Psyllid ID: psy7434

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MRIATGASMVAVAYPNLYPGYMTHAAATIAAMAASQHSAPPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVEP
cccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHc
MRIATGASMVAVaypnlypgymTHAAATIAAMAAsqhsapppkrkrrhrtiftEEQLEQLEATFekthypdvVLREQLALKVdlkeervep
MRIATGASMVAVAYPNLYPGYMTHAAATIAAMAAsqhsapppkrkrrhRTIFTEEQLEQLEAtfekthypdvvLREQLalkvdlkeervep
MRIATGASMVAVAYPNLYPGYmthaaatiaamaasqhsaPPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVEP
*******SMVAVAYPNLYPGYMTHAAATIAA****************************LEATFEKTHYPDVVLREQLALKV*********
**************************************************IFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEE*V**
MRIATGASMVAVAYPNLYPGYMTHAAATIA*****************HRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVD********
************************************************RTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEER***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIATGASMVAVAYPNLYPGYMTHAAATIAAMAASQHSAPPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
P54366419 Homeobox protein goosecoi yes N/A 0.868 0.188 0.512 2e-24
A2T7P4257 Homeobox protein goosecoi N/A N/A 0.527 0.186 0.708 4e-13
A1YFI3257 Homeobox protein goosecoi N/A N/A 0.527 0.186 0.708 4e-13
A2T733257 Homeobox protein goosecoi yes N/A 0.527 0.186 0.708 4e-13
A1YG57257 Homeobox protein goosecoi N/A N/A 0.527 0.186 0.708 4e-13
A1YEY5257 Homeobox protein goosecoi N/A N/A 0.527 0.186 0.708 4e-13
Q02591256 Homeobox protein goosecoi yes N/A 0.527 0.187 0.708 5e-13
P56915257 Homeobox protein goosecoi yes N/A 0.527 0.186 0.708 5e-13
P53545245 Homeobox protein goosecoi yes N/A 0.527 0.195 0.708 6e-13
P53544240 Homeobox protein goosecoi yes N/A 0.527 0.2 0.708 7e-13
>sp|P54366|GSC_DROME Homeobox protein goosecoid OS=Drosophila melanogaster GN=Gsc PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 66/121 (54%), Gaps = 42/121 (34%)

Query: 12  VAYPNLYPGYMT--------------HAAATIAAMAASQHS------------------- 38
           VAYPN YP YM               H +   A ++   H                    
Sbjct: 211 VAYPNFYPNYMHAAAVAHVAAAQMQAHVSGAAAGLSGHGHHPHHPHGHPHHPHLGAHHHG 270

Query: 39  ---------APPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERV 89
                     PPPKRKRRHRTIFTEEQLEQLEATF+KTHYPDVVLREQLALKVDLKEERV
Sbjct: 271 QHHLSHLGHGPPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERV 330

Query: 90  E 90
           E
Sbjct: 331 E 331
Appears to regulate regional development of specific tissues. Can rescue axis polarity in UV-radiated Xenopus embryos.
Drosophila melanogaster (taxid: 7227)
>sp|A2T7P4|GSC_PONPY Homeobox protein goosecoid OS=Pongo pygmaeus GN=GSC PE=3 SV=1 Back     alignment and function description
>sp|A1YFI3|GSC_SAGLB Homeobox protein goosecoid OS=Saguinus labiatus GN=GSC PE=3 SV=1 Back     alignment and function description
>sp|A2T733|GSC_PANTR Homeobox protein goosecoid OS=Pan troglodytes GN=GSC PE=3 SV=1 Back     alignment and function description
>sp|A1YG57|GSC_PANPA Homeobox protein goosecoid OS=Pan paniscus GN=GSC PE=3 SV=1 Back     alignment and function description
>sp|A1YEY5|GSC_GORGO Homeobox protein goosecoid OS=Gorilla gorilla gorilla GN=GSC PE=3 SV=1 Back     alignment and function description
>sp|Q02591|GSC_MOUSE Homeobox protein goosecoid OS=Mus musculus GN=Gsc PE=2 SV=1 Back     alignment and function description
>sp|P56915|GSC_HUMAN Homeobox protein goosecoid OS=Homo sapiens GN=GSC PE=1 SV=2 Back     alignment and function description
>sp|P53545|GSC_CHICK Homeobox protein goosecoid OS=Gallus gallus GN=GSC PE=2 SV=1 Back     alignment and function description
>sp|P53544|GSC_DANRE Homeobox protein goosecoid OS=Danio rerio GN=gsc PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
91090854 318 PREDICTED: similar to homeobox transcrip 0.945 0.270 0.722 4e-25
198473724 527 GA15485 [Drosophila pseudoobscura pseudo 0.868 0.149 0.535 6e-25
195147182 531 GL19249 [Drosophila persimilis] gi|19410 0.868 0.148 0.535 6e-25
193678843 324 PREDICTED: hypothetical protein LOC10016 0.901 0.253 0.677 7e-25
195032852 565 GH10501 [Drosophila grimshawi] gi|193904 0.846 0.136 0.552 8e-25
242022192 210 Homeobox protein ceh-10, putative [Pedic 0.901 0.390 0.653 9e-25
1708053 419 RecName: Full=Homeobox protein goosecoid 0.857 0.186 0.549 3e-24
212288009 424 RT01146p [Drosophila melanogaster] 0.857 0.183 0.549 3e-24
195350153 419 GM16652 [Drosophila sechellia] gi|194123 0.857 0.186 0.549 3e-24
17136854 419 goosecoid, isoform A [Drosophila melanog 0.857 0.186 0.549 3e-24
>gi|91090854|ref|XP_972647.1| PREDICTED: similar to homeobox transcription factor [Tribolium castaneum] gi|270014336|gb|EFA10784.1| goosecoid [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 73/90 (81%), Gaps = 4/90 (4%)

Query: 4   ATGASMVAVAYPNLYPGYMTHAAATIAAMAASQHSAP---PPKRKRRHRTIFTEEQLEQL 60
           A+ A  +A+AYP LYPGY+ HA A  +  A+   S P   PPKRKRRHRTIF+EEQLEQL
Sbjct: 175 ASSADFLAMAYPGLYPGYV-HALAAASQAASMAGSHPQHQPPKRKRRHRTIFSEEQLEQL 233

Query: 61  EATFEKTHYPDVVLREQLALKVDLKEERVE 90
           EATFE+THYPDVVLREQLALKVDLKEERVE
Sbjct: 234 EATFEQTHYPDVVLREQLALKVDLKEERVE 263

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|198473724|ref|XP_001356417.2| GA15485 [Drosophila pseudoobscura pseudoobscura] gi|198138080|gb|EAL33481.2| GA15485 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195147182|ref|XP_002014559.1| GL19249 [Drosophila persimilis] gi|194106512|gb|EDW28555.1| GL19249 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|193678843|ref|XP_001943352.1| PREDICTED: hypothetical protein LOC100162381 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195032852|ref|XP_001988574.1| GH10501 [Drosophila grimshawi] gi|193904574|gb|EDW03441.1| GH10501 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|242022192|ref|XP_002431525.1| Homeobox protein ceh-10, putative [Pediculus humanus corporis] gi|212516819|gb|EEB18787.1| Homeobox protein ceh-10, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|1708053|sp|P54366.1|GSC_DROME RecName: Full=Homeobox protein goosecoid gi|1177383|emb|CAA64699.1| gsc [Drosophila melanogaster] gi|1399587|gb|AAB17948.1| goosecoid [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|212288009|gb|ABI34245.3| RT01146p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195350153|ref|XP_002041606.1| GM16652 [Drosophila sechellia] gi|194123379|gb|EDW45422.1| GM16652 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|17136854|ref|NP_476949.1| goosecoid, isoform A [Drosophila melanogaster] gi|7296181|gb|AAF51473.1| goosecoid, isoform A [Drosophila melanogaster] gi|115646581|gb|ABI34211.2| RT01046p [Drosophila melanogaster] gi|208879498|gb|ACI31294.1| IP21556p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
FB|FBgn0010323419 Gsc "Goosecoid" [Drosophila me 0.560 0.121 0.980 1.6e-25
WB|WBGene00022837229 ceh-45 [Caenorhabditis elegans 0.527 0.209 0.687 4.4e-13
UNIPROTKB|P53545245 GSC "Homeobox protein goosecoi 0.527 0.195 0.708 7.1e-13
UNIPROTKB|E1BB15257 GSC "Uncharacterized protein" 0.527 0.186 0.708 7.1e-13
UNIPROTKB|F1PH84255 GSC "Uncharacterized protein" 0.527 0.188 0.708 7.1e-13
UNIPROTKB|P56915257 GSC "Homeobox protein goosecoi 0.527 0.186 0.708 7.1e-13
UNIPROTKB|F1SCC4256 GSC "Uncharacterized protein" 0.527 0.187 0.708 7.1e-13
UNIPROTKB|A1YEY5257 GSC "Homeobox protein goosecoi 0.527 0.186 0.708 7.1e-13
UNIPROTKB|A1YFI3257 GSC "Homeobox protein goosecoi 0.527 0.186 0.708 7.1e-13
UNIPROTKB|A1YG57257 GSC "Homeobox protein goosecoi 0.527 0.186 0.708 7.1e-13
FB|FBgn0010323 Gsc "Goosecoid" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 1.6e-25, Sum P(2) = 1.6e-25
 Identities = 50/51 (98%), Positives = 51/51 (100%)

Query:    40 PPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVE 90
             PPPKRKRRHRTIFTEEQLEQLEATF+KTHYPDVVLREQLALKVDLKEERVE
Sbjct:   281 PPPKRKRRHRTIFTEEQLEQLEATFDKTHYPDVVLREQLALKVDLKEERVE 331
GO:0005634 "nucleus" evidence=IC;ISS;NAS
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=NAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
WB|WBGene00022837 ceh-45 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P53545 GSC "Homeobox protein goosecoid" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BB15 GSC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PH84 GSC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P56915 GSC "Homeobox protein goosecoid" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCC4 GSC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A1YEY5 GSC "Homeobox protein goosecoid" [Gorilla gorilla gorilla (taxid:9595)] Back     alignment and assigned GO terms
UNIPROTKB|A1YFI3 GSC "Homeobox protein goosecoid" [Saguinus labiatus (taxid:78454)] Back     alignment and assigned GO terms
UNIPROTKB|A1YG57 GSC "Homeobox protein goosecoid" [Pan paniscus (taxid:9597)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53545GSC_CHICKNo assigned EC number0.70830.52740.1959yesN/A
P53544GSC_DANRENo assigned EC number0.70830.52740.2yesN/A
P56915GSC_HUMANNo assigned EC number0.70830.52740.1867yesN/A
A2T733GSC_PANTRNo assigned EC number0.70830.52740.1867yesN/A
P54366GSC_DROMENo assigned EC number0.51230.86810.1885yesN/A
Q02591GSC_MOUSENo assigned EC number0.70830.52740.1875yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-14
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-12
smart0038957 smart00389, HOX, Homeodomain 4e-12
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 61.7 bits (151), Expect = 1e-14
 Identities = 25/44 (56%), Positives = 29/44 (65%)

Query: 46 RRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERV 89
          RR RT FT EQLE+LE  FEK  YP    RE+LA K+ L E +V
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQV 44

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
KOG0842|consensus 307 99.44
KOG0484|consensus125 99.38
KOG0850|consensus245 99.37
KOG0488|consensus309 99.37
KOG0489|consensus261 99.36
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.34
KOG0487|consensus308 99.34
KOG2251|consensus 228 99.34
KOG0485|consensus 268 99.33
KOG0843|consensus197 99.29
KOG0492|consensus246 99.22
KOG0493|consensus342 99.1
KOG0494|consensus 332 99.05
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.03
KOG0848|consensus317 99.02
KOG0486|consensus 351 98.99
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 98.85
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.75
KOG0491|consensus194 98.75
KOG0844|consensus 408 98.68
KOG0490|consensus 235 98.63
COG5576156 Homeodomain-containing transcription factor [Trans 98.56
KOG0849|consensus 354 98.52
KOG3802|consensus398 97.95
KOG0483|consensus 198 97.85
KOG0847|consensus288 97.62
KOG2252|consensus558 97.32
KOG4577|consensus 383 96.98
KOG0774|consensus334 96.38
KOG0490|consensus235 95.8
KOG0775|consensus304 95.78
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 95.68
KOG1168|consensus385 94.57
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 89.98
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 88.79
KOG1146|consensus 1406 83.52
COG3413215 Predicted DNA binding protein [General function pr 81.55
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 81.09
>KOG0842|consensus Back     alignment and domain information 
Probab=99.44  E-value=1.2e-13  Score=95.58  Aligned_cols=50  Identities=30%  Similarity=0.517  Sum_probs=47.3

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHhhhhcCCCCHHHHHHHHHhcCCCCCCCCC
Q psy7434          42 PKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVEP   91 (91)
Q Consensus        42 ~~~~rr~Rt~~t~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qVk~   91 (91)
                      ..++||.|..||..|..+||+.|..++|++.++|++||..|.|++.||||
T Consensus       150 ~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKI  199 (307)
T KOG0842|consen  150 KRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKI  199 (307)
T ss_pred             cccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheee
Confidence            45677789999999999999999999999999999999999999999998

>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 5e-12
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-11
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 7e-11
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 2e-10
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 8e-10
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-09
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-09
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 8e-09
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 7e-08
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 8e-08
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-07
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure 
Iteration: 1

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%)
Query: 46 RRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVE 90
          RRHRTIFT+EQLE LE  F++T YPDV  REQLA KV L+EE+VE
Sbjct: 8  RRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVE 52
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 5e-25
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-24
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-24
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-23
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 6e-23
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-22
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-22
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-21
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-20
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-20
3a02_A60 Homeobox protein aristaless; homeodomain, developm 9e-20
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-18
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-16
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-16
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 7e-14
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-13
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-12
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-12
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 8e-12
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 7e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-08
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-07
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 3e-07
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 5e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-06
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-06
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-06
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 2e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
1wh5_A80 ZF-HD homeobox family protein; structural genomics 2e-04
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 4e-04
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 9e-04
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score = 88.2 bits (219), Expect = 5e-25
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 40 PPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVE 90
                +R+RT FT+EQ+E LE  FE+THYPDV  RE+LA K+DL E R++
Sbjct: 2  SSGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQ 52
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.44
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.43
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.42
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.41
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.39
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.39
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.39
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.38
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.38
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.38
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.38
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.36
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.36
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.36
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.36
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.36
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.35
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.35
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.35
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.35
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.34
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.34
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.34
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.34
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.33
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.32
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.32
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.32
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.32
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.31
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.31
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.3
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.3
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.3
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.29
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.28
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.28
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.28
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.27
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.27
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.22
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.22
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.21
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.2
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.2
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.2
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.19
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.16
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.15
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.15
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.15
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.13
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.13
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.12
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.1
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.1
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.09
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.09
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.07
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.07
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.0
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.98
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 98.97
2e19_A64 Transcription factor 8; homeobox domain, structura 98.95
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.92
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 98.87
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 98.87
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 98.78
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.62
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.32
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.17
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.05
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 83.82
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.44  E-value=8.5e-14  Score=78.98  Aligned_cols=50  Identities=24%  Similarity=0.307  Sum_probs=46.5

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHhhhh----cCCCCHHHHHHHHHhcCCCCCCCCC
Q psy7434          42 PKRKRRHRTIFTEEQLEQLEATFEK----THYPDVVLREQLALKVDLKEERVEP   91 (91)
Q Consensus        42 ~~~~rr~Rt~~t~~Q~~~Le~~F~~----~~yp~~~~r~~La~~l~l~~~qVk~   91 (91)
                      ..++||.||.||..|+..||..|..    ++||+..+|++||..|+|++.+||+
T Consensus        14 ~~~~rR~Rt~ft~~Ql~~Le~~f~~~~~~~~yp~~~~r~~La~~lgL~~~~Vkv   67 (80)
T 1wh5_A           14 GGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKV   67 (80)
T ss_dssp             CCCSCCCSCCCCHHHHHHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHhCCCcccccC
Confidence            4567889999999999999999999    9999999999999999999999874
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-14
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-13
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-11
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-11
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-11
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-11
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 4e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 4e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 5e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-10
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-10
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-10
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 6e-10
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 6e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-09
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 4e-09
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 6e-08
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 7e-08
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-07
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-07
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-07
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-06
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-06
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-04
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 0.003
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 59.5 bits (144), Expect = 4e-14
 Identities = 13/52 (25%), Positives = 24/52 (46%)

Query: 38 SAPPPKRKRRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERV 89
          +    +  R+ R  +T+ Q  +LE  F    Y     R ++A  ++L E +V
Sbjct: 6  NWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQV 57
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.5
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.49
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.49
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.48
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.46
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.46
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.45
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.45
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.44
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.43
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.43
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.41
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.39
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.36
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.34
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.34
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.34
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.32
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.3
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.25
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.25
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.22
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.21
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.13
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.99
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.97
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.94
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.88
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 98.76
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.63
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.6
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.6
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.50  E-value=5.1e-15  Score=78.07  Aligned_cols=46  Identities=20%  Similarity=0.387  Sum_probs=43.6

Q ss_pred             CCCCCCCCHHHHHHHHHhhhhcCCCCHHHHHHHHHhcCCCCCCCCC
Q psy7434          46 RRHRTIFTEEQLEQLEATFEKTHYPDVVLREQLALKVDLKEERVEP   91 (91)
Q Consensus        46 rr~Rt~~t~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qVk~   91 (91)
                      |+.||.||..|+..||..|..++||+..+|++||..|||++.+||+
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~v   47 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITI   47 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeee
Confidence            6679999999999999999999999999999999999999999873
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure