Psyllid ID: psy7427

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MSPHVHVAYTHNTCTRSTRDDYRSHSHRDIVKKNRETQVYKAGTGPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGIEIKPSQSSSNFK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEcccccccccc
ccccEEEEEEccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEcccccccccc
msphvhvaythntctrstrddyrshshrDIVKKNREtqvykagtgperdashrwvqtHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFedtnlcaihakrgydasasvgstkkpamtpQMQMIIWGieikpsqsssnfk
MSPHVHVAythntctrstrddyrshshrdivkknretqvykagtgperdashrwvQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGieikpsqsssnfk
MSPHVHVAYTHNTCTRSTRDDYRSHSHRDIVKKNRETQVYKAGTGPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGIEIKPSQSSSNFK
***************************************************HRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYD****************MQMIIWGIEI**********
********************************************GPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGIEIKP********
MSPHVHVAYTHNTCTRS*********HRDIVKKNRETQVYKAGTGPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGIEIKP********
***HVHVAYTHN**********************RETQVYKAGTGPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGY*************MTPQMQMIIWGIEIKP********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPHVHVAYTHNTCTRSTRDDYRSHSHRDIVKKNRETQVYKAGTGPERDASHRWVQTHRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDASASVGSTKKPAMTPQMQMIIWGIEIKPSQSSSNFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q64400136 Histone H3.2 OS=Cricetulu N/A N/A 0.311 0.345 1.0 1e-21
P84239136 Histone H3 OS=Urechis cau N/A N/A 0.311 0.345 1.0 1e-21
P84237136 Histone H3 OS=Tigriopus c N/A N/A 0.311 0.345 1.0 1e-21
P84235136 Histone H3 OS=Platynereis N/A N/A 0.311 0.345 1.0 1e-21
P02299136 Histone H3 OS=Drosophila yes N/A 0.311 0.345 1.0 1e-21
P84236136 Histone H3 OS=Drosophila N/A N/A 0.311 0.345 1.0 1e-21
P84238136 Histone H3 OS=Chironomus N/A N/A 0.311 0.345 1.0 1e-21
Q28D37136 Histone H3.2 OS=Xenopus t no N/A 0.311 0.345 1.0 1e-21
P84233136 Histone H3.2 OS=Xenopus l N/A N/A 0.311 0.345 1.0 1e-21
P84232136 Histone H3.2 OS=Poroderma N/A N/A 0.311 0.345 1.0 1e-21
>sp|Q64400|H32_CRILO Histone H3.2 OS=Cricetulus longicaudatus PE=2 SV=3 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%)

Query: 66  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 112
           LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR
Sbjct: 71  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 117
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Cricetulus longicaudatus (taxid: 10030)
>sp|P84239|H3_URECA Histone H3 OS=Urechis caupo PE=1 SV=2 Back     alignment and function description
>sp|P84237|H3_TIGCA Histone H3 OS=Tigriopus californicus PE=3 SV=2 Back     alignment and function description
>sp|P84235|H3_PLADU Histone H3 OS=Platynereis dumerilii PE=3 SV=2 Back     alignment and function description
>sp|P02299|H3_DROME Histone H3 OS=Drosophila melanogaster GN=His3 PE=1 SV=4 Back     alignment and function description
>sp|P84236|H3_DROHY Histone H3 OS=Drosophila hydei GN=His3 PE=3 SV=2 Back     alignment and function description
>sp|P84238|H3_CHITH Histone H3 OS=Chironomus thummi thummi PE=3 SV=2 Back     alignment and function description
>sp|Q28D37|H32_XENTR Histone H3.2 OS=Xenopus tropicalis GN=TGas081o10.1 PE=2 SV=3 Back     alignment and function description
>sp|P84233|H32_XENLA Histone H3.2 OS=Xenopus laevis PE=1 SV=2 Back     alignment and function description
>sp|P84232|H32_PORAF Histone H3.2 OS=Poroderma africanum PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
156350379229 predicted protein [Nematostella vectensi 0.576 0.379 0.648 1e-21
156375346138 predicted protein [Nematostella vectensi 0.337 0.369 0.960 2e-20
195363997136 GM25125 [Drosophila sechellia] gi|194131 0.483 0.536 0.710 2e-20
426398248135 histone H3, partial [Plectorhinchus medi 0.483 0.540 0.697 3e-20
293612152109 histone H3 [Liotiinae sp. SWA-2010] 0.483 0.669 0.710 3e-20
209970242109 histone H3 [Moroteuthis robusta] 0.543 0.752 0.640 3e-20
301628156 255 PREDICTED: histone H3.2-like [Xenopus (S 0.311 0.184 1.0 4e-20
410933283 271 PREDICTED: uncharacterized protein LOC10 0.311 0.173 1.0 4e-20
293612144109 histone H3 [Astralium milloni] gi|293612 0.483 0.669 0.710 4e-20
301792130 255 PREDICTED: histone H3.2-like [Ailuropoda 0.311 0.184 1.0 4e-20
>gi|156350379|ref|XP_001622258.1| predicted protein [Nematostella vectensis] gi|156208747|gb|EDO30158.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/91 (64%), Positives = 64/91 (70%), Gaps = 4/91 (4%)

Query: 40  YKAGTGPERDASHRWVQTHRVTQVLS---LVREIAQDFKTDLRFQSSAVMALQEASEAYL 96
           Y+ GT   R+       T  + + L    LVREIAQDFKTDLRFQSSAVMALQEASEAYL
Sbjct: 42  YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 101

Query: 97  VGLFEDTNLCAIHAKRGYDASA-SVGSTKKP 126
           VGLFEDTNLCAIHAKR    SA + G  KKP
Sbjct: 102 VGLFEDTNLCAIHAKRAARKSAPATGGVKKP 132

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|156375346|ref|XP_001630042.1| predicted protein [Nematostella vectensis] gi|156217055|gb|EDO37979.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|195363997|ref|XP_002045602.1| GM25125 [Drosophila sechellia] gi|194131785|gb|EDW53725.1| GM25125 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|426398248|gb|AFY26267.1| histone H3, partial [Plectorhinchus mediterraneus] Back     alignment and taxonomy information
>gi|293612152|gb|ADE48503.1| histone H3 [Liotiinae sp. SWA-2010] Back     alignment and taxonomy information
>gi|209970242|gb|ACJ02927.1| histone H3 [Moroteuthis robusta] Back     alignment and taxonomy information
>gi|301628156|ref|XP_002943224.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|410933283|ref|XP_003980021.1| PREDICTED: uncharacterized protein LOC101068669 [Takifugu rubripes] Back     alignment and taxonomy information
>gi|293612144|gb|ADE48499.1| histone H3 [Astralium milloni] gi|293612150|gb|ADE48502.1| histone H3 [Tegula fasciata] Back     alignment and taxonomy information
>gi|301792130|ref|XP_002931030.1| PREDICTED: histone H3.2-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
FB|FBgn0051613136 His3:CG31613 "His3:CG31613" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053803136 His3:CG33803 "His3:CG33803" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053806136 His3:CG33806 "His3:CG33806" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053809136 His3:CG33809 "His3:CG33809" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053812136 His3:CG33812 "His3:CG33812" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053815136 His3:CG33815 "His3:CG33815" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053818136 His3:CG33818 "His3:CG33818" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053821136 His3:CG33821 "His3:CG33821" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053824136 His3:CG33824 "His3:CG33824" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0053827136 His3:CG33827 "His3:CG33827" [D 0.483 0.536 0.697 1.2e-19
FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 1.2e-19, P = 1.2e-19
 Identities = 53/76 (69%), Positives = 57/76 (75%)

Query:    40 YKAGTGPERDASHRWVQTHRVTQVLS---LVREIAQDFKTDLRFQSSAVMALQEASEAYL 96
             Y+ GT   R+       T  + + L    LVREIAQDFKTDLRFQSSAVMALQEASEAYL
Sbjct:    42 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 101

Query:    97 VGLFEDTNLCAIHAKR 112
             VGLFEDTNLCAIHAKR
Sbjct:   102 VGLFEDTNLCAIHAKR 117
GO:0006334 "nucleosome assembly" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0000786 "nucleosome" evidence=ISS
GO:0046982 "protein heterodimerization activity" evidence=IEA
FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053821 His3:CG33821 "His3:CG33821" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053824 His3:CG33824 "His3:CG33824" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053827 His3:CG33827 "His3:CG33827" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P68431H31_HUMANNo assigned EC number0.68420.48340.5367yesN/A
P68433H31_MOUSENo assigned EC number0.68420.48340.5367yesN/A
P68432H31_BOVINNo assigned EC number0.68420.48340.5367yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 3e-28
smart00428105 smart00428, H3, Histone H3 3e-25
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 3e-24
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 3e-15
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 6e-14
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 2e-11
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 3e-11
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information 
 Score =  101 bits (252), Expect = 3e-28
 Identities = 45/47 (95%), Positives = 47/47 (100%)

Query: 66  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 112
           LVREIAQDFKTDLRFQSSAV+ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct: 71  LVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKR 117

Length = 136
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
PLN00161135 histone H3; Provisional 100.0
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN0016097 histone H3; Provisional 100.0
smart00428105 H3 Histone H3. 100.0
KOG1745|consensus137 100.0
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.79
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.6
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 99.05
smart0080365 TAF TATA box binding protein associated factor. TA 97.21
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 97.08
cd0007685 H4 Histone H4, one of the four histones, along wit 97.04
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.0
PLN00035103 histone H4; Provisional 96.94
PTZ00015102 histone H4; Provisional 96.58
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 96.5
smart0041774 H4 Histone H4. 96.47
KOG1142|consensus258 96.36
smart0057677 BTP Bromodomain transcription factors and PHD doma 96.26
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 96.22
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 95.66
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 95.58
KOG0870|consensus172 95.22
PF0296966 TAF: TATA box binding protein associated factor (T 93.53
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.19
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 90.35
PF1091177 DUF2717: Protein of unknown function (DUF2717); In 81.61
>PLN00161 histone H3; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-44  Score=281.35  Aligned_cols=90  Identities=41%  Similarity=0.591  Sum_probs=86.4

Q ss_pred             ccccccCCCCchhhhhhhhhhhc---cccchhhHhHHhhhhccc-CccccchHHHHHHHHHHHHHHHhhhhchhhhhhcc
Q psy7427          35 RETQVYKAGTGPERDASHRWVQT---HRVTQVLSLVREIAQDFK-TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA  110 (151)
Q Consensus        35 ~k~~RykPGTvALREIR~~Qkst---~rklPFqRLVREIaq~~~-~~lRfq~~AL~ALQEAAEayLV~LFEdsnLcAiHA  110 (151)
                      ++++|||||||||||||+||++|   |+++||+||||||++++. +++|||++||+|||||+|+|||+||||+||||+||
T Consensus        30 kk~~r~rpGtvaLrEIR~yQkst~lLIpklPF~RLVREI~~~~~~~~~Rfq~~Al~ALQEAsEayLV~lFeda~lcaiHA  109 (135)
T PLN00161         30 KKPHRYRPGTVALREIRKYQKSTELLIRKLPFARLVREISNEMLREPFRWTAEALLALQEATEDFLVHLFEDCNLCAIHA  109 (135)
T ss_pred             CCCccCCCcchHHHHHHHHccccccccccccHHHHHHHHHHhcCCCCcEeeHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            56789999999999999999999   688999999999999996 58999999999999999999999999999999999


Q ss_pred             CcccCCccCCCCCCCCccccCcceee
Q psy7427         111 KRGYDASASVGSTKKPAMTPQMQMII  136 (151)
Q Consensus       111 KRV~~~~~~~~~~~~tl~~~dm~l~~  136 (151)
                      |||            |||++||+|+.
T Consensus       110 kRV------------Tlm~kDm~La~  123 (135)
T PLN00161        110 KRV------------TIMPKDMQLAR  123 (135)
T ss_pred             cCc------------ccchhhHHHHH
Confidence            999            99999999997

>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>KOG1745|consensus Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>KOG1142|consensus Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>KOG0870|consensus Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>PF10911 DUF2717: Protein of unknown function (DUF2717); InterPro: IPR020121 The proteins in this entry are uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 1e-22
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 1e-22
3av1_A139 The Human Nucleosome Structure Containing The Histo 2e-22
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 4e-22
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 6e-22
3afa_A139 The Human Nucleosome Structure Length = 139 6e-22
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-22
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-22
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 6e-22
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 7e-22
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 8e-22
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 8e-22
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 8e-22
3lel_A136 Structural Insight Into The Sequence-Dependence Of 8e-22
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 8e-22
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 9e-22
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 9e-22
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 9e-22
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 9e-22
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 1e-21
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 2e-21
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-21
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 2e-21
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 3e-21
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-21
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 3e-21
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 3e-21
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 4e-21
3av2_A139 The Human Nucleosome Structure Containing The Histo 4e-21
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 1e-20
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 4e-20
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 5e-20
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 5e-19
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 1e-18
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 2e-17
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 3e-13
2l5a_A 235 Structural Basis For Recognition Of Centromere Spec 7e-13
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 7e-12
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 8e-12
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 5e-11
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 9e-07
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 1e-06
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 1e-06
3nqj_A82 Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len 2e-06
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/47 (100%), Positives = 47/47 (100%)
Query: 66  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 112
           LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR
Sbjct: 71  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 117
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 9e-19
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 8e-13
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 7e-10
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 6e-09
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 2e-06
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 4e-06
3r45_A156 Histone H3-like centromeric protein A; histone fol 7e-05
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
 Score = 74.5 bits (183), Expect = 9e-19
 Identities = 46/47 (97%), Positives = 46/47 (97%)

Query: 66  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 112
           LVREIAQDFKTDLRFQSSAVMALQEASEAYLV LFEDTNLCAIHAKR
Sbjct: 12  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKR 58
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.97
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.97
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 99.97
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.93
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.68
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.45
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.1
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 97.55
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 97.53
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 97.53
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 97.51
1taf_A68 TFIID TBP associated factor 42; transcription init 97.5
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 97.47
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 97.43
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 97.41
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 97.35
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 97.2
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 97.09
1f1e_A154 Histone fold protein; archaeal histone protein, DN 96.93
1f1e_A154 Histone fold protein; archaeal histone protein, DN 96.88
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 96.62
1taf_B70 TFIID TBP associated factor 62; transcription init 96.61
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 96.57
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 96.52
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 96.47
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 96.41
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 96.24
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 95.91
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 94.25
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 93.08
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 87.89
2r10_A 361 Chromatin structure-remodeling complex protein RSC 86.02
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 84.86
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 84.78
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 83.99
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 82.55
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 82.01
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
Probab=100.00  E-value=5.3e-46  Score=274.85  Aligned_cols=90  Identities=43%  Similarity=0.506  Sum_probs=63.2

Q ss_pred             ccccccCCCCchhhhhhhhhhhc---cccchhhHhHHhhhhcccC---ccccchHHHHHHHHHHHHHHHhhhhchhhhhh
Q psy7427          35 RETQVYKAGTGPERDASHRWVQT---HRVTQVLSLVREIAQDFKT---DLRFQSSAVMALQEASEAYLVGLFEDTNLCAI  108 (151)
Q Consensus        35 ~k~~RykPGTvALREIR~~Qkst---~rklPFqRLVREIaq~~~~---~lRfq~~AL~ALQEAAEayLV~LFEdsnLcAi  108 (151)
                      +++|||+|||+||+|||+||++|   ++++||+||||||+++|++   ++|||++|+.|||||+|+|||+||||+|+||+
T Consensus         2 ~~~~r~rpgt~alrEIr~yQkst~llIpk~PF~RLVREI~~~~~~~~~~~R~q~~Al~ALQeaaEayLv~Lfeda~l~A~   81 (100)
T 2yfv_A            2 ARGTRYKPTDLALAEIRKYQRSTDLLISRMPFARLVKEVTDQFTTESEPLRWQSMAIMALQEASEAYLVGLLEHTNLLAL   81 (100)
T ss_dssp             --------------------------CCHHHHHHHHHHHHHTTC-----CEECHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCcchHHHHHHhhcccchhhhccccHHHHHHHHHHHhccccchhhccHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46889999999999999999999   6889999999999999987   89999999999999999999999999999999


Q ss_pred             ccCcccCCccCCCCCCCCccccCcceee
Q psy7427         109 HAKRGYDASASVGSTKKPAMTPQMQMII  136 (151)
Q Consensus       109 HAKRV~~~~~~~~~~~~tl~~~dm~l~~  136 (151)
                      |||||            |||++||+|+.
T Consensus        82 HAkRv------------Ti~~kDiqLa~   97 (100)
T 2yfv_A           82 HAKRI------------TIMRKDMQLAR   97 (100)
T ss_dssp             HTTCS------------EECHHHHHHHH
T ss_pred             HcCCc------------cCCHHHHHHHH
Confidence            99999            99999999985
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 2e-22
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 3e-04
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score = 83.3 bits (206), Expect = 2e-22
 Identities = 47/47 (100%), Positives = 47/47 (100%)

Query: 66  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 112
           LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR
Sbjct: 30  LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKR 76
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.5
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 98.16
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 97.95
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.44
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 96.98
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 96.72
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 96.51
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 96.23
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 96.17
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 95.64
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 95.42
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 94.95
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 91.17
d1q9ca_172 Histone domain of Son of sevenless protein {Human 89.54
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=5.1e-43  Score=255.17  Aligned_cols=85  Identities=65%  Similarity=0.821  Sum_probs=83.0

Q ss_pred             cCCCCchhhhhhhhhhhc---cccchhhHhHHhhhhcccCccccchHHHHHHHHHHHHHHHhhhhchhhhhhccCcccCC
Q psy7427          40 YKAGTGPERDASHRWVQT---HRVTQVLSLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRGYDA  116 (151)
Q Consensus        40 ykPGTvALREIR~~Qkst---~rklPFqRLVREIaq~~~~~lRfq~~AL~ALQEAAEayLV~LFEdsnLcAiHAKRV~~~  116 (151)
                      |||||+||||||+||+++   ++++||+||||||++++++++|||++||+|||||+|+|||+||||+|+||+|||||   
T Consensus         1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRv---   77 (95)
T d1tzyc_           1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV---   77 (95)
T ss_dssp             CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCS---
T ss_pred             CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCC---
Confidence            899999999999999999   57889999999999999999999999999999999999999999999999999999   


Q ss_pred             ccCCCCCCCCccccCcceee
Q psy7427         117 SASVGSTKKPAMTPQMQMII  136 (151)
Q Consensus       117 ~~~~~~~~~tl~~~dm~l~~  136 (151)
                               |||++||+|+.
T Consensus        78 ---------Tl~~kD~~Lar   88 (95)
T d1tzyc_          78 ---------TIMPKDIQLAR   88 (95)
T ss_dssp             ---------EECHHHHHHHH
T ss_pred             ---------cCCHHHHHHHH
Confidence                     99999999987
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure