Psyllid ID: psy7437
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| 242020088 | 522 | Hrp65 protein, putative [Pediculus human | 0.845 | 0.452 | 0.552 | 2e-67 | |
| 321454568 | 472 | hypothetical protein DAPPUDRAFT_204255 [ | 0.741 | 0.438 | 0.508 | 3e-63 | |
| 14572592 | 512 | hrp65-3 isoform [Chironomus tentans] | 0.741 | 0.404 | 0.495 | 1e-62 | |
| 14572590 | 517 | hrp65-2 isoform [Chironomus tentans] | 0.741 | 0.400 | 0.495 | 1e-62 | |
| 156549847 | 646 | PREDICTED: hrp65 protein-like [Nasonia v | 0.738 | 0.318 | 0.555 | 2e-62 | |
| 34922660 | 535 | RecName: Full=Hrp65 protein; AltName: Fu | 0.741 | 0.386 | 0.495 | 2e-62 | |
| 328792621 | 563 | PREDICTED: hrp65 protein-like [Apis mell | 0.738 | 0.365 | 0.559 | 2e-62 | |
| 380023432 | 563 | PREDICTED: hrp65 protein-like [Apis flor | 0.738 | 0.365 | 0.559 | 3e-62 | |
| 383861809 | 566 | PREDICTED: hrp65 protein-like [Megachile | 0.738 | 0.363 | 0.555 | 1e-61 | |
| 340708632 | 579 | PREDICTED: hrp65 protein-like [Bombus te | 0.738 | 0.355 | 0.542 | 2e-61 |
| >gi|242020088|ref|XP_002430488.1| Hrp65 protein, putative [Pediculus humanus corporis] gi|212515645|gb|EEB17750.1| Hrp65 protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 261 bits (668), Expect = 2e-67, Method: Compositional matrix adjust.
Identities = 152/275 (55%), Positives = 185/275 (67%), Gaps = 39/275 (14%)
Query: 3 IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62
IERAVV+ D+RG S EGI+EF RKP A QAL+RC +G +F+T SL+PVIVEPLD VDD
Sbjct: 258 IERAVVIGDERGKSTGEGIVEFARKPGATQALRRCTEGCYFITSSLRPVIVEPLDQVDDI 317
Query: 63 EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLE 122
+G SE+++ KK ++FK+R +GPRFA GSFEFEYGTRWKQL+ELYKQKEEAL++E+K+E
Sbjct: 318 DGYSEKSLFKKGPEFFKEREVGPRFANHGSFEFEYGTRWKQLHELYKQKEEALRREMKME 377
Query: 123 EEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILR 182
EEKLEAQME+A+YE+ETE L LR
Sbjct: 378 EEKLEAQMEYAKYEHETE-------------------L--------------------LR 398
Query: 183 EQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQEN 242
EQLR RE D+ERQK+EWELKER AEEQRR DEE MRRQ EE+ LR+ +Q+EELRRR QEN
Sbjct: 399 EQLRLREQDKERQKREWELKERQAEEQRRSDEEMMRRQAEEMQLRIHRQEEELRRRQQEN 458
Query: 243 SIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKM 277
++FMQ L Q LG G + M
Sbjct: 459 TLFMQAHQLNSLLDQQEQALGSGPGGYDSAGRGHM 493
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321454568|gb|EFX65733.1| hypothetical protein DAPPUDRAFT_204255 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|14572592|emb|CAC42830.1| hrp65-3 isoform [Chironomus tentans] | Back alignment and taxonomy information |
|---|
| >gi|14572590|emb|CAC42828.1| hrp65-2 isoform [Chironomus tentans] | Back alignment and taxonomy information |
|---|
| >gi|156549847|ref|XP_001606842.1| PREDICTED: hrp65 protein-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|34922660|sp|Q9U1N0.1|HRP65_CHITE RecName: Full=Hrp65 protein; AltName: Full=Ct-Hrp65 gi|6687398|emb|CAB64926.1| Hrp65 protein [Chironomus tentans] gi|14572591|emb|CAC42829.1| hrp65-1 isoform [Chironomus tentans] | Back alignment and taxonomy information |
|---|
| >gi|328792621|ref|XP_001121935.2| PREDICTED: hrp65 protein-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380023432|ref|XP_003695527.1| PREDICTED: hrp65 protein-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383861809|ref|XP_003706377.1| PREDICTED: hrp65 protein-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340708632|ref|XP_003392926.1| PREDICTED: hrp65 protein-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 279 | ||||||
| UNIPROTKB|Q9U1N0 | 535 | HRP65 "Hrp65 protein" [Chirono | 0.781 | 0.407 | 0.343 | 4.2e-33 | |
| UNIPROTKB|Q9GRW7 | 697 | nonA "Protein no-on-transient | 0.777 | 0.311 | 0.350 | 5.4e-32 | |
| FB|FBgn0004227 | 700 | nonA "no on or off transient A | 0.777 | 0.31 | 0.352 | 7.1e-32 | |
| ZFIN|ZDB-GENE-030131-9530 | 512 | pspc1 "paraspeckle component 1 | 0.505 | 0.275 | 0.415 | 1.7e-31 | |
| FB|FBgn0015520 | 642 | nonA-l "nonA-like" [Drosophila | 0.767 | 0.333 | 0.343 | 2.3e-31 | |
| UNIPROTKB|Q9GRX4 | 698 | nonA "Protein no-on-transient | 0.777 | 0.310 | 0.341 | 1.4e-30 | |
| UNIPROTKB|F1N941 | 524 | PSPC1 "Paraspeckle component 1 | 0.745 | 0.396 | 0.355 | 3.7e-30 | |
| UNIPROTKB|Q91017 | 241 | SFPQ "Uncharacterized protein" | 0.684 | 0.792 | 0.394 | 7.9e-30 | |
| UNIPROTKB|F1P555 | 647 | SFPQ "Uncharacterized protein" | 0.720 | 0.310 | 0.397 | 8.2e-30 | |
| UNIPROTKB|F1LQW3 | 606 | Sfpq "Protein Sfpq" [Rattus no | 0.720 | 0.331 | 0.392 | 1.1e-29 |
| UNIPROTKB|Q9U1N0 HRP65 "Hrp65 protein" [Chironomus tentans (taxid:7153)] | Back alignment and assigned GO terms |
|---|
Score = 362 (132.5 bits), Expect = 4.2e-33, P = 4.2e-33
Identities = 79/230 (34%), Positives = 123/230 (53%)
Query: 3 IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62
+ERAV++VDDRG + EGI+EF RK A ALK C + +FLT SL+P +VE D +D+
Sbjct: 213 VERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVETFDHIDET 272
Query: 63 EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYXXXXXXXXXXXXXXXXX 122
+G E+++ +KS+DY+K R GPRFA +GSFE E+GT+WKQ+Y
Sbjct: 273 DGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDALKREMQLE 332
Query: 123 XXXXXXXMEFARYENETEILRERECRFVXXXXXXXXXXXXXXXXXXMEFARYENETEILR 182
ME+A++E+ETE LRE+ + R +E+ I
Sbjct: 333 EEKLEAQMEYAKFEHETESLREQ--------LRKREQDRDRQKKEWEDRERQADESRIRD 384
Query: 183 EQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQD 232
EQ +R+ D + ++ + E +RR E ++ Q +++ + QQ+
Sbjct: 385 EQQMRRQQD----DMQMRMQRQDEEMRRRQQENSLFMQAQQLSNMLDQQE 430
|
|
| UNIPROTKB|Q9GRW7 nonA "Protein no-on-transient A" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004227 nonA "no on or off transient A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9530 pspc1 "paraspeckle component 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0015520 nonA-l "nonA-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9GRX4 nonA "Protein no-on-transient A" [Drosophila littoralis (taxid:47316)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N941 PSPC1 "Paraspeckle component 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q91017 SFPQ "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P555 SFPQ "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LQW3 Sfpq "Protein Sfpq" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| cd12945 | 100 | cd12945, NOPS_NONA_like, NOPS domain, including C- | 4e-40 | |
| cd12931 | 90 | cd12931, eNOPS_SF, NOPS domain, including C-termin | 3e-25 | |
| cd12333 | 80 | cd12333, RRM2_p54nrb_like, RNA recognition motif 2 | 5e-24 | |
| cd12590 | 80 | cd12590, RRM2_PSF, RNA recognition motif 2 in vert | 2e-18 | |
| cd12589 | 80 | cd12589, RRM2_PSP1, RNA recognition motif 2 in ver | 3e-17 | |
| cd12591 | 80 | cd12591, RRM2_p54nrb, RNA recognition motif 2 in v | 3e-17 | |
| pfam08075 | 52 | pfam08075, NOPS, NOPS (NUC059) domain | 7e-17 | |
| cd12946 | 93 | cd12946, NOPS_p54nrb_PSF_PSPC1, NOPS domain, inclu | 2e-15 | |
| cd12949 | 94 | cd12949, NOPS_PSPC1, NOPS domain, including C-term | 4e-15 | |
| cd12947 | 94 | cd12947, NOPS_p54nrb, NOPS domain, including C-ter | 8e-15 | |
| cd12948 | 97 | cd12948, NOPS_PSF, NOPS domain, including C-termin | 1e-14 | |
| pfam12037 | 276 | pfam12037, DUF3523, Domain of unknown function (DU | 5e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 9e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| TIGR02680 | 1353 | TIGR02680, TIGR02680, TIGR02680 family protein | 0.003 |
| >gnl|CDD|240580 cd12945, NOPS_NONA_like, NOPS domain, including C-terminal coiled-coil region, in p54nrb/PSF/PSP1 homologs from invertebrate species | Back alignment and domain information |
|---|
Score = 134 bits (339), Expect = 4e-40
Identities = 67/97 (69%), Positives = 88/97 (90%)
Query: 48 LKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYEL 107
L+P +VEP++ +DDE+GL E++++KK+ ++ K+RSIGPRFA SFE EYGTRWKQL+EL
Sbjct: 1 LRPCVVEPMEEIDDEDGLPEKSLNKKNPEFNKERSIGPRFAEPNSFEHEYGTRWKQLHEL 60
Query: 108 YKQKEEALQKELKLEEEKLEAQMEFARYENETEILRE 144
YKQKEEAL++ELK+EEEKLEAQME+ARYE+ETE+LRE
Sbjct: 61 YKQKEEALKRELKMEEEKLEAQMEYARYEHETELLRE 97
|
The family contains a DBHS domain (for Drosophila behavior, human splicing), which comprises two conserved RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a charged protein-protein interaction NOPS (NONA and PSP1) domain. This model corresponds to the NOPS domain, with a long helical C-terminal extension , found in Drosophila melanogaster gene no-ontransient A (nonA) encoding puff-specific protein Bj6 (also termed NONA), Chironomus tentans hrp65 gene encoding protein Hrp65 and similar proteins. D. melanogaster NONA is involved in eye development and behavior, and may play a role in circadian rhythm maintenance, similar to vertebrate p54nrb. C. tentans hrp65 is a component of nuclear fibers associated with ribonucleoprotein particles in transit from the gene to the nuclear pore. The NOPS domain specifically binds to the second RNA recognition motif (RRM2) domain of the partner DBHS protein via a substantial interaction surface. Its highly conserved C-terminal residues are critical for functional DBHS dimerization while the highly conserved C-terminal helical extension, forming a right-handed antiparallel heterodimeric coiled-coil, is essential for localization of these proteins to subnuclear bodies. Length = 100 |
| >gnl|CDD|240579 cd12931, eNOPS_SF, NOPS domain, including C-terminal helical extension region, in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family | Back alignment and domain information |
|---|
| >gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) | Back alignment and domain information |
|---|
| >gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) | Back alignment and domain information |
|---|
| >gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) | Back alignment and domain information |
|---|
| >gnl|CDD|149257 pfam08075, NOPS, NOPS (NUC059) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240581 cd12946, NOPS_p54nrb_PSF_PSPC1, NOPS domain, including C-terminal coiled-coil region, in p54nrb/PSF/PSPC1 family proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240584 cd12949, NOPS_PSPC1, NOPS domain, including C-terminal coiled-coil region, in paraspeckle protein component 1 (PSPC1) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240582 cd12947, NOPS_p54nrb, NOPS domain, including C-terminal coiled-coil region, in 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240583 cd12948, NOPS_PSF, NOPS domain, including C-terminal coiled-coil region, in polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523) | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233973 TIGR02680, TIGR02680, TIGR02680 family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| KOG0115|consensus | 275 | 100.0 | ||
| PF08075 | 52 | NOPS: NOPS (NUC059) domain; InterPro: IPR012975 Th | 99.93 | |
| KOG0115|consensus | 275 | 98.06 | ||
| KOG0149|consensus | 247 | 96.61 | ||
| smart00362 | 72 | RRM_2 RNA recognition motif. | 96.42 | |
| PF00076 | 70 | RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or | 96.21 | |
| smart00361 | 70 | RRM_1 RNA recognition motif. | 96.12 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 95.85 | |
| smart00360 | 71 | RRM RNA recognition motif. | 95.78 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 95.62 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 95.4 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 95.19 | |
| TIGR01628 | 562 | PABP-1234 polyadenylate binding protein, human typ | 94.97 | |
| cd00590 | 74 | RRM RRM (RNA recognition motif), also known as RBD | 94.63 | |
| PF14259 | 70 | RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or | 94.54 | |
| KOG1029|consensus | 1118 | 94.03 | ||
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 93.99 | |
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 93.71 | |
| TIGR01659 | 346 | sex-lethal sex-lethal family splicing factor. This | 93.32 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 92.46 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 92.44 | |
| KOG0123|consensus | 369 | 92.42 | ||
| KOG1029|consensus | 1118 | 91.84 | ||
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 91.74 | |
| KOG0144|consensus | 510 | 91.73 | ||
| PLN03120 | 260 | nucleic acid binding protein; Provisional | 91.03 | |
| KOG0148|consensus | 321 | 90.83 | ||
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 90.26 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 89.5 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 89.14 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 88.65 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 88.15 | |
| PLN03121 | 243 | nucleic acid binding protein; Provisional | 87.59 | |
| TIGR01649 | 481 | hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor | 86.47 | |
| PTZ00121 | 2084 | MAEBL; Provisional | 81.73 | |
| KOG0147|consensus | 549 | 80.65 | ||
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 80.37 |
| >KOG0115|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-52 Score=382.80 Aligned_cols=216 Identities=37% Similarity=0.484 Sum_probs=194.8
Q ss_pred CcceeEEEeCCCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecCcccccccCchhhhhcccCchhhhhh
Q psy7437 2 NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQR 81 (279)
Q Consensus 2 ~VERAVViVDdRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~e~~DdeDGLpEK~l~~k~~~f~kER 81 (279)
+||+|||+|||+|++||+|||+|++||+|.+|+++|++|||++|++++||+|+|+++.||+||+|++ +..+++.|.+||
T Consensus 57 ~~e~av~~vD~r~k~t~eg~v~~~~k~~a~~a~rr~~~~g~~~~~~~~p~~VeP~eq~~d~~G~~~k-~~~~~~~~~~e~ 135 (275)
T KOG0115|consen 57 PIERAVAKVDDRGKPTREGIVEFAKKPNARKAARRCREGGFGGTTGGRPVGVEPMEQPDDNDGGPEK-GGGGGPSGPKER 135 (275)
T ss_pred ccchheeeecccccccccchhhhhcchhHHHHHHHhccCccccCCCCCccCCChhhccCCCCcchhh-cCCCCCCCCccc
Confidence 7999999999999999999999999999999999999999999999999999999999999999999 678999999999
Q ss_pred ccCCCCCCCCCchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh-hhhHHHHHHHHHHhHHHHHHHHHHHH
Q psy7437 82 SIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFAR-YENETEILRERECRFVEEALQKELKL 160 (279)
Q Consensus 82 E~gPRfa~~gsFE~EygqRWK~L~e~eKqqrE~l~reikee~EKLEaEME~a~-~ehq~~lLre~l~r~~~e~~~~~~~~ 160 (279)
+.|||||.+|||+|+|+++||.|++++|++.+.|+.+|+++.+|||++||+|+ |+||++|+|++|+++++++++
T Consensus 136 ~~p~r~a~~g~fe~e~~~~~k~l~~mekq~qd~v~~n~kea~~klE~~me~arghe~q~~l~rq~lmrrqeelrr----- 210 (275)
T KOG0115|consen 136 EQPPRFAQQGSFEVEYGSRWKMLGGMEKQGQDQVDRNIKEAQDKLEAPMEKARGHECQLMLGRQPLMRREEELRR----- 210 (275)
T ss_pred cCCchhccccccccccCccccccccccccCCcccccccchhhhccccccccccCccceeeecCCCcccccHHHHH-----
Confidence 99999999999999999999999999999999999999999999999999999 999999999999999999999
Q ss_pred HHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHHHHHHHHhhhhHHHHHHhh
Q psy7437 161 EEEKLEAQMEFARYENETEILREQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQ 240 (279)
Q Consensus 161 ~~~kle~qmE~a~~e~e~~~~Rq~l~~rqe~~~rqk~e~em~~r~~ee~rr~~Ee~mrrq~ee~~~r~~~q~~~~~rr~q 240 (279)
|+.. ++++++.|.++..++++.++.. +++++++.. .++++|||
T Consensus 211 --------me~l--~nqe~qkr~~~~~~eee~r~r~----------------~~~~~~~~~-----------~~~~~rqq 253 (275)
T KOG0115|consen 211 --------MEEL--HNQEAKKRKEINLREEEERLRR----------------IEEMDNHEE-----------GEMYRRQQ 253 (275)
T ss_pred --------HHHH--hhHHHHHhhhhhhhHHHHHHHH----------------HHHHhccCc-----------hhcccccc
Confidence 9977 8888888888877776653333 333333321 15679999
Q ss_pred hchhHHHHHHHhhchhhhhh
Q psy7437 241 ENSIFMQVIVWLGDLKQGVY 260 (279)
Q Consensus 241 e~~~~~q~~~~~~~~~~~~~ 260 (279)
|+++|++..-.++..|...+
T Consensus 254 e~~~~~~~y~d~~~~~e~~g 273 (275)
T KOG0115|consen 254 EPGGMFGSYGDNGYPDEKKG 273 (275)
T ss_pred ccCceeccccccCCchhhcc
Confidence 99999998888877776543
|
|
| >PF08075 NOPS: NOPS (NUC059) domain; InterPro: IPR012975 This domain is found C-terminal to 1 or 2 IPR000504 from INTERPRO domains [] in NONA and PSP1 proteins | Back alignment and domain information |
|---|
| >KOG0115|consensus | Back alignment and domain information |
|---|
| >KOG0149|consensus | Back alignment and domain information |
|---|
| >smart00362 RRM_2 RNA recognition motif | Back alignment and domain information |
|---|
| >PF00076 RRM_1: RNA recognition motif | Back alignment and domain information |
|---|
| >smart00361 RRM_1 RNA recognition motif | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >smart00360 RRM RNA recognition motif | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability | Back alignment and domain information |
|---|
| >PF14259 RRM_6: RNA recognition motif (a | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01659 sex-lethal sex-lethal family splicing factor | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >KOG0123|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0144|consensus | Back alignment and domain information |
|---|
| >PLN03120 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0148|consensus | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >PLN03121 nucleic acid binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
| >PTZ00121 MAEBL; Provisional | Back alignment and domain information |
|---|
| >KOG0147|consensus | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 279 | ||||
| 3sde_B | 261 | Crystal Structure Of A Paraspeckle-Protein Heterodi | 9e-28 | ||
| 3sde_A | 261 | Crystal Structure Of A Paraspeckle-Protein Heterodi | 3e-27 |
| >pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 | Back alignment and structure |
|
| >pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 279 | |||
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 6e-35 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 2e-04 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 5e-04 |
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 | Back alignment and structure |
|---|
Score = 125 bits (316), Expect = 6e-35
Identities = 68/141 (48%), Positives = 101/141 (71%), Gaps = 1/141 (0%)
Query: 2 NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDD 61
+E+AVV+VDDRG + +G +EF KP A +AL+RC DG F LT + +PVIVEP++ DD
Sbjct: 122 PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDD 181
Query: 62 EEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKL 121
E+GL E+ + +K+ Y K+R PRFA G+FEFEY +RWK L E+ KQ+ E + + ++
Sbjct: 182 EDGLPEKLM-QKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIRE 240
Query: 122 EEEKLEAQMEFARYENETEIL 142
+EKLEA+ME AR+E++ ++
Sbjct: 241 AKEKLEAEMEAARHEHQLMLM 261
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 99.98 | |
| 2dnl_A | 114 | Cytoplasmic polyadenylation element binding protei | 97.54 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 97.35 | |
| 2j8a_A | 136 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 97.32 | |
| 2dha_A | 123 | FLJ20171 protein; RRM domain, structural genomics, | 97.31 | |
| 2dgw_A | 91 | Probable RNA-binding protein 19; RRM domain, struc | 97.29 | |
| 2dnn_A | 109 | RNA-binding protein 12; RRM domain, RBD, structura | 97.26 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 97.21 | |
| 2cpy_A | 114 | RNA-binding protein 12; RRM domain, structural gen | 97.18 | |
| 2lkz_A | 95 | RNA-binding protein 5; RRM; NMR {Homo sapiens} | 97.18 | |
| 3md1_A | 83 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 97.17 | |
| 2dnh_A | 105 | Bruno-like 5, RNA binding protein; RRM domain, RBD | 97.17 | |
| 2pe8_A | 105 | Splicing factor 45; RRM, protein binding; 2.00A {H | 97.13 | |
| 1wg5_A | 104 | Heterogeneous nuclear ribonucleoprotein H; structu | 97.13 | |
| 2fy1_A | 116 | RNA-binding motif protein, Y chromosome, family 1 | 97.13 | |
| 1wez_A | 102 | HnRNP H', FTP-3, heterogeneous nuclear ribonucleop | 97.12 | |
| 2lmi_A | 107 | GRSF-1, G-rich sequence factor 1; G-rich RNA seque | 97.12 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 97.09 | |
| 1x5t_A | 96 | Splicing factor 3B subunit 4; structure genomics, | 97.05 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 97.04 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 97.04 | |
| 2ywk_A | 95 | Putative RNA-binding protein 11; RRM-domain, struc | 97.02 | |
| 2d9p_A | 103 | Polyadenylate-binding protein 3; RRM domain, struc | 97.0 | |
| 2lxi_A | 91 | RNA-binding protein 10; NMR {Homo sapiens} | 96.99 | |
| 1jmt_A | 104 | Splicing factor U2AF 35 kDa subunit; RRM, RNA spli | 96.99 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 96.97 | |
| 3ns6_A | 100 | Eukaryotic translation initiation factor 3 subuni; | 96.95 | |
| 1uaw_A | 77 | Mouse-musashi-1; RNP-type structure, RNA binding p | 96.94 | |
| 3ucg_A | 89 | Polyadenylate-binding protein 2; ferredoxin-like, | 96.91 | |
| 2dgp_A | 106 | Bruno-like 4, RNA binding protein; RRM domain, str | 96.91 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 96.91 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 96.89 | |
| 2db1_A | 118 | Heterogeneous nuclear ribonucleoprotein F; RRM dom | 96.86 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 96.86 | |
| 2cph_A | 107 | RNA binding motif protein 19; RNA recognition moti | 96.86 | |
| 1whw_A | 99 | Hypothetical protein riken cDNA 1200009A02; RNA re | 96.85 | |
| 2div_A | 99 | TRNA selenocysteine associated protein; structural | 96.83 | |
| 2dnz_A | 95 | Probable RNA-binding protein 23; RNA recognition m | 96.81 | |
| 2do4_A | 100 | Squamous cell carcinoma antigen recognized by T- c | 96.81 | |
| 3mdf_A | 85 | Peptidyl-prolyl CIS-trans isomerase E; RRM domain, | 96.8 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 96.79 | |
| 1p1t_A | 104 | Cleavage stimulation factor, 64 kDa subunit; RNA r | 96.77 | |
| 1x5s_A | 102 | Cold-inducible RNA-binding protein; structure geno | 96.76 | |
| 3bs9_A | 87 | Nucleolysin TIA-1 isoform P40; RNA recognition mot | 96.76 | |
| 1s79_A | 103 | Lupus LA protein; RRM, alpha/beta, RNA binding pro | 96.75 | |
| 2la6_A | 99 | RNA-binding protein FUS; structural genomics, nort | 96.75 | |
| 2dh8_A | 105 | DAZ-associated protein 1; RRM domain, structural g | 96.74 | |
| 2dhg_A | 104 | TRNA selenocysteine associated protein (SECP43); R | 96.73 | |
| 2cpe_A | 113 | RNA-binding protein EWS; RNA recognition motif, RR | 96.69 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 96.67 | |
| 2cqb_A | 102 | Peptidyl-prolyl CIS-trans isomerase E; RNA recogni | 96.67 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 96.67 | |
| 2ek1_A | 95 | RNA-binding protein 12; RNA recognition motif, dim | 96.67 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 96.66 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 96.66 | |
| 1x4h_A | 111 | RNA-binding protein 28; structural genomics, RRM d | 96.66 | |
| 2ki2_A | 90 | SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA | 96.63 | |
| 2dgs_A | 99 | DAZ-associated protein 1; RRM domain, structural g | 96.63 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 96.62 | |
| 2e5h_A | 94 | Zinc finger CCHC-type and RNA-binding motif- conta | 96.61 | |
| 1fj7_A | 101 | Nucleolin RBD1, protein C23; RNP, RRM, RNA binding | 96.61 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 96.6 | |
| 2do0_A | 114 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.6 | |
| 3v4m_A | 105 | Splicing factor U2AF 65 kDa subunit; canonical RNA | 96.6 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 96.59 | |
| 1x5u_A | 105 | Splicing factor 3B subunit 4 (spliceosome associat | 96.59 | |
| 2j76_E | 100 | EIF-4B, EIF4B, eukaryotic translation initiation f | 96.59 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 96.58 | |
| 2cqc_A | 95 | Arginine/serine-rich splicing factor 10; RNA recog | 96.57 | |
| 2dnm_A | 103 | SRP46 splicing factor; RRM domain, RBD, structural | 96.57 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 96.56 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 96.55 | |
| 2krb_A | 81 | Eukaryotic translation initiation factor 3 subunit | 96.54 | |
| 2cqp_A | 98 | RNA-binding protein 12; RNA recognition motif, RRM | 96.54 | |
| 2x1f_A | 96 | MRNA 3'-END-processing protein RNA15; transcriptio | 96.52 | |
| 3ue2_A | 118 | Poly(U)-binding-splicing factor PUF60; RNA recogni | 96.51 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 96.49 | |
| 2cq0_A | 103 | Eukaryotic translation initiation factor 3 subunit | 96.49 | |
| 3ex7_B | 126 | RNA-binding protein 8A; protein-RNA complex, mRNA | 96.48 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 96.47 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 96.47 | |
| 1wi8_A | 104 | EIF-4B, eukaryotic translation initiation factor 4 | 96.46 | |
| 2mss_A | 75 | Protein (musashi1); RNA-binding domain, RNA bindin | 96.45 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 96.44 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 96.43 | |
| 2m2b_A | 131 | RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio | 96.42 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 96.33 | |
| 2dgo_A | 115 | Cytotoxic granule-associated RNA binding protein 1 | 96.32 | |
| 2cq3_A | 103 | RNA-binding protein 9; RRM domain, structural geno | 96.31 | |
| 1x4e_A | 85 | RNA binding motif, single-stranded interacting pro | 96.31 | |
| 3lqv_A | 115 | PRE-mRNA branch site protein P14; cysless mutant, | 96.29 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 96.28 | |
| 1fjc_A | 96 | Nucleolin RBD2, protein C23; RNP, RRM, RNA binding | 96.28 | |
| 2fc8_A | 102 | NCL protein; structure genomics, RRM_1 domain, str | 96.26 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 96.25 | |
| 2fc9_A | 101 | NCL protein; structure genomics, RRM_1 domain, str | 96.23 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 96.21 | |
| 2cpf_A | 98 | RNA binding motif protein 19; RNA recognition moti | 96.19 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 96.18 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 96.18 | |
| 2dis_A | 109 | Unnamed protein product; structural genomics, RRM | 96.17 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 96.11 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 96.11 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 96.11 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 96.11 | |
| 2dgv_A | 92 | HnRNP M, heterogeneous nuclear ribonucleoprotein M | 96.1 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 96.1 | |
| 2cqd_A | 116 | RNA-binding region containing protein 1; RNA recog | 96.09 | |
| 2cqi_A | 103 | Nucleolysin TIAR; RNA recognition motif, RRM, RNA | 96.08 | |
| 2cqg_A | 103 | TDP-43, TAR DNA-binding protein-43; RNA recognitio | 96.07 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 96.04 | |
| 2dit_A | 112 | HIV TAT specific factor 1 variant; structural geno | 96.02 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 95.96 | |
| 1iqt_A | 75 | AUF1, heterogeneous nuclear ribonucleoprotein D0; | 95.93 | |
| 3s7r_A | 87 | Heterogeneous nuclear ribonucleoprotein A/B; ferre | 95.82 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 95.76 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 95.75 | |
| 2xs2_A | 102 | Deleted in azoospermia-like; RNA binding protein-R | 95.74 | |
| 2dng_A | 103 | Eukaryotic translation initiation factor 4H; RRM d | 95.72 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 95.7 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 95.7 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 95.7 | |
| 4a8x_A | 88 | RNA-binding protein with serine-rich domain 1; tra | 95.65 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 95.62 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 95.6 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 95.56 | |
| 2d9o_A | 100 | DNAJ (HSP40) homolog, subfamily C, member 17; RRM | 95.48 | |
| 2lcw_A | 116 | RNA-binding protein FUS; RRM, nucleic acid binding | 94.42 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 95.39 | |
| 3smz_A | 284 | Protein raver-1, ribonucleoprotein PTB-binding 1; | 95.36 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 95.34 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 95.27 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 95.19 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 94.9 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 94.88 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 94.81 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 94.73 | |
| 3s6e_A | 114 | RNA-binding protein 39; ferredoxin-like, structura | 94.71 | |
| 1x4c_A | 108 | Splicing factor, arginine/serine-rich 1; structura | 94.69 | |
| 2hvz_A | 101 | Splicing factor, arginine/serine-rich 7; RRM, RNA | 94.6 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 94.59 | |
| 1nu4_A | 97 | U1A RNA binding domain; RNA recognition motif, U1 | 94.52 | |
| 1x4a_A | 109 | Splicing factor, arginine/serine-rich 1 (splicing | 94.38 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 94.2 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 94.08 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 94.06 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 94.02 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 93.98 | |
| 3sde_A | 261 | Paraspeckle component 1; RRM, anti parallel right | 93.76 | |
| 2bz2_A | 121 | Negative elongation factor E; NELF E, RNA recognit | 93.24 | |
| 2cq2_A | 114 | Hypothetical protein LOC91801; RRM domain, structu | 92.95 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 92.86 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 92.73 | |
| 1sjq_A | 105 | Polypyrimidine tract-binding protein 1; babbab mot | 92.55 | |
| 2kvi_A | 96 | Nuclear polyadenylated RNA-binding protein 3; RNA- | 92.53 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 92.52 | |
| 2ytc_A | 85 | PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s | 92.5 | |
| 3beg_B | 115 | Splicing factor, arginine/serine-rich 1; kinase, S | 92.21 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 92.13 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 91.85 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 91.83 | |
| 1qm9_A | 198 | Polypyrimidine tract-binding protein; ribonucleopr | 91.8 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 91.73 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 91.54 | |
| 1whx_A | 111 | Hypothetical protein riken cDNA 1200009A02; RNA re | 91.16 | |
| 2cpj_A | 99 | Non-POU domain-containing octamer-binding protein; | 91.15 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 91.01 | |
| 2dnq_A | 90 | RNA-binding protein 4B; RRM domain,RBD, structural | 90.95 | |
| 2cq1_A | 101 | PTB-like protein L; RRM domain, structural genomic | 90.76 | |
| 3u1l_A | 240 | PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; | 90.33 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 90.17 | |
| 2dnp_A | 90 | RNA-binding protein 14; RRM domain, RBD, structura | 90.03 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 89.92 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 89.5 | |
| 1why_A | 97 | Hypothetical protein riken cDNA 1810017N16; RNA re | 89.49 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 89.46 | |
| 1wex_A | 104 | Hypothetical protein (riken cDNA 2810036L13); stru | 89.45 | |
| 1x4d_A | 102 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 89.45 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 89.26 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 89.1 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 89.03 | |
| 2dgu_A | 103 | Heterogeneous nuclear ribonucleoprotein Q; RRM dom | 88.97 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 88.95 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 88.6 | |
| 2cqh_A | 93 | IGF-II mRNA-binding protein 2 isoform A; RNA recog | 88.49 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 88.35 | |
| 1wf0_A | 88 | TDP-43, TAR DNA-binding protein-43; structural gen | 87.79 | |
| 3d2w_A | 89 | TAR DNA-binding protein 43; DP-43 proteinopathy, T | 87.67 | |
| 2cpd_A | 99 | Apobec-1 stimulating protein; RNA recognition moti | 87.43 | |
| 1owx_A | 121 | Lupus LA protein, SS-B, LA; RRM, transcription; NM | 86.77 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 86.49 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 84.42 | |
| 2e5g_A | 94 | U6 snRNA-specific terminal uridylyltransferase 1; | 83.65 | |
| 2dgt_A | 92 | RNA-binding protein 30; RRM domain, structural gen | 82.57 |
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
Probab=99.98 E-value=1.4e-32 Score=236.82 Aligned_cols=140 Identities=49% Similarity=0.869 Sum_probs=135.9
Q ss_pred CcceeEEEeCCCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecCcccccccCchhhhhcccCchhhhhh
Q psy7437 2 NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQR 81 (279)
Q Consensus 2 ~VERAVViVDdRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~e~~DdeDGLpEK~l~~k~~~f~kER 81 (279)
+|..+.|+.|..|+|.|.|+|+|+...+|.+||..++.|.|+++.++|||+|.|....++.+|+|++.+. +++.|+++|
T Consensus 122 ~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~A~~~l~~~~~~~~~~~r~i~v~~~~~~~~~~~~~~~~~~-~~~~~~~~r 200 (261)
T 3sde_A 122 PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQ-KTQQYHKER 200 (261)
T ss_dssp CEEEEEEEEETTSCEEEEEEEEESSHHHHHHHHHHHHHSCEESSSSCCBCEEEECCCEESSSCCCGGGSC-CCHHHHHHH
T ss_pred CeEEEEeeeCCCCCcCcEEEEEeCCHHHHHHHHHHhcCCeEEecCCCceEEEeeccccCccCCCcchhhh-cchhhhhhc
Confidence 5788999999999999999999999999999999999999999999999999999999999999999885 799999999
Q ss_pred ccCCCCCCCCCchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHH
Q psy7437 82 SIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEIL 142 (279)
Q Consensus 82 E~gPRfa~~gsFE~EygqRWK~L~e~eKqqrE~l~reikee~EKLEaEME~a~~ehq~~lL 142 (279)
+.||||+.||||+|+|+++|++|++++++++++++++++++++||++||++|+|+||++||
T Consensus 201 ~~~p~~~~pgs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~ 261 (261)
T 3sde_A 201 EQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLM 261 (261)
T ss_dssp TSCSEECCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred cCCCCCCCCCcccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhcC
Confidence 9999999999999999999999999999999999999999999999999999999999874
|
| >2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 | Back alignment and structure |
|---|
| >2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A | Back alignment and structure |
|---|
| >2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A | Back alignment and structure |
|---|
| >1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lxi_A RNA-binding protein 10; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A | Back alignment and structure |
|---|
| >1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A | Back alignment and structure |
|---|
| >2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B | Back alignment and structure |
|---|
| >3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A | Back alignment and structure |
|---|
| >2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A | Back alignment and structure |
|---|
| >3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A | Back alignment and structure |
|---|
| >2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A | Back alignment and structure |
|---|
| >1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... | Back alignment and structure |
|---|
| >1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B | Back alignment and structure |
|---|
| >2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} | Back alignment and structure |
|---|
| >2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 279 | |||
| d2cpya1 | 103 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 97.6 | |
| d1b7fa2 | 85 | Sex-lethal protein {Drosophila melanogaster [TaxId | 97.52 | |
| d2disa1 | 96 | Hypothetical protein FLJ20273 {Human (Homo sapiens | 97.5 | |
| d1x5oa1 | 101 | RNA-binding motif, single-stranded-interacting pro | 97.28 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 97.26 | |
| d2ghpa1 | 81 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 97.23 | |
| d1fxla2 | 85 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 97.22 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 97.19 | |
| d1wg5a_ | 104 | Heterogeneous nuclear ribonucleoprotein H' {Human | 97.19 | |
| d2cq4a1 | 101 | RNA binding protein 23 {Human (Homo sapiens) [TaxI | 97.17 | |
| d1wela1 | 112 | RNA-binding protein 12 {Human (Homo sapiens) [TaxI | 97.16 | |
| d1x5sa1 | 90 | Cold-inducible RNA-binding protein {Human (Homo sa | 97.15 | |
| d2cpha1 | 94 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 97.07 | |
| U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_ | 104 | U2 | 97.06 | |
| d2cqda1 | 103 | RNA-binding region containing protein 1 {Human (Ho | 97.0 | |
| d2cqpa1 | 86 | RNA-binding protein 12 {Mouse (Mus musculus) [TaxI | 96.97 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.92 | |
| d2adca1 | 109 | Polypyrimidine tract-binding protein {Human (Homo | 96.91 | |
| d2cqga1 | 90 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 96.9 | |
| d1weza_ | 102 | Heterogeneous nuclear ribonucleoprotein H' {Human | 96.9 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 96.89 | |
| d1whwa_ | 99 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 96.88 | |
| d1l3ka1 | 84 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 96.88 | |
| d1x4ha1 | 98 | RNA-binding protein 28 {Mouse (Mus musculus) [TaxI | 96.81 | |
| d1p1ta_ | 104 | Cleavage stimulation factor, 64 kda subunit {Human | 96.71 | |
| d1x4ba1 | 103 | Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu | 96.68 | |
| d1zh5a2 | 85 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 96.67 | |
| d2cqba1 | 89 | Peptidyl-prolyl cis-trans isomerase E, N-terminal | 96.64 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 96.62 | |
| d1hd0a_ | 75 | Heterogeneous nuclear ribonucleoprotein d0 {Human | 96.6 | |
| d2cpxa1 | 102 | RNA-binding protein 41, RBM41 {Human (Homo sapiens | 96.56 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 96.52 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 96.47 | |
| d2ghpa2 | 75 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 96.47 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 96.46 | |
| d1uawa_ | 77 | Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | 96.44 | |
| d1x5ua1 | 93 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 96.42 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 96.37 | |
| d2cq3a1 | 93 | RNA-binding protein 9 {Human (Homo sapiens) [TaxId | 96.3 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 96.28 | |
| d2msta_ | 75 | Neural RNA-binding protein Musashi-1 {Mouse (Mus m | 96.26 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 96.22 | |
| d1wi8a_ | 104 | Eukaryotic translation initiation factor 4B {Human | 96.15 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 96.05 | |
| d1x4ea1 | 72 | RNA-binding motif, single-stranded-interacting pro | 96.01 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 95.97 | |
| d2ghpa3 | 86 | U4/U6 snRNA-associated-splicing factor PRP24 {Bake | 95.95 | |
| d1x0fa1 | 75 | Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s | 95.92 | |
| d1l3ka2 | 79 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 95.87 | |
| d2cqca1 | 83 | Arginine/serine-rich splicing factor 10 {Human (Ho | 95.76 | |
| d2cpfa1 | 85 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 95.71 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 95.31 | |
| d1fjeb1 | 91 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 95.3 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 95.26 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 95.15 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 95.06 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 94.36 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 94.32 | |
| d1o0pa_ | 104 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 93.75 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 93.71 | |
| d2adba1 | 108 | Polypyrimidine tract-binding protein {Human (Homo | 93.66 | |
| d1nu4a_ | 91 | Splicesomal U1A protein {Human (Homo sapiens) [Tax | 93.57 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 93.44 | |
| d3begb1 | 87 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 92.95 | |
| d2adca2 | 88 | Polypyrimidine tract-binding protein {Human (Homo | 92.16 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 91.87 | |
| d1wi6a1 | 75 | Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M | 91.62 | |
| d1wf0a_ | 88 | TAR DNA-binding protein 43, TDP-43 {Human (Homo sa | 91.35 | |
| d1wwha1 | 81 | Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 | 90.84 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 90.64 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 90.59 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 90.04 | |
| d1x4fa1 | 99 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 89.73 | |
| d2cpja1 | 86 | Non-POU domain-containing octamer-binding protein, | 89.58 | |
| d2cq1a1 | 88 | Polypyrimidine tract-binding protein 2, PTBP2 {Hum | 89.03 | |
| d2cpda1 | 86 | APOBEC1 stimulating protein {Human (Homo sapiens) | 88.77 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 87.03 | |
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 86.36 | |
| d1wexa_ | 104 | Heterogeneous nuclear ribonucleoprotein L-like {Mo | 86.26 | |
| d1whya_ | 97 | Putative RNA-binding protein 15B, Rbm15b {Mouse (M | 86.02 | |
| d1owxa_ | 113 | Lupus LA protein {Human (Homo sapiens) [TaxId: 960 | 85.14 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 85.11 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 84.97 | |
| d2b0ga1 | 83 | Splicesomal U1A protein {Drosophila melanogaster [ | 83.89 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 83.08 | |
| d2cq2a1 | 101 | Alkylation repair AlkB homolog 8, ALKBH8 {Human (H | 82.84 | |
| d1wg4a_ | 98 | Splicing factor, arginine/serine-rich 9 (SFRS9) {M | 82.81 |
| >d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: RNA-binding protein 12 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.60 E-value=2.5e-05 Score=57.35 Aligned_cols=49 Identities=14% Similarity=0.228 Sum_probs=40.1
Q ss_pred cceeEEEeC-CCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecC
Q psy7437 3 IERAVVLVD-DRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPL 56 (279)
Q Consensus 3 VERAVViVD-dRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~ 56 (279)
|..+|++++ +.|+|+|.|+|+|....+|.+||. + .|.+| .-|+|.|.|.
T Consensus 35 i~~~~~~~~~~~g~~~G~afV~F~s~~~a~~Al~-~-n~~~i---~gr~i~V~~~ 84 (103)
T d2cpya1 35 DENAVHVLVDNNGQGLGQALVQFKNEDDARKSER-L-HRKKL---NGREAFVHVV 84 (103)
T ss_dssp CSTTEEECCCTTSSCSSCEEEECSSHHHHHHHGG-G-CSEEE---TTEEEEEEEE
T ss_pred EEEEEEEEeCCCCCcCccEEEEECCHHHHHHHHh-c-CCCeE---CCcEEEEEEC
Confidence 455566655 559999999999999999999997 4 57766 5689999886
|
| >d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|