Psyllid ID: psy7425


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHPSSSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPLLNKLLSGVTIAQGGRGKGGKAKTKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
cccHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHccccHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHEEEcccccHHHHccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccHHHHHHHcccEEcccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEccHHHHHHHcccccccccccccccccccccccHHHHHcccEEEcccccccccccccccccHHHHHcccccHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHcHHHHHHcccEEEccccccccccHHHccccccccc
martkqtarkstggkaprkQLATKAArksapatggvkkphpsssmartkqtarkstggkaprkQLATKAarksapatggvkkphryrpgtVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQtarkstggkaprkQLATKAArksapatggvkkplLNKLLsgvtiaqggrgkggkaktksktrssraglqfpvgrIHRLLRkgnyaervgagAPVYLAAVMEYLAAEVLELAGnaardnkktriiPRHLQLAIRNDEELNKLLSgvtiaqggvlpniqavllpkktekka
martkqtarkstggkaprkqlatkaarksapatggvkkphpsssmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreIRRYQKSTellirklpfqrLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKrqtarkstggkaprkqlatkaarksapatggvkkpllnKLLSgvtiaqggrgkggkaktksktrssraglqfpvgrihrllrkgnyaerVGAGAPVYLAAVMEYLAAEVLELAGnaardnkktriiPRHLQLAIRNDEELNKLLSGvtiaqggvlpniqavllpkktekka
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHPSSSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPLLNKLLSGVTIAQggrgkggkaktksktrssragLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
****************************************************************************************GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA****************************************LL****************************LQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLL********
***************************************************A*********************************YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTA****************************************************************GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAV***K******
**********************************************************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR****************************GGVKKPLLNKLLSGVTIA********************AGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
**********************************************************************************PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLA**************KKPLLNKLLSGVTIA*********************GLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHPSSSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPLLNKLLSGVTIAQGGRGKGGKAKTKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
P84239136 Histone H3 OS=Urechis cau N/A N/A 0.359 0.875 0.991 9e-63
P84237136 Histone H3 OS=Tigriopus c N/A N/A 0.359 0.875 0.991 9e-63
P84235136 Histone H3 OS=Platynereis N/A N/A 0.359 0.875 0.991 9e-63
P02299136 Histone H3 OS=Drosophila yes N/A 0.359 0.875 0.991 9e-63
P84236136 Histone H3 OS=Drosophila N/A N/A 0.359 0.875 0.991 9e-63
P84238136 Histone H3 OS=Chironomus N/A N/A 0.359 0.875 0.991 9e-63
Q28D37136 Histone H3.2 OS=Xenopus t no N/A 0.359 0.875 0.991 9e-63
P84233136 Histone H3.2 OS=Xenopus l N/A N/A 0.359 0.875 0.991 9e-63
P84232136 Histone H3.2 OS=Poroderma N/A N/A 0.359 0.875 0.991 9e-63
P84234136 Histone H3.2 OS=Oncorhync N/A N/A 0.359 0.875 0.991 9e-63
>sp|P84239|H3_URECA Histone H3 OS=Urechis caupo PE=1 SV=2 Back     alignment and function desciption
 Score =  240 bits (613), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 118/119 (99%)

Query: 45  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 104
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 105 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQT 163
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR T
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT 119




Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Urechis caupo (taxid: 6431)
>sp|P84237|H3_TIGCA Histone H3 OS=Tigriopus californicus PE=3 SV=2 Back     alignment and function description
>sp|P84235|H3_PLADU Histone H3 OS=Platynereis dumerilii PE=3 SV=2 Back     alignment and function description
>sp|P02299|H3_DROME Histone H3 OS=Drosophila melanogaster GN=His3 PE=1 SV=4 Back     alignment and function description
>sp|P84236|H3_DROHY Histone H3 OS=Drosophila hydei GN=His3 PE=3 SV=2 Back     alignment and function description
>sp|P84238|H3_CHITH Histone H3 OS=Chironomus thummi thummi PE=3 SV=2 Back     alignment and function description
>sp|Q28D37|H32_XENTR Histone H3.2 OS=Xenopus tropicalis GN=TGas081o10.1 PE=2 SV=3 Back     alignment and function description
>sp|P84233|H32_XENLA Histone H3.2 OS=Xenopus laevis PE=1 SV=2 Back     alignment and function description
>sp|P84232|H32_PORAF Histone H3.2 OS=Poroderma africanum PE=1 SV=2 Back     alignment and function description
>sp|P84234|H32_ONCMY Histone H3.2 OS=Oncorhynchus mykiss PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
391344330412 PREDICTED: uncharacterized protein LOC10 0.806 0.648 0.842 1e-121
449436665274 PREDICTED: uncharacterized protein LOC10 0.456 0.551 0.830 4e-73
432892305250 PREDICTED: histone H3.3-like [Oryzias la 0.456 0.604 0.789 2e-71
156350379229 predicted protein [Nematostella vectensi 0.398 0.576 0.874 1e-65
301628156255 PREDICTED: histone H3.2-like [Xenopus (S 0.670 0.870 0.593 3e-63
301629548255 PREDICTED: histone H3.2-like [Xenopus (S 0.670 0.870 0.593 4e-63
301792130255 PREDICTED: histone H3.2-like [Ailuropoda 0.673 0.874 0.575 6e-63
297802114229 F10A5.19 [Arabidopsis lyrata subsp. lyra 0.398 0.576 0.834 1e-62
410932775221 PREDICTED: histone H3.2-like, partial [T 0.465 0.696 0.805 2e-62
391344312277 PREDICTED: uncharacterized protein LOC10 0.368 0.440 0.975 4e-62
>gi|391344330|ref|XP_003746454.1| PREDICTED: uncharacterized protein LOC100903667 [Metaseiulus occidentalis] Back     alignment and taxonomy information
 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 252/286 (88%), Gaps = 19/286 (6%)

Query: 45  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 104
           MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 105 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTA 164
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR T 
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 165 RKSTGGKAPRK-QLATKAARKSAPATGGVKKPLLNKLLSGVTIAQGGRGKGGKAKTKSKT 223
                   P+  QLA +           ++    + +L+  TI   GRGKGGKAK+K+KT
Sbjct: 121 -------MPKDIQLARR-----------IRGEQQSSVLNSRTINMSGRGKGGKAKSKAKT 162

Query: 224 RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKT 283
           RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAV+EYLAAEVLELAGNAARDNKKT
Sbjct: 163 RSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKT 222

Query: 284 RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 329
           RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKT+K
Sbjct: 223 RIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTDK 268




Source: Metaseiulus occidentalis

Species: Metaseiulus occidentalis

Genus: Metaseiulus

Family: Phytoseiidae

Order: Mesostigmata

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|449436665|ref|XP_004136113.1| PREDICTED: uncharacterized protein LOC101209420 [Cucumis sativus] Back     alignment and taxonomy information
>gi|432892305|ref|XP_004075755.1| PREDICTED: histone H3.3-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|156350379|ref|XP_001622258.1| predicted protein [Nematostella vectensis] gi|156208747|gb|EDO30158.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|301628156|ref|XP_002943224.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|301629548|ref|XP_002943900.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis] gi|301631762|ref|XP_002944963.1| PREDICTED: histone H3.2-like isoform 1 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|301792130|ref|XP_002931030.1| PREDICTED: histone H3.2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|297802114|ref|XP_002868941.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] gi|297314777|gb|EFH45200.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|410932775|ref|XP_003979768.1| PREDICTED: histone H3.2-like, partial [Takifugu rubripes] Back     alignment and taxonomy information
>gi|391344312|ref|XP_003746445.1| PREDICTED: uncharacterized protein LOC100902368 [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
UNIPROTKB|G1K331143 LOC768333 "Histone H3" [Gallus 0.365 0.846 0.983 1.7e-57
UNIPROTKB|G1K329142 LOC768333 "Histone H3" [Gallus 0.362 0.845 0.983 4.6e-57
UNIPROTKB|G3MYD7136 LOC100297725 "Histone H3" [Bos 0.359 0.875 0.949 5.4e-57
FB|FBgn0051613136 His3:CG31613 "His3:CG31613" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053803136 His3:CG33803 "His3:CG33803" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053806136 His3:CG33806 "His3:CG33806" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053809136 His3:CG33809 "His3:CG33809" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053812136 His3:CG33812 "His3:CG33812" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053815136 His3:CG33815 "His3:CG33815" [D 0.359 0.875 0.991 5.9e-57
FB|FBgn0053818136 His3:CG33818 "His3:CG33818" [D 0.359 0.875 0.991 5.9e-57
UNIPROTKB|G1K331 LOC768333 "Histone H3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 591 (213.1 bits), Expect = 1.7e-57, P = 1.7e-57
 Identities = 119/121 (98%), Positives = 120/121 (99%)

Query:    43 SSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 102
             S+MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
Sbjct:     6 SAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 65

Query:   103 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQ 162
             TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 
Sbjct:    66 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 125

Query:   163 T 163
             T
Sbjct:   126 T 126


GO:0006334 "nucleosome assembly" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
UNIPROTKB|G1K329 LOC768333 "Histone H3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYD7 LOC100297725 "Histone H3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84235H3_PLADUNo assigned EC number0.99150.35950.875N/AN/A
P84234H32_ONCMYNo assigned EC number0.99150.35950.875N/AN/A
P84237H3_TIGCANo assigned EC number0.99150.35950.875N/AN/A
P84236H3_DROHYNo assigned EC number0.99150.35950.875N/AN/A
P84231H32_ICTBUNo assigned EC number0.99150.35950.875N/AN/A
Q71DI3H32_HUMANNo assigned EC number0.99150.35950.875yesN/A
P84233H32_XENLANo assigned EC number0.99150.35950.875N/AN/A
P84232H32_PORAFNo assigned EC number0.99150.35950.875N/AN/A
Q64400H32_CRILONo assigned EC number0.98310.35950.875N/AN/A
P84239H3_URECANo assigned EC number0.99150.35950.875N/AN/A
P84238H3_CHITHNo assigned EC number0.99150.35950.875N/AN/A
P19178H2A_PLADUNo assigned EC number0.98330.36250.9677N/AN/A
P69078H3_SOLSTNo assigned EC number0.98310.35950.875N/AN/A
Q6LBF0H31_MUSPANo assigned EC number0.98310.35950.875N/AN/A
Q6LED0H31_RATNo assigned EC number0.98310.35950.875noN/A
P69072H3_LYTPINo assigned EC number0.98310.35950.875N/AN/A
P69073H3_PARLINo assigned EC number0.98310.35950.875N/AN/A
P69071H3_DERIMNo assigned EC number0.98310.35950.875N/AN/A
P69076H3_PSAMINo assigned EC number0.98310.35950.875N/AN/A
P69077H3_PYCHENo assigned EC number0.98310.35950.875N/AN/A
P69074H3_PISBRNo assigned EC number0.98310.35950.875N/AN/A
P84230H32_CAIMONo assigned EC number0.99150.35950.875N/AN/A
P84244H33_MOUSENo assigned EC number0.95790.35950.875yesN/A
Q6P823H33_XENTRNo assigned EC number0.95790.35950.875noN/A
P08898H3_CAEELNo assigned EC number0.95790.35950.875yesN/A
Q4QRF4H32_DANRENo assigned EC number0.99150.35950.875yesN/A
Q71LE2H33_PIGNo assigned EC number0.95790.35950.875yesN/A
P69079H3_STRDRNo assigned EC number0.98310.35950.875N/AN/A
P84245H33_RATNo assigned EC number0.95790.35950.875noN/A
P84246H33_RABITNo assigned EC number0.95790.35950.875noN/A
P84250H33_DROHYNo assigned EC number0.95790.35950.875N/AN/A
Q28D37H32_XENTRNo assigned EC number0.99150.35950.875noN/A
P84243H33_HUMANNo assigned EC number0.95790.35950.875yesN/A
P69075H3_PISOCNo assigned EC number0.98310.35950.875N/AN/A
P84248H33_SPISONo assigned EC number0.95790.35950.875N/AN/A
P84249H33_DROMENo assigned EC number0.95790.35950.875yesN/A
P02299H3_DROMENo assigned EC number0.99150.35950.875yesN/A
P84227H32_BOVINNo assigned EC number0.99150.35950.875yesN/A
P84228H32_MOUSENo assigned EC number0.99150.35950.875yesN/A
P84229H32_CHICKNo assigned EC number0.99150.35950.875yesN/A
Q6LBE8H32_MUSPANo assigned EC number0.99150.35950.875N/AN/A
Q6PI20H33_DANRENo assigned EC number0.95790.35950.875yesN/A
P06352H3_STRPUNo assigned EC number0.97470.30210.7352yesN/A
Q16695H31T_HUMANNo assigned EC number0.94950.35950.875yesN/A
Q6PI79H33_XENLANo assigned EC number0.95790.35950.875N/AN/A
P68431H31_HUMANNo assigned EC number0.98310.35950.875yesN/A
P68433H31_MOUSENo assigned EC number0.98310.35950.875yesN/A
P68432H31_BOVINNo assigned EC number0.98310.35950.875yesN/A
P08903H32_ENCALNo assigned EC number0.96630.35950.875N/AN/A
P22843H3_ACRFONo assigned EC number0.97470.35950.875N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 1e-70
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 3e-63
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 2e-61
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 4e-61
smart00414106 smart00414, H2A, Histone 2A 8e-61
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 9e-61
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 8e-54
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 4e-50
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 9e-48
smart00428105 smart00428, H3, Histone H3 4e-45
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 6e-35
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 4e-32
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 5e-26
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 2e-23
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 7e-22
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 1e-20
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 1e-20
PLN0015558 PLN00155, PLN00155, histone H2A; Provisional 1e-14
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 3e-11
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 3e-10
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 3e-04
PRK149001052 PRK14900, valS, valyl-tRNA synthetase; Provisional 5e-04
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information
 Score =  215 bits (549), Expect = 1e-70
 Identities = 113/119 (94%), Positives = 117/119 (98%)

Query: 45  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 104
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIRRYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 105 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQT 163
           LLIRKLPFQRLVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKR T
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT 119


Length = 136

>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN00161135 histone H3; Provisional 100.0
PLN00153129 histone H2A; Provisional 100.0
KOG1745|consensus137 100.0
PLN00157132 histone H2A; Provisional 100.0
PLN00156139 histone H2AX; Provisional 100.0
PTZ00017134 histone H2A; Provisional 100.0
PTZ00252134 histone H2A; Provisional 100.0
KOG1756|consensus131 100.0
PLN00154136 histone H2A; Provisional 100.0
smart00414106 H2A Histone 2A. 100.0
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 100.0
PLN0016097 histone H3; Provisional 100.0
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 100.0
smart00428105 H3 Histone H3. 100.0
KOG1757|consensus131 100.0
PLN0015558 histone H2A; Provisional 99.84
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.82
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.6
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.32
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.18
KOG1659|consensus 224 98.8
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.54
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 98.44
PLN00035103 histone H4; Provisional 98.24
PTZ00018136 histone H3; Provisional 98.16
PLN00121136 histone H3; Provisional 98.16
PLN00161135 histone H3; Provisional 97.74
PTZ00015102 histone H4; Provisional 97.71
smart0080365 TAF TATA box binding protein associated factor. TA 97.56
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 97.33
smart0041774 H4 Histone H4. 97.31
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 97.28
KOG1657|consensus236 97.18
cd0007685 H4 Histone H4, one of the four histones, along wit 97.09
cd0007685 H4 Histone H4, one of the four histones, along wit 97.05
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 96.97
KOG0870|consensus172 96.96
KOG1745|consensus137 96.87
smart0080365 TAF TATA box binding protein associated factor. TA 96.85
PTZ00015102 histone H4; Provisional 96.83
PLN00035103 histone H4; Provisional 96.8
smart0041774 H4 Histone H4. 96.64
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 96.29
PTZ00463117 histone H2B; Provisional 96.05
PLN00158116 histone H2B; Provisional 95.88
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 95.86
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 95.55
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 95.44
smart0042789 H2B Histone H2B. 95.3
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 94.65
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 94.47
KOG3219|consensus195 94.34
PF0296966 TAF: TATA box binding protein associated factor (T 93.97
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 93.84
smart0057677 BTP Bromodomain transcription factors and PHD doma 93.32
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 93.15
PF0296966 TAF: TATA box binding protein associated factor (T 92.18
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 91.99
smart00428105 H3 Histone H3. 90.65
smart0057677 BTP Bromodomain transcription factors and PHD doma 90.41
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 89.29
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 88.54
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 88.01
KOG1744|consensus127 86.29
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 84.27
KOG1142|consensus258 83.88
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 83.46
>PTZ00018 histone H3; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.3e-50  Score=343.67  Aligned_cols=133  Identities=87%  Similarity=1.185  Sum_probs=125.9

Q ss_pred             ccccccccccccCCCCCcchhhhhhhhcCCCCCCCCCCCCccCCCcchhhhhhhhccchhhhhccCchhHHHHHHHhhcc
Q psy7425          45 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK  124 (331)
Q Consensus        45 MARtKqtarkstg~kaprk~~a~k~~~k~~p~~~~~~~~~r~~pg~~al~EIr~yq~st~lli~k~pF~rlvrei~~~~~  124 (331)
                      |||||+++++++++++|+++.+.++++++.+.+++.++++||+||++||+|||+||+||+|||||+||+||||||+++|.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999988888887777888999999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHhhhhhhhhhhhcCceeeecCCCCCCchHHHHHHHHh
Q psy7425         125 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLATKAAR  183 (331)
Q Consensus       125 ~~~r~~~~al~aLQea~E~~lv~lfed~~lca~HakRvTi~~~d~~~a~~~~~~~~~~~  183 (331)
                      +++|||++||+|||||+|+|||+||||+|+|++||||||||++      |||||.++..
T Consensus        81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~k------D~~L~~rirg  133 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPK------DIQLARRIRG  133 (136)
T ss_pred             CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchh------hHHHHHHhcc
Confidence            9999999999999999999999999999999999999999998      5688876643



>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>KOG1657|consensus Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG3219|consensus Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>KOG1744|consensus Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
3av1_A139 The Human Nucleosome Structure Containing The Histo 4e-64
3av1_A139 The Human Nucleosome Structure Containing The Histo 1e-11
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 1e-63
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 9e-12
3afa_A139 The Human Nucleosome Structure Length = 139 1e-63
3afa_A139 The Human Nucleosome Structure Length = 139 1e-11
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-63
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-12
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 3e-63
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 9e-12
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 3e-63
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-12
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 3e-63
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-12
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 3e-63
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-12
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 3e-63
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 9e-12
3lel_A136 Structural Insight Into The Sequence-Dependence Of 3e-63
3lel_A136 Structural Insight Into The Sequence-Dependence Of 8e-12
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 7e-63
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 1e-11
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 2e-62
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 9e-12
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 2e-62
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 6e-11
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 4e-62
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 2e-11
3av2_A139 The Human Nucleosome Structure Containing The Histo 4e-62
3av2_A139 The Human Nucleosome Structure Containing The Histo 2e-11
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 5e-62
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 9e-12
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 5e-62
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 8e-12
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 1e-61
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 2e-11
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 5e-61
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 2e-10
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 7e-61
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-10
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-60
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-10
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-60
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-10
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 2e-60
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 9e-12
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-60
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-10
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-60
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-10
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-60
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 4e-10
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 5e-60
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 2e-11
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 1e-58
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 2e-11
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 7e-58
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 2e-11
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 1e-57
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 4e-11
2nqb_C123 Drosophila Nucleosome Structure Length = 123 3e-54
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 4e-53
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 2e-11
2pyo_C120 Drosophila Nucleosome Core Length = 120 8e-53
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 7e-52
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 5e-50
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 6e-50
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 6e-50
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 6e-50
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 7e-50
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 8e-50
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 1e-49
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 1e-49
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 6e-49
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 2e-48
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 4e-48
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 5e-48
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 4e-47
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 3e-45
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-42
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 1e-41
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 2e-40
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 1e-38
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 1e-32
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 1e-27
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 2e-27
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 2e-27
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 4e-25
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 3e-24
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 2e-21
2l5a_A235 Structural Basis For Recognition Of Centromere Spec 3e-18
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 1e-17
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 1e-17
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 2e-17
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 3e-15
3nqj_A82 Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len 5e-12
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 1e-08
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 1e-08
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 6e-07
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 8e-08
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 8e-08
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 2e-06
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 8e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 8e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 2e-06
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 1e-07
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 1e-07
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 2e-06
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 1e-05
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 1e-05
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 2e-04
1q9c_A191 Crystal Structure Of The Histone Domain Of Son Of S 2e-05
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 5e-05
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 5e-05
2p5b_I22 The Complex Structure Of Jmjd2a And Trimethylated H 7e-05
3ksy_A 1049 Crystal Structure Of The Histone Domain, Dh-Ph Unit 2e-04
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 3e-04
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 3e-04
2x4w_B21 Molecular Basis Of Histone H3k36me3 Recognition By 3e-04
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 3e-04
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 3e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 6e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 6e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 6e-04
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure

Iteration: 1

Score = 241 bits (615), Expect = 4e-64, Method: Compositional matrix adjust. Identities = 119/121 (98%), Positives = 119/121 (98%) Query: 43 SSMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 102 S MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS Sbjct: 2 SHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS 61 Query: 103 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQ 162 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR Sbjct: 62 TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV 121 Query: 163 T 163 T Sbjct: 122 T 122
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 Back     alignment and structure
>pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 7e-47
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 1e-45
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 4e-45
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 4e-45
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 5e-42
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 5e-38
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 6e-36
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 3e-04
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 8e-30
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 5e-29
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 4e-26
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 1e-25
3r45_A156 Histone H3-like centromeric protein A; histone fol 1e-24
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 2e-20
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 2e-19
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 8e-19
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 1e-08
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 2e-08
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 2e-04
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
 Score =  153 bits (388), Expect = 7e-47
 Identities = 117/122 (95%), Positives = 120/122 (98%)

Query: 210 GRGKGGKAKTKSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 269
           GRGKGGK K K+K+RS+RAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV
Sbjct: 2   GRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEV 61

Query: 270 LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 329
           LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK
Sbjct: 62  LELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEK 121

Query: 330 KA 331
           KA
Sbjct: 122 KA 123


>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 100.0
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 100.0
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 100.0
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 100.0
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 100.0
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 100.0
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 100.0
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.97
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.97
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.95
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.87
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.81
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.67
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.65
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.63
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.62
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.51
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.48
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.46
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.36
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.22
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 99.07
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 98.58
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.44
2r10_A361 Chromatin structure-remodeling complex protein RSC 98.27
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 98.19
2r10_A361 Chromatin structure-remodeling complex protein RSC 98.16
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 98.15
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 98.02
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.97
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 97.63
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 97.62
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 97.61
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 97.59
1f1e_A154 Histone fold protein; archaeal histone protein, DN 97.54
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 97.51
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 97.22
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.21
1taf_B70 TFIID TBP associated factor 62; transcription init 97.21
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 97.2
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 97.2
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 97.09
3r45_A156 Histone H3-like centromeric protein A; histone fol 97.01
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 97.01
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 96.86
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 96.86
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 96.68
1taf_A68 TFIID TBP associated factor 42; transcription init 96.65
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 96.65
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 96.51
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 96.48
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 96.36
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 96.33
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 96.31
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 96.31
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 96.29
1taf_A68 TFIID TBP associated factor 42; transcription init 96.28
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 96.26
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 96.19
1taf_B70 TFIID TBP associated factor 62; transcription init 95.73
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 95.61
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 95.33
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 95.18
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 94.72
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 94.64
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 94.51
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 94.32
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 94.25
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 94.25
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 94.2
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 94.13
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 93.95
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 93.76
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 92.12
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 91.7
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 91.29
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 90.88
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 90.87
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 90.75
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 90.64
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 90.56
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 90.42
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 89.7
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 88.81
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 83.97
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 83.68
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
Probab=100.00  E-value=3.3e-54  Score=368.18  Aligned_cols=135  Identities=90%  Similarity=1.185  Sum_probs=91.0

Q ss_pred             ccccccccccccCCCCCcchhhhhhhhcCCCCCCCCCCCCccCCCcchhhhhhhhccchhhhhccCchhHHHHHHHhhcc
Q psy7425          45 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK  124 (331)
Q Consensus        45 MARtKqtarkstg~kaprk~~a~k~~~k~~p~~~~~~~~~r~~pg~~al~EIr~yq~st~lli~k~pF~rlvrei~~~~~  124 (331)
                      ||||||+|++++||++|++++++++++++.|.+++++++|||+||+++|+|||+||+||+|||||+||+||||||+++|.
T Consensus         1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~   80 (136)
T 1tzy_C            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_dssp             -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHhhhhhhhhhhhcCceeeecCCCCCCchHHHHHHHHhcc
Q psy7425         125 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRQTARKSTGGKAPRKQLATKAARKS  185 (331)
Q Consensus       125 ~~~r~~~~al~aLQea~E~~lv~lfed~~lca~HakRvTi~~~d~~~a~~~~~~~~~~~~~  185 (331)
                      +++|||++||+|||||+|+|||+||||+|+||+||+|||||++      |||||.++....
T Consensus        81 ~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~k------DiqLa~rirg~~  135 (136)
T 1tzy_C           81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPK------DIQLARRIRGER  135 (136)
T ss_dssp             TTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHH------HHHHHHHHHTCC
T ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHH------hHHHHHHHhCcC
Confidence            9999999999999999999999999999999999999999997      999999886543



>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 6e-59
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 1e-57
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 2e-49
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 2e-43
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 9e-42
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 5e-20
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 1e-18
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 4e-12
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 2e-09
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-04
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
 Score =  183 bits (465), Expect = 6e-59
 Identities = 98/106 (92%), Positives = 103/106 (97%)

Query: 220 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARD 279
           K+K+RSSRAGLQFPVGR+HRLLRKGNYAERVGAGAPVYLAAV+EYL AE+LELAGNAARD
Sbjct: 1   KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARD 60

Query: 280 NKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPK 325
           NKKTRIIPRHLQLAIRNDEELNKLL  VTIAQGGVLPNIQAVLLPK
Sbjct: 61  NKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK 106


>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 100.0
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 100.0
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.94
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.58
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.43
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.24
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.56
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 98.47
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.46
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 98.43
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.19
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 98.1
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 98.06
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 97.86
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.67
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 97.64
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 96.95
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 96.89
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 96.8
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 96.74
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 96.69
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 96.53
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 95.94
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 94.73
d1q9ca_172 Histone domain of Son of sevenless protein {Human 93.81
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 90.29
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 89.91
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 88.26
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 85.95
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 82.97
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 82.22
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00  E-value=4e-45  Score=298.04  Aligned_cols=106  Identities=92%  Similarity=1.329  Sum_probs=104.0

Q ss_pred             cCccccccCCcccchhhHHHhhhcCCcccccCCChhHHHHHHHHHHHHHHHHHHhhHHhhcCCcccchHHHHHHhhCcHH
Q psy7425         220 KSKTRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEE  299 (331)
Q Consensus       220 ~~~srs~ragL~FPVsri~R~Lk~~~~~~Rvs~~A~VyLaAvLEYL~aEILelAg~~A~~~~k~rItP~hi~~AI~nDeE  299 (331)
                      |..|+|+|||||||||||+|+|++++|++||+++|||||+||||||++||||||||+|+++++++|+|+||++||+||+|
T Consensus         1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDee   80 (106)
T d1tzya_           1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE   80 (106)
T ss_dssp             CCCCHHHHHTCSSCHHHHHHHHHHTTSSSEECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHH
T ss_pred             CCccccccCCccCChHHHHHHHHcCccccccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHH
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhcCcEecCCcccCCcccccCCc
Q psy7425         300 LNKLLSGVTIAQGGVLPNIQAVLLPK  325 (331)
Q Consensus       300 L~~L~~~~tia~gGv~p~i~~~l~~~  325 (331)
                      |+.||+++||++|||+|+||++||||
T Consensus        81 L~~L~~~vtI~~GGv~P~Ih~~Llpk  106 (106)
T d1tzya_          81 LNKLLGKVTIAQGGVLPNIQAVLLPK  106 (106)
T ss_dssp             HHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred             HHHHHcCCeecCCCccCccCHhhcCC
Confidence            99999999999999999999999986



>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure