGN +DY+EWE MGN+
Sbjct: 153 SKIDWNYTTQPDEHTCRSRPGGMCDWARGKVMGGSSTINYMIYTRGNMDDYNEWERMGND 212

Query: 229 GWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGY 288
           GWGY+EVL+YFKKSEDNED E+Y KN ++HGKGGY TVEW PY D     LIKAW+E G 
Sbjct: 213 GWGYEEVLQYFKKSEDNEDPEVYKKNQKFHGKGGYLTVEWFPYVDPTAVALIKAWQEIGL 272

Query: 289 PERDLNAENQVGGFICGD--------STNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTP 340
              D+NAENQ+G              STN AFIRPIRKKRKNLT+LT+AHVTRI+ +K  
Sbjct: 273 HYVDVNAENQIGVTHLQSTARHGERMSTNKAFIRPIRKKRKNLTVLTDAHVTRILIEKKR 332

Query: 341 NKHKKLVAKSVEFFYKKKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTL 400
                  A  VEF YKKK+R   AKKEVI SAG++NSPKILMLSGIGPK HL  + IK +
Sbjct: 333 -------AIGVEFLYKKKIRTVFAKKEVILSAGSLNSPKILMLSGIGPKKHLDKMKIKVV 385

Query: 401 VDLKVGHNLQDHLTSDGIVIAFPKTATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVF 460
            +L VG NLQDH+TSDG+VI   KTATD+  K+K  DA  YK+ R GPLA+TGPLQCGVF
Sbjct: 386 KNLAVGKNLQDHVTSDGVVIRVKKTATDKPLKEKKEDAVLYKKKRKGPLAATGPLQCGVF 445

Query: 461 AKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKPKSRG 520
            +TK  D+LD+PDI +  D  + +DWI +P NA+   MSP +YY+ I VRPILLKPKSRG
Sbjct: 446 LQTKYEDTLDLPDINYAFDNGNEKDWIIDPANATKFGMSPVSYYEAINVRPILLKPKSRG 505

Query: 521 YIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPPSNKL 580
           YI LN T P+WG PLI+P+FFTK  D+D+ + + +K      +  ++V+           
Sbjct: 506 YILLNETHPIWGQPLIYPRFFTKGNDIDI-LVEGMK------IGANLVN----------- 547

Query: 581 KRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKV 640
                     T+S R    E V                    +P   C+           
Sbjct: 548 ----------TASMRKAGAELV-------------------DVPAKACKA---------- 568

Query: 641 FYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIM 700
            YKFG+  YWAC+A ++T TI HPVGTCKMGP+ D  +VVD  LRVHGV+ LRVVDASIM
Sbjct: 569 -YKFGSDKYWACVATEYTATIYHPVGTCKMGPEQDEEAVVDPELRVHGVEGLRVVDASIM 627

Query: 701 PKIVRGNTNAPTIMIAEKAADMIKEDW 727
           P IVRGNTNAPTIMIAEKA+DMIK+ W
Sbjct: 628 PTIVRGNTNAPTIMIAEKASDMIKDKW 654

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi\|242008457\|ref\|XP_002425020.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212508669\|gb\|EEB12282.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|383860464\|ref\|XP_003705709.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|66499225\|ref\|XP_394222.2\| PREDICTED: glucose dehydrogenase [acceptor] [Apis mellifera]	Back alignment and taxonomy information

>gi\|350401258\|ref\|XP_003486101.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|156551748\|ref\|XP_001602062.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|340720643\|ref\|XP_003398743.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|328726813\|ref\|XP_003249058.1\| PREDICTED: glucose dehydrogenase [acceptor]-like, partial [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|307206066\|gb\|EFN84159.1\| Glucose dehydrogenase [acceptor] [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|91086973\|ref\|XP_973336.1\| PREDICTED: similar to AGAP003782-PA [Tribolium castaneum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		731
FB\|FBgn0030591		865	CG9517 [Drosophila melanogaste	0.673	0.568	0.373	9e-111
FB\|FBgn0030590		703	CG9518 [Drosophila melanogaste	0.578	0.601	0.411	8e-110
FB\|FBgn0030598		626	CG9503 [Drosophila melanogaste	0.580	0.677	0.408	6.5e-106
FB\|FBgn0030592		726	CG9514 [Drosophila melanogaste	0.662	0.666	0.383	2e-100
FB\|FBgn0039415		616	CG6142 [Drosophila melanogaste	0.573	0.680	0.399	3.7e-97
FB\|FBgn0001112		625	Gld "Glucose dehydrogenase" [D	0.582	0.681	0.394	1.3e-96
FB\|FBgn0030588		621	CG9521 [Drosophila melanogaste	0.585	0.689	0.370	9.9e-95
FB\|FBgn0030596		633	CG12398 [Drosophila melanogast	0.511	0.590	0.383	4.9e-91
FB\|FBgn0030589		622	CG9519 [Drosophila melanogaste	0.577	0.678	0.342	1.5e-89
FB\|FBgn0030587		616	CG9522 [Drosophila melanogaste	0.574	0.681	0.362	7.6e-88

FB\|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 828 (296.5 bits), Expect = 9.0e-111, Sum P(2) = 9.0e-111
 Identities = 198/530 (37%), Positives = 286/530 (53%)

Query:    48 KSVDSSDSHPAGSLEVNSYRSAEDVSHILGDTFLKAYDNT----GHKKIPEQSNEGYDK- 102
             K + S +S  +G+   N+  S+   +H  G         T    G         +G D  
Sbjct:   221 KILASGESSLSGNSSTNTALSSSAPAHCYGPGKRTTVGGTSGSGGAAGATGTGAQGTDPV 280

Query:   103 DHKNNNREEQDGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGL 162
             D +N  +E       +DF++IG GSAG V+ANRLSE++ W VLLLEAG +E   +DVP L
Sbjct:   281 DPENKVQEPTVIRRQYDFVVIGGGSAGAVVANRLSEVRNWTVLLLEAGGDETEISDVPAL 340

Query:   163 APLISRSNIDWNYMTMPDP--HACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYD 220
             A  +  + +DW Y T P      C+A    RC+W RGKV+GGSS +N M+Y RG+  DY+
Sbjct:   341 AGYLQLTELDWKYQTTPSSTRQYCQAMKGDRCFWPRGKVLGGSSVLNAMVYVRGSKNDYN 400

Query:   221 EWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLI 280
              W ++GN GW YD +L+YF KSED  +  +  K P YH  GGY TV+  P+        +
Sbjct:   401 HWASLGNPGWDYDSMLKYFLKSEDVRNPYLA-KTP-YHETGGYLTVQEAPWRTPLSIAFL 458

Query:   281 KAWKEKGYPERDLNAENQVGGFICGD--------STNGAFIRPIRKKRKNLTILTEAHVT 332
             +A  E GY  RD+N   Q G  +           ST  AFIRP+R+ RKN  +L  A  T
Sbjct:   459 QAGIEMGYENRDINGAQQTGFMLTQSTIRRGARCSTGKAFIRPVRQ-RKNFDVLLHAEAT 517

Query:   333 RIIFDKTPNKHKKLVAKSVEFFYXXXXXXXXXXXEVISSAGAINSPKILMLSGIGPKDHL 392
             RI+FDK     K+ +   VE+             EVI+SAGA+N+PK+LMLSG+GP +HL
Sbjct:   518 RILFDK----QKRAIG--VEYMRGGRKNVVFVRREVIASAGALNTPKLLMLSGVGPAEHL 571

Query:   393 TSLNIKTLVDLKVGHNLQDHLTSDGI--VIAFPKTATDRMYKKKVSDAFEYKESRCGPLA 450
                NI  + DL VG+N+QDH+   G+  V+  P T T   ++  +  + EY     GP+ 
Sbjct:   572 QEHNIPVISDLPVGNNMQDHVGLGGLTFVVDAPLTVTRNRFQT-IPVSMEYILRERGPMT 630

Query:   451 STGPLQCGVFAKTKLAD-SLDVPDIQFHHDPMSVR----DWITNPVNAS----STNMSPF 501
              +G ++   F  TK  D S+D PD+QFH  P S+     + I   +N      +T   P 
Sbjct:   631 FSG-VEGVAFLNTKYQDPSVDWPDVQFHFCPSSINSDGGEQIRKILNLRDGFYNTVYKPL 689

Query:   502 AYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFV 551
              + +  ++ P+LL+PKS G+++LN+ +P   P +I P +F  + D+DV V
Sbjct:   690 QHSETWSILPLLLRPKSTGWVRLNSRNPQHQPKII-PNYFAHQEDIDVLV 738

GO:0004344 "glucose dehydrogenase activity" evidence=ISS

GO:0006066 "alcohol metabolic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0008812 "choline dehydrogenase activity" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

FB\|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6G664	BETA_STAAS	1, ., 1, ., 9, 9, ., 1	0.3227	0.6935	0.8910	yes	N/A
Q6GDJ1	BETA_STAAR	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
Q5HL11	BETA_STAEQ	1, ., 1, ., 9, 9, ., 1	0.3164	0.6963	0.8898	yes	N/A
P64263	Y1279_MYCTU	1, ., 1, ., -, ., -	0.3097	0.7017	0.9715	yes	N/A
Q2FV11	BETA_STAA8	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
A8Z5A4	BETA_STAAT	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
Q4A0Q1	BETA_STAS1	1, ., 1, ., 9, 9, ., 1	0.3155	0.7031	0.9178	yes	N/A
Q2YWJ5	BETA_STAAB	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
A6QK99	BETA_STAAE	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
B7N8L3	BETA_ECOLU	1, ., 1, ., 9, 9, ., 1	0.3181	0.6922	0.9100	yes	N/A
Q4ZM63	BETA_PSEU2	1, ., 1, ., 9, 9, ., 1	0.3166	0.7017	0.9031	yes	N/A
A7ZWV4	BETA_ECOHS	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
Q0T7N0	BETA_SHIF8	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
Q0TKW1	BETA_ECOL5	1, ., 1, ., 9, 9, ., 1	0.3120	0.7031	0.9244	yes	N/A
Q5HCU1	BETA_STAAC	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
B1J0W6	BETA_ECOLC	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
P60336	BETA_STAAM	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
P60337	BETA_STAAN	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
B7M2V5	BETA_ECO8A	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
B5Z1R0	BETA_ECO5E	1, ., 1, ., 9, 9, ., 1	0.3193	0.7017	0.9128	yes	N/A
C6DKY4	BETA_PECCP	1, ., 1, ., 9, 9, ., 1	0.3192	0.7031	0.9194	yes	N/A
A7ZI50	BETA_ECO24	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
B7MCD0	BETA_ECO45	1, ., 1, ., 9, 9, ., 1	0.3165	0.6922	0.9003	yes	N/A
Q1RFM3	BETA_ECOUT	1, ., 1, ., 9, 9, ., 1	0.3165	0.6922	0.9003	yes	N/A
B1XE52	BETA_ECODH	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
A6U4Z2	BETA_STAA2	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
B7UJG4	BETA_ECO27	1, ., 1, ., 9, 9, ., 1	0.3120	0.7031	0.9244	yes	N/A
B6I074	BETA_ECOSE	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
P64264	Y1310_MYCBO	1, ., 1, ., -, ., -	0.3097	0.7017	0.9715	yes	N/A
A5IW37	BETA_STAA9	1, ., 1, ., 9, 9, ., 1	0.3212	0.6935	0.8910	yes	N/A
B7L439	BETA_ECO55	1, ., 1, ., 9, 9, ., 1	0.3177	0.7017	0.9226	yes	N/A
Q8CMY2	BETA_STAES	1, ., 1, ., 9, 9, ., 1	0.3148	0.6963	0.8898	yes	N/A
Q6FDF9	BETA_ACIAD	1, ., 1, ., 9, 9, ., 1	0.3198	0.6976	0.9222	yes	N/A
Q48CM7	BETA_PSE14	1, ., 1, ., 9, 9, ., 1	0.3140	0.6990	0.8996	yes	N/A
Q8NUM0	BETA_STAAW	1, ., 1, ., 9, 9, ., 1	0.3227	0.6935	0.8910	yes	N/A
Q6D6D9	BETA_ERWCT	1, ., 1, ., 9, 9, ., 1	0.3145	0.7031	0.9194	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.3.4	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		731
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	1e-106
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-103
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	1e-64
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	5e-43
pfam00732		218	pfam00732, GMC_oxred_N, GMC oxidoreductase	2e-41
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	8e-34
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	2e-31
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	2e-24
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	7e-18
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	2e-16
PRK06292		460	PRK06292, PRK06292, dihydrolipoamide dehydrogenase	8e-04
COG1249		454	COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas	0.001
COG0665		387	COG0665, DadA, Glycine/D-amino acid oxidases (deam	0.002
PRK06370		463	PRK06370, PRK06370, mercuric reductase; Validated	0.003
COG0644		396	COG0644, FixC, Dehydrogenases (flavoproteins) [Ene	0.003
COG0579		429	COG0579, COG0579, Predicted dehydrogenase [General	0.004
pfam05834		374	pfam05834, Lycopene_cycl, Lycopene cyclase protein	0.004

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

 Score =  333 bits (856), Expect = e-106
 Identities = 193/630 (30%), Positives = 269/630 (42%), Gaps = 116/630 (18%)

Query: 115 DMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIE-EPFFADVP-GLAPLISRSNID 172
            M +D++I+G+GSAG VLA RLS+     VL+LEAG         +P   A L++    D
Sbjct: 5   KMEYDYVIVGSGSAGSVLAARLSD-AGLSVLVLEAGGPDRRPLIQMPAAYAFLMNGPRYD 63

Query: 173 WNYMTMPDPHACKARPNGRCYWARGKVMGGSSTINYMIYARGNAEDYDEWEAM-GNEGWG 231
           W + T P+PH           W RGKV+GGSS+IN M+Y RG+ ED+D W    G  GW 
Sbjct: 64  WGFRTEPEPH----LRGRELAWPRGKVLGGSSSINGMVYVRGHPEDFDAWAQESGAPGWP 119

Query: 232 YDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYADKNLPVLIKAWKEKGYPER 291
           YD+VL YFK++ED            +HG GG   V      +      I+A ++ G+P  
Sbjct: 120 YDDVLPYFKRAEDLLGVGGQ-DLRTWHGGGGPLPVSPPRSPNPIARAFIEAGEQLGFPTT 178

Query: 292 DLNAENQVGGF------ICGD---STNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNK 342
                    GF      IC     S   A+++P  K R NLT+LT A V RI+ +     
Sbjct: 179 PDPNGADQEGFGPYCVTICNGRRWSAARAYLKPALK-RPNLTLLTGARVRRILLEG---- 233

Query: 343 HKKLVAKSVEFFYKKK--LRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTL 400
             +  A  VE        +  A A +EV+ +AGAINSPK+L+LSGIGP DHL    I  +
Sbjct: 234 -DR--AVGVEVEIGDGGTIETAVAAREVVLAAGAINSPKLLLLSGIGPADHLLEHGIDVV 290

Query: 401 VDLK-VGHNLQDHLTSDGIVIAFPKTATDRMYK---KKVSDAFEYKESRCGPLASTGPLQ 456
             L  VG NLQDHL       A   T  D +     K    A  Y  +R GP A+    +
Sbjct: 291 GRLPGVGQNLQDHLEIYVAFEATEPTN-DSVLSLFSKLGIGADRYLLTRDGPGATN-HFE 348

Query: 457 CGVFAKTKLADSLDVPDIQFHHDPMSVRDWITNPVNASSTNMSPFAYYDGITVRPILLKP 516
            G     +   + + PD Q+H  P+ +                      G T+    ++P
Sbjct: 349 GGFV---RSGPAGEYPDGQYHFAPLPLAIR-------------AAGAEHGFTLHVGPMRP 392

Query: 517 KSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDMWNSIPP 576
           KSRG + L + DP    P+I P + + + D  +F A       + I+ +  +D       
Sbjct: 393 KSRGSVTLRSPDPD-NRPVIDPNYLSAEGDRAIFRA--GIRLTREIIGQPALDARR---K 446

Query: 577 SNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTD 636
           +      + T D   S+               I     T  H            G+    
Sbjct: 447 AELAPGPRVTTDEDISAA--------------IRFLARTAYH----------PMGTC--- 479

Query: 637 LNKVFYKFGTWDYWACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVD 696
                 + G+    A +                    DDP       LRVHG++NLRVVD
Sbjct: 480 ------RMGSDP-AAVV--------------------DDP------YLRVHGLENLRVVD 506

Query: 697 ASIMPKIVRGNTNAPTIMIAEKAADMIKED 726
           AS+MP     N N   I +AE+AAD I  D
Sbjct: 507 ASVMPTSTGVNPNLTIIALAERAADHILGD 536

Length = 542

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|235787 PRK06370, PRK06370, mercuric reductase; Validated	Back alignment and domain information

>gnl\|CDD\|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|218770 pfam05834, Lycopene_cycl, Lycopene cyclase protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		731
KOG1238\|consensus		623		100.0
PRK02106		560	choline dehydrogenase; Validated	100.0
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	100.0
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	100.0
PLN02785		587	Protein HOTHEAD	100.0
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	100.0
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	100.0
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	99.97
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	99.48
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.41
PRK07121		492	hypothetical protein; Validated	99.4
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.39
PRK08274		466	tricarballylate dehydrogenase; Validated	99.37
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	99.37
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.37
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	99.34
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	99.32
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	99.31
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	99.31
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	99.28
PRK06175		433	L-aspartate oxidase; Provisional	99.27
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	99.23
PLN02815		594	L-aspartate oxidase	99.23
PRK07395		553	L-aspartate oxidase; Provisional	99.23
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	99.21
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	99.21
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	99.21
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	99.2
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	99.19
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	99.19
PRK12839		572	hypothetical protein; Provisional	99.19
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	99.18
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	99.18
PRK07804		541	L-aspartate oxidase; Provisional	99.18
PRK12842		574	putative succinate dehydrogenase; Reviewed	99.18
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	99.17
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	99.16
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	99.16
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	99.16
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	99.15
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	99.13
PTZ00383		497	malate:quinone oxidoreductase; Provisional	99.12
COG0579		429	Predicted dehydrogenase [General function predicti	99.11
PRK11728		393	hydroxyglutarate oxidase; Provisional	99.11
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	99.1
COG2081		408	Predicted flavoproteins [General function predicti	99.09
PRK08275		554	putative oxidoreductase; Provisional	99.09
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	99.08
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	99.08
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	99.07
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	99.07
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	99.06
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	99.06
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	99.06
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	99.06
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	99.05
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	99.04
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	99.03
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	99.03
PRK07512		513	L-aspartate oxidase; Provisional	99.03
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	99.03
PRK05257		494	malate:quinone oxidoreductase; Validated	99.02
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	99.02
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	99.01
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	99.01
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	99.01
PRK09077		536	L-aspartate oxidase; Provisional	99.0
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	98.98
PLN02464		627	glycerol-3-phosphate dehydrogenase	98.97
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	98.94
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	98.94
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	98.94
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	98.94
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	98.93
PRK08071		510	L-aspartate oxidase; Provisional	98.93
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	98.92
PLN02661		357	Putative thiazole synthesis	98.92
PRK13339		497	malate:quinone oxidoreductase; Reviewed	98.91
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	98.9
PRK08401		466	L-aspartate oxidase; Provisional	98.89
KOG2820\|consensus		399		98.85
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	98.85
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	98.85
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	98.85
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	98.8
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	98.78
KOG2844\|consensus		856		98.75
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	98.74
PRK10157		428	putative oxidoreductase FixC; Provisional	98.72
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	98.71
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	98.7
COG3573		552	Predicted oxidoreductase [General function predict	98.7
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	98.66
PRK10015		429	oxidoreductase; Provisional	98.65
PRK13977		576	myosin-cross-reactive antigen; Provisional	98.59
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	98.54
KOG0042\|consensus		680		98.51
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	98.5
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	98.49
KOG1298\|consensus		509		98.46
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	98.44
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	98.43
KOG2415\|consensus		621		98.43
KOG2853\|consensus		509		98.41
PRK06185		407	hypothetical protein; Provisional	98.41
TIGR00275		400	flavoprotein, HI0933 family. The model when search	98.38
PRK07208		479	hypothetical protein; Provisional	98.38
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	98.37
PRK06370		463	mercuric reductase; Validated	98.36
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	98.36
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	98.35
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	98.33
KOG2404\|consensus		477		98.31
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	98.31
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	98.26
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	98.26
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	98.25
TIGR02053		463	MerA mercuric reductase. This model represents the	98.24
PLN02985		514	squalene monooxygenase	98.24
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	98.24
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	98.24
KOG4254\|consensus		561		98.23
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	98.19
PRK08244		493	hypothetical protein; Provisional	98.19
PRK06126		545	hypothetical protein; Provisional	98.15
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	98.13
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	98.11
PRK06847		375	hypothetical protein; Provisional	98.11
KOG2665\|consensus		453		98.11
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	98.1
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	98.09
PRK06184		502	hypothetical protein; Provisional	98.09
PLN02507		499	glutathione reductase	98.08
PLN02697		529	lycopene epsilon cyclase	98.07
KOG2852\|consensus		380		98.05
PRK08132		547	FAD-dependent oxidoreductase; Provisional	98.04
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	98.04
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	98.04
PRK07190		487	hypothetical protein; Provisional	98.03
PRK06834		488	hypothetical protein; Provisional	98.02
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	98.02
PRK11445		351	putative oxidoreductase; Provisional	98.02
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	97.98
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	97.98
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	97.98
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	97.98
PRK07538		413	hypothetical protein; Provisional	97.94
PRK07588		391	hypothetical protein; Provisional	97.87
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	97.86
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	97.84
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	97.81
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	97.78
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	97.78
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	97.78
PRK06116		450	glutathione reductase; Validated	97.76
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	97.76
KOG1399\|consensus		448		97.76
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	97.74
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	97.73
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.67
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	97.66
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	97.65
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	97.64
PLN02463		447	lycopene beta cyclase	97.64
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	97.63
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.63
PRK09897		534	hypothetical protein; Provisional	97.62
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	97.62
PTZ00058		561	glutathione reductase; Provisional	97.61
KOG2311\|consensus		679		97.61
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	97.6
PRK09126		392	hypothetical protein; Provisional	97.6
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	97.59
PRK08013		400	oxidoreductase; Provisional	97.58
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	97.57
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	97.56
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	97.55
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.54
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	97.54
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	97.53
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	97.53
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	97.53
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	97.53
PRK07045		388	putative monooxygenase; Reviewed	97.52
PLN02546		558	glutathione reductase	97.52
PRK13748		561	putative mercuric reductase; Provisional	97.51
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	97.51
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	97.51
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	97.51
KOG1335\|consensus		506		97.49
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	97.48
KOG0029\|consensus		501		97.47
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	97.47
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	97.46
PTZ00367		567	squalene epoxidase; Provisional	97.45
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	97.43
PTZ00052		499	thioredoxin reductase; Provisional	97.42
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	97.42
PTZ00153		659	lipoamide dehydrogenase; Provisional	97.42
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	97.4
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	97.4
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	97.4
TIGR03197		381	MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri	97.4
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	97.37
PRK14694		468	putative mercuric reductase; Provisional	97.37
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	97.35
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	97.35
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	97.34
PRK08163		396	salicylate hydroxylase; Provisional	97.33
KOG2960\|consensus		328		97.33
PLN02268		435	probable polyamine oxidase	97.3
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	97.3
COG2907		447	Predicted NAD/FAD-binding protein [General functio	97.28
PRK11883		451	protoporphyrinogen oxidase; Reviewed	97.26
PRK08294		634	phenol 2-monooxygenase; Provisional	97.26
PRK07233		434	hypothetical protein; Provisional	97.25
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	97.23
PRK07236		386	hypothetical protein; Provisional	97.22
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	97.22
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	97.21
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	97.2
PRK10262		321	thioredoxin reductase; Provisional	97.2
PLN02576		496	protoporphyrinogen oxidase	97.19
PRK06753		373	hypothetical protein; Provisional	97.18
PRK06996		398	hypothetical protein; Provisional	97.18
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	97.1
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	97.09
COG3349		485	Uncharacterized conserved protein [Function unknow	97.07
PLN02568		539	polyamine oxidase	97.05
PLN02676		487	polyamine oxidase	97.03
PRK14727		479	putative mercuric reductase; Provisional	97.02
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	97.02
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	97.0
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	96.97
PRK05868		372	hypothetical protein; Validated	96.96
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	96.95
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	96.9
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	96.89
PRK12416		463	protoporphyrinogen oxidase; Provisional	96.85
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	96.84
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	96.8
PRK07846		451	mycothione reductase; Reviewed	96.8
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	96.76
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	96.74
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	96.74
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	96.74
KOG2614\|consensus		420		96.73
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	96.73
PRK06475		400	salicylate hydroxylase; Provisional	96.71
PRK12831		464	putative oxidoreductase; Provisional	96.68
PF06100		500	Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross	96.61
KOG4716\|consensus		503		96.54
PRK07845		466	flavoprotein disulfide reductase; Reviewed	96.54
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	96.53
PLN02529		738	lysine-specific histone demethylase 1	96.53
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	96.51
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	96.48
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	96.48
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	96.46
PLN02328		808	lysine-specific histone demethylase 1 homolog	96.46
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	96.45
PLN02612		567	phytoene desaturase	96.45
PRK12779		944	putative bifunctional glutamate synthase subunit b	96.34
COG3634		520	AhpF Alkyl hydroperoxide reductase, large subunit	96.34
PRK06567		1028	putative bifunctional glutamate synthase subunit b	96.32
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	96.3
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	96.28
KOG0405\|consensus		478		96.26
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	96.25
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	96.23
PLN02487		569	zeta-carotene desaturase	96.22
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	96.21
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	96.2
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	96.14
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	96.12
PLN02852		491	ferredoxin-NADP+ reductase	95.98
PRK09564		444	coenzyme A disulfide reductase; Reviewed	95.92
KOG0685\|consensus		498		95.91
PLN03000		881	amine oxidase	95.88
PRK14989		847	nitrite reductase subunit NirD; Provisional	95.84
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	95.83
PRK12814		652	putative NADPH-dependent glutamate synthase small	95.79
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	95.76
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	95.74
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	95.74
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	95.67
PRK12770		352	putative glutamate synthase subunit beta; Provisio	95.66
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	95.64
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	95.62
PLN02976		1713	amine oxidase	95.61
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	95.56
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	95.54
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	95.53
PRK10262		321	thioredoxin reductase; Provisional	95.46
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	95.43
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	95.42
KOG3855\|consensus		481		95.36
PTZ00188		506	adrenodoxin reductase; Provisional	95.32
KOG1276\|consensus		491		95.27
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	95.22
TIGR03385		427	CoA_CoA_reduc CoA-disulfide reductase. Members of	94.96
PRK12831		464	putative oxidoreductase; Provisional	94.95
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	94.89
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	94.88
PRK14727		479	putative mercuric reductase; Provisional	94.88
PRK13984		604	putative oxidoreductase; Provisional	94.84
PTZ00058		561	glutathione reductase; Provisional	94.74
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	94.37
PRK13512		438	coenzyme A disulfide reductase; Provisional	94.31
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	94.31
PRK09564		444	coenzyme A disulfide reductase; Reviewed	94.29
KOG4405\|consensus		547		94.21
PRK14694		468	putative mercuric reductase; Provisional	94.14
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	94.08
COG0493		457	GltD NADPH-dependent glutamate synthase beta chain	93.86
PRK12770		352	putative glutamate synthase subunit beta; Provisio	93.77
KOG1439\|consensus		440		93.75
COG1206		439	Gid NAD(FAD)-utilizing enzyme possibly involved in	93.51
PRK12779		944	putative bifunctional glutamate synthase subunit b	92.93
COG5044		434	MRS6 RAB proteins geranylgeranyltransferase compon	92.68
KOG3851\|consensus		446		92.6
PRK04965		377	NADH:flavorubredoxin oxidoreductase; Provisional	92.57
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	92.57
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	92.52
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	92.5
TIGR03169		364	Nterm_to_SelD pyridine nucleotide-disulfide oxidor	92.47
KOG1800\|consensus		468		92.37
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	92.35
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	92.26
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	92.12
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	92.09
COG0446		415	HcaD Uncharacterized NAD(FAD)-dependent dehydrogen	92.02
PF13454		156	NAD_binding_9: FAD-NAD(P)-binding	92.01
KOG0399\|consensus		2142		91.75
PF03721		185	UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen	91.67
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	91.44
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	91.38
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	91.33
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	91.06
KOG1346\|consensus		659		90.89
KOG1336\|consensus		478		90.55
KOG0404\|consensus		322		90.23
PRK12814		652	putative NADPH-dependent glutamate synthase small	90.0
COG0569		225	TrkA K+ transport systems, NAD-binding component [	89.58
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	89.36
KOG2755\|consensus		334		89.3
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	89.28
COG4529		474	Uncharacterized protein conserved in bacteria [Fun	89.26
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	89.19
KOG2403\|consensus		642		88.77
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	88.59
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	88.57
PRK06249		313	2-dehydropantoate 2-reductase; Provisional	88.45
PRK07846		451	mycothione reductase; Reviewed	88.36
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	88.22
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	88.16
TIGR02053		463	MerA mercuric reductase. This model represents the	88.13
PRK06129		308	3-hydroxyacyl-CoA dehydrogenase; Validated	87.89
PRK06370		463	mercuric reductase; Validated	87.4
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	86.9
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	86.85
PRK12921		305	2-dehydropantoate 2-reductase; Provisional	86.71
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	86.68
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	86.51
PRK13512		438	coenzyme A disulfide reductase; Provisional	86.28
TIGR02374		785	nitri_red_nirB nitrite reductase [NAD(P)H], large	86.12
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.92
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	85.87
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	85.87
PRK08293		287	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.77
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.64
PRK14989		847	nitrite reductase subunit NirD; Provisional	85.58
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	85.46
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	85.38
PRK09260		288	3-hydroxybutyryl-CoA dehydrogenase; Validated	85.36
PF01593		450	Amino_oxidase: Flavin containing amine oxidoreduct	85.21
PRK02705		459	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	85.07
PTZ00153		659	lipoamide dehydrogenase; Provisional	84.87
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	84.64
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	84.43
PRK08229		341	2-dehydropantoate 2-reductase; Provisional	84.28
PRK04148		134	hypothetical protein; Provisional	84.12
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	84.1
COG1004		414	Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en	84.1
PRK07845		466	flavoprotein disulfide reductase; Reviewed	84.03
PRK06116		450	glutathione reductase; Validated	83.85
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	83.81
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	83.71
PRK07530		292	3-hydroxybutyryl-CoA dehydrogenase; Validated	83.69
PLN02507		499	glutathione reductase	83.62
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	83.46
PRK06035		291	3-hydroxyacyl-CoA dehydrogenase; Validated	83.42
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	83.38
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	83.31
PRK06719		157	precorrin-2 dehydrogenase; Validated	83.22
PRK14106		450	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	83.2
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	83.09
PLN02546		558	glutathione reductase	82.81
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	82.74
PRK05808		282	3-hydroxybutyryl-CoA dehydrogenase; Validated	81.94
COG3486		436	IucD Lysine/ornithine N-monooxygenase [Secondary m	81.89
PRK13748		561	putative mercuric reductase; Provisional	81.85
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	81.68
PRK14620		326	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	81.62
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	81.57
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	81.53
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	81.38
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	81.29
PRK15116		268	sulfur acceptor protein CsdL; Provisional	81.25
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	81.14
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	80.55
PRK11064		415	wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro	80.3
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	80.06

>KOG1238\|consensus	Back alignment and domain information

Probab=100.00  E-value=7.7e-92  Score=766.45  Aligned_cols=544  Identities=46%  Similarity=0.749  Sum_probs=475.7

Q ss_pred             CCCCcccEEEECCChhHHHHHHHHhhcCCCeEEEEecCCCCCCccCCCCccccccCCCCCCCcccCCCccccccCCCCee
Q psy7389         113 DGDMTFDFIIIGAGSAGCVLANRLSEIKKWKVLLLEAGIEEPFFADVPGLAPLISRSNIDWNYMTMPDPHACKARPNGRC  192 (731)
Q Consensus       113 ~~~~~~DvIIVGsG~aG~~aA~~LA~~~G~~VlVLEaG~~~~~~~~~p~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~  192 (731)
                      +...+||+||||||.+||++|.+|+|.|..+|||||||+..+...+.|.....++.+.++|.|.++|++..|..+.+..|
T Consensus        53 ~~~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~~ac~~m~~~~c  132 (623)
T KOG1238|consen   53 ELDSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQHACLAMSEDRC  132 (623)
T ss_pred             ccccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccChhhhhhhcCCce
Confidence            34568999999999999999999999989999999999988777788877778888999999999999999999999999


Q ss_pred             EeecceeeechhhhhcceeecCCHhhHHHHHHcCCCCCChhhHHHHHHHhhcCCCcccccCCCCCCCCCCceeeecCCCC
Q psy7389         193 YWARGKVMGGSSTINYMIYARGNAEDYDEWEAMGNEGWGYDEVLEYFKKSEDNEDKEIYHKNPEYHGKGGYQTVEWLPYA  272 (731)
Q Consensus       193 ~~~~g~~lGG~S~~n~~~~~r~~~~d~~~w~~~g~~~w~~~~l~~~~~~~e~~~~~~~~~~~~~~~g~~G~l~~~~~~~~  272 (731)
                      .|++|+++||+|.+|+|++.|+.+.||+.|++.|+++|+|+++++||+++|+......  ...++++..|++.+...++.
T Consensus       133 ~wpRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~--~~~~y~~~~g~~~ve~~~~~  210 (623)
T KOG1238|consen  133 YWPRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDP--ELTPYHGAGGPLLVEAGVYP  210 (623)
T ss_pred             ecCccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCc--ccCcccccCCcceecccccc
Confidence            9999999999999999999999999999999999999999999999999999876543  23448899999999999999


Q ss_pred             CChHHHHHHHHHHcCCCCCCCCCCCCCCc----------cccCCChhhhccHhhHhcCCCeEEEcCcEEEEEEecCCCCC
Q psy7389         273 DKNLPVLIKAWKEKGYPERDLNAENQVGG----------FICGDSTNGAFIRPIRKKRKNLTILTEAHVTRIIFDKTPNK  342 (731)
Q Consensus       273 ~~~~~~~~~~~~~~G~~~~~~~~~~~~G~----------~r~~~s~~~~~L~~a~~~~~g~~i~~~t~V~~I~~~~~g~~  342 (731)
                      .+....+.++..++|....|+|+....|+          .|+  ++..+|+.++...++|+.+..++.|++|.+|+.++ 
T Consensus       211 ~~~~~~~~~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~--s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~-  287 (623)
T KOG1238|consen  211 NNLFTAFHRAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRV--SLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGK-  287 (623)
T ss_pred             CchhhHhHHhHHhcCCCccCCCCccccchhhhhccccCCEEE--EehhhhhhhhhccCccccccccceEEEEEEcCCCc-
Confidence            99999999999999988899999887776          677  89999999887657899999999999999998777 


Q ss_pred             CCceEEEEEEEEeC-CEEEEEEeccEEEecccCCCchHHHhhcCCCCcccccccCccceeecC-ccccccccccCceEEE
Q psy7389         343 HKKLVAKSVEFFYK-KKLRRARAKKEVISSAGAINSPKILMLSGIGPKDHLTSLNIKTLVDLK-VGHNLQDHLTSDGIVI  420 (731)
Q Consensus       343 ~~~~r~~GV~~~~~-g~~~~i~A~k~VVLAAGai~Tp~LLl~SGig~~~~l~~~gi~~~~~~p-VG~nL~dH~~~~~~~~  420 (731)
                          ++.||++... +++++|+|+|+||||||||+||+|||+|||||.++|++.|||++.|+| ||+||+||+..+.+.+
T Consensus       288 ----~a~gv~~~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~  363 (623)
T KOG1238|consen  288 ----RAKGVEFVRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVF  363 (623)
T ss_pred             ----eEEEEEEEecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeee
Confidence                9999999988 899999999999999999999999999999999999999999999999 9999999999854444


Q ss_pred             EecCC--cchhhhhhhHHhHHHHHHcCCCCCCCCCccceeEEEeccCCC-CCCCCCeeEEecCCcccccc----c---Cc
Q psy7389         421 AFPKT--ATDRMYKKKVSDAFEYKESRCGPLASTGPLQCGVFAKTKLAD-SLDVPDIQFHHDPMSVRDWI----T---NP  490 (731)
Q Consensus       421 ~~~~~--~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~-~~~~p~~~~~~~~~~~~~~~----~---~~  490 (731)
                      ..+..  ....+  .....+.+|.+.+.||+...+ ++..+|+++.... +.++||+++++.+..+..+-    .   .+
T Consensus       364 ~~~~~~~~~~~~--~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~~  440 (623)
T KOG1238|consen  364 STNPVELSLIRL--VGITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALGE  440 (623)
T ss_pred             cCCCcccccccc--ccchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccccccchhhhhhhcch
Confidence            43321  11122  245677889999999998776 7889999988765 44799999988777665441    0   01


Q ss_pred             ccCCCCCCCCCCCCCcEEEEEeecccCCccEEEccCCCCCCCCCeeccCCCCChhHHHHHHhcchHHHHHHHHHhhhhcc
Q psy7389         491 VNASSTNMSPFAYYDGITVRPILLKPKSRGYIQLNATDPLWGPPLIFPKFFTKKPDLDVFVADDLKPWIKAIVKKDIVDM  570 (731)
Q Consensus       491 ~~~~~~~~~~~~~~~~~~~~~~~~~p~srg~V~l~~~d~~~~~p~i~~~y~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~  570 (731)
                      +++  ..+.+......+.++..+++|.|||+|.|.++|| ...|.|++||+.+|.|++.++++     ++.+.       
T Consensus       441 ~y~--~~~~~~~~~~~~~i~~~~l~P~SrG~l~L~s~nP-~~~P~I~~NY~~~p~Dv~~~veg-----i~~~~-------  505 (623)
T KOG1238|consen  441 IYQ--ALFGELTNSDSFVIFPKLLRPKSRGRLKLRSTNP-RDNPLITPNYFTHPEDVATLVEG-----IRTII-------  505 (623)
T ss_pred             HHH--HhhhhhhcCceeEEeehhcCCCccceEEecCCCC-CcCceeccCcCCCHHHHHHHHHH-----HHHHH-------
Confidence            111  1223334445688888999999999999999999 99999999999999999999999     99999       


Q ss_pred             cCCCCCCccccccccccccccccccccchhhhhhhhhhccccceecccccccCCCCccCCCCcccccccccccCCCHHHH
Q psy7389         571 WNSIPPSNKLKRIKPTVDSWTSSFRNNRYEEVVLTRLRIGHTRVTHNHLFKKLPPPICQCGSVLTDLNKVFYKFGTWDYW  650 (731)
Q Consensus       571 ~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~  650 (731)
                                 ++     .++++|++            +++ +      +...+.|+|..           ....++++|
T Consensus       506 -----------~l-----~~s~af~~------------~~~-r------~~~~~~~~c~~-----------~~~~sd~yw  539 (623)
T KOG1238|consen  506 -----------RL-----SNSKAFQR------------FGA-R------LWKKPVPGCDL-----------LAFLSDAYW  539 (623)
T ss_pred             -----------HH-----HcCHHHHH------------hcc-h------hccccCCCccc-----------ccCCCHHHH
Confidence                       88     88999998            666 3      33446788864           457899999


Q ss_pred             HHHHHhhcCcccccccccccCCCCCCCCccCCCCeEeccCCeEEeecCCCCCCCCCCcHHHHHHHHHHHHHHHHhhhcc
Q psy7389         651 ACIAMQFTGTIQHPVGTCKMGPKDDPGSVVDARLRVHGVQNLRVVDASIMPKIVRGNTNAPTIMIAEKAADMIKEDWIL  729 (731)
Q Consensus       651 ~~~~~~~~~~~~H~~GTcrMG~~d~~~~VVD~~~rV~g~~nL~V~DaSv~P~~~~~NP~lTi~AlA~r~A~~I~~~~~~  729 (731)
                      +||+|....|.||++|||+||+..|+++|||+++||||++||||+|||+||.+|++||..|+||||||+|+.|++++..
T Consensus       540 ~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~MIgek~ad~Ik~~~~~  618 (623)
T KOG1238|consen  540 ECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVMMIGEKAADMIKEEWLA  618 (623)
T ss_pred             HHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHHHHHHHHHHHHHHHhhh
Confidence            9999999999999999999999888999999999999999999999999999999999999999999999999999764

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>KOG2820\|consensus	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>KOG2844\|consensus	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>KOG0042\|consensus	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>KOG1298\|consensus	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>KOG2415\|consensus	Back alignment and domain information

>KOG2853\|consensus	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>KOG2404\|consensus	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>KOG4254\|consensus	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>KOG2665\|consensus	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>KOG2852\|consensus	Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>KOG1399\|consensus	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>KOG2311\|consensus	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>KOG1335\|consensus	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>KOG0029\|consensus	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>KOG2960\|consensus	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>COG2907 Predicted NAD/FAD-binding protein [General function prediction only]	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>KOG2614\|consensus	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis []	Back alignment and domain information

>KOG4716\|consensus	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>KOG0405\|consensus	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>KOG0685\|consensus	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>KOG3855\|consensus	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

>KOG1276\|consensus	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK09564 coenzyme A disulfide reductase; Reviewed	Back alignment and domain information

>KOG4405\|consensus	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>KOG1439\|consensus	Back alignment and domain information

>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3851\|consensus	Back alignment and domain information

>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein	Back alignment and domain information

>KOG1800\|consensus	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PF13454 NAD_binding_9: FAD-NAD(P)-binding	Back alignment and domain information

>KOG0399\|consensus	Back alignment and domain information

>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ]	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>KOG1346\|consensus	Back alignment and domain information

>KOG1336\|consensus	Back alignment and domain information

>KOG0404\|consensus	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>KOG2755\|consensus	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>COG4529 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>KOG2403\|consensus	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK06249 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK12921 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK14989 nitrite reductase subunit NirD; Provisional	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO)	Back alignment and domain information

>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PRK08229 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

Homologous Structure Templates