Psyllid ID: psy7437

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28

MNIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILREQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKMKN

ccccEEEEEEcccccccccccEEEcccHHHHHHHHHcccccEEEEcccccEEEEccccccccccHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccccccccccccccccc

ccEEEEEEEEEccccccccEEEEEcccHHHHHHHHHHcccEEEEEcccccEEEEccccccccccccHHHHHHHcHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccccccccccEEEEccccccc

MNIERAVVLVddrgnsknegiieFTRKPAAAQALKRCQDGVFFLtqslkpvivepldlvddeeglsertvskkssdyfkqrsigprfatigsfefEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILREQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQgvyqlgltegpficecnnkmkn

mnieravvlvddrgnsknegiIEFTRKPAAAQALKRCQDGVFFLTqslkpvivepldlvddeeglsertvskkssdyfkqrsigprfatigsfEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILREQLRQREADRERQKQewelkerhaeeqrrcdeeaMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTegpficecnnkmkn

MNIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYelykqkeealqkelkleeekleaqMEFARYENETEILRERECRFVeealqkelkleeekleaqMEFARYENETEILREQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKMKN

*******************GIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLV******************FKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQ****************************TEILRERECRFVE*******************************************************************************************SIFMQVIVWLGDLKQGVYQLGLTEGPFICECN*****

**IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLS**************************FEFEYGTRWKQ********************************************************************************************************************************************************************************

MNIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILREQLR********************************RQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKMKN

*NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEE*K***************************************************AMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNK***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxECRFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQENSIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKMKN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		279	2.2.26 [Sep-21-2011]
Q9U1N0		535	Hrp65 protein OS=Chironom	N/A	N/A	0.741	0.386	0.495	3e-64
Q9GRW7		697	Protein no-on-transient A	N/A	N/A	0.741	0.296	0.459	7e-58
Q9GRX4		698	Protein no-on-transient A	N/A	N/A	0.741	0.296	0.451	1e-56
Q04047		700	Protein no-on-transient A	yes	N/A	0.738	0.294	0.451	3e-55
Q8VIJ6		699	Splicing factor, proline-	yes	N/A	0.745	0.297	0.434	4e-36
P23246		707	Splicing factor, proline-	yes	N/A	0.745	0.294	0.434	7e-36
Q5ZK88		523	Paraspeckle component 1 O	no	N/A	0.505	0.269	0.485	2e-34
Q8WXF1		523	Paraspeckle component 1 O	no	N/A	0.505	0.269	0.485	3e-34
Q4KLH4		522	Paraspeckle component 1 O	no	N/A	0.505	0.270	0.485	3e-34
Q99K48		473	Non-POU domain-containing	no	N/A	0.505	0.298	0.5	3e-34

>sp\|Q9U1N0\|HRP65_CHITE Hrp65 protein OS=Chironomus tentans GN=HRP65 PE=1 SV=1	Back alignment and function desciption

 Score =  244 bits (624), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 168/246 (68%), Gaps = 39/246 (15%)

Query: 3   IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62
           +ERAV++VDDRG +  EGI+EF RK  A  ALK C +  +FLT SL+P +VE  D +D+ 
Sbjct: 213 VERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVETFDHIDET 272

Query: 63  EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLE 122
           +G  E+++ +KS+DY+K R  GPRFA +GSFE E+GT+WKQ+Y++YKQK +AL++E++LE
Sbjct: 273 DGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDALKREMQLE 332

Query: 123 EEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILR 182
           EEKLEAQME+A++E+ETE                                        LR
Sbjct: 333 EEKLEAQMEYAKFEHETE---------------------------------------SLR 353

Query: 183 EQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQEN 242
           EQLR+RE DR+RQK+EWE +ER A+E R  DE+ MRRQ +++ +RMQ+QDEE+RRR QEN
Sbjct: 354 EQLRKREQDRDRQKKEWEDRERQADESRIRDEQQMRRQQDDMQMRMQRQDEEMRRRQQEN 413

Query: 243 SIFMQV 248
           S+FMQ 
Sbjct: 414 SLFMQA 419

Component of nuclear connecting fibers associated with the transport of ribonucleoprotein particles from either the chromosome to the nuclear pore complex or their transient retention in the nucleoplasm.
Chironomus tentans (taxid: 7153)

>sp\|Q9GRW7\|NONA_DROVI Protein no-on-transient A OS=Drosophila virilis GN=nonA PE=2 SV=1	Back alignment and function description

>sp\|Q9GRX4\|NONA_DROLR Protein no-on-transient A OS=Drosophila littoralis GN=nonA PE=2 SV=1	Back alignment and function description

>sp\|Q04047\|NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster GN=nonA PE=1 SV=2	Back alignment and function description

>sp\|Q8VIJ6\|SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus GN=Sfpq PE=1 SV=1	Back alignment and function description

>sp\|P23246\|SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2	Back alignment and function description

>sp\|Q5ZK88\|PSPC1_CHICK Paraspeckle component 1 OS=Gallus gallus GN=PSPC1 PE=2 SV=1	Back alignment and function description

>sp\|Q8WXF1\|PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens GN=PSPC1 PE=1 SV=1	Back alignment and function description

>sp\|Q4KLH4\|PSPC1_RAT Paraspeckle component 1 OS=Rattus norvegicus GN=Pspc1 PE=2 SV=1	Back alignment and function description

>sp\|Q99K48\|NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus GN=Nono PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		279
242020088		522	Hrp65 protein, putative [Pediculus human	0.845	0.452	0.552	2e-67
321454568		472	hypothetical protein DAPPUDRAFT_204255 [	0.741	0.438	0.508	3e-63
14572592		512	hrp65-3 isoform [Chironomus tentans]	0.741	0.404	0.495	1e-62
14572590		517	hrp65-2 isoform [Chironomus tentans]	0.741	0.400	0.495	1e-62
156549847		646	PREDICTED: hrp65 protein-like [Nasonia v	0.738	0.318	0.555	2e-62
34922660		535	RecName: Full=Hrp65 protein; AltName: Fu	0.741	0.386	0.495	2e-62
328792621		563	PREDICTED: hrp65 protein-like [Apis mell	0.738	0.365	0.559	2e-62
380023432		563	PREDICTED: hrp65 protein-like [Apis flor	0.738	0.365	0.559	3e-62
383861809		566	PREDICTED: hrp65 protein-like [Megachile	0.738	0.363	0.555	1e-61
340708632		579	PREDICTED: hrp65 protein-like [Bombus te	0.738	0.355	0.542	2e-61

>gi\|242020088\|ref\|XP_002430488.1\| Hrp65 protein, putative [Pediculus humanus corporis] gi\|212515645\|gb\|EEB17750.1\| Hrp65 protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 185/275 (67%), Gaps = 39/275 (14%)

Query: 3   IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62
           IERAVV+ D+RG S  EGI+EF RKP A QAL+RC +G +F+T SL+PVIVEPLD VDD 
Sbjct: 258 IERAVVIGDERGKSTGEGIVEFARKPGATQALRRCTEGCYFITSSLRPVIVEPLDQVDDI 317

Query: 63  EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLE 122
           +G SE+++ KK  ++FK+R +GPRFA  GSFEFEYGTRWKQL+ELYKQKEEAL++E+K+E
Sbjct: 318 DGYSEKSLFKKGPEFFKEREVGPRFANHGSFEFEYGTRWKQLHELYKQKEEALRREMKME 377

Query: 123 EEKLEAQMEFARYENETEILRERECRFVEEALQKELKLEEEKLEAQMEFARYENETEILR 182
           EEKLEAQME+A+YE+ETE                   L                    LR
Sbjct: 378 EEKLEAQMEYAKYEHETE-------------------L--------------------LR 398

Query: 183 EQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQEN 242
           EQLR RE D+ERQK+EWELKER AEEQRR DEE MRRQ EE+ LR+ +Q+EELRRR QEN
Sbjct: 399 EQLRLREQDKERQKREWELKERQAEEQRRSDEEMMRRQAEEMQLRIHRQEEELRRRQQEN 458

Query: 243 SIFMQVIVWLGDLKQGVYQLGLTEGPFICECNNKM 277
           ++FMQ       L Q    LG   G +       M
Sbjct: 459 TLFMQAHQLNSLLDQQEQALGSGPGGYDSAGRGHM 493

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|321454568\|gb\|EFX65733.1\| hypothetical protein DAPPUDRAFT_204255 [Daphnia pulex]	Back alignment and taxonomy information

>gi\|14572592\|emb\|CAC42830.1\| hrp65-3 isoform [Chironomus tentans]	Back alignment and taxonomy information

>gi\|14572590\|emb\|CAC42828.1\| hrp65-2 isoform [Chironomus tentans]	Back alignment and taxonomy information

>gi\|156549847\|ref\|XP_001606842.1\| PREDICTED: hrp65 protein-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|34922660\|sp\|Q9U1N0.1\|HRP65_CHITE RecName: Full=Hrp65 protein; AltName: Full=Ct-Hrp65 gi\|6687398\|emb\|CAB64926.1\| Hrp65 protein [Chironomus tentans] gi\|14572591\|emb\|CAC42829.1\| hrp65-1 isoform [Chironomus tentans]	Back alignment and taxonomy information

>gi\|328792621\|ref\|XP_001121935.2\| PREDICTED: hrp65 protein-like [Apis mellifera]	Back alignment and taxonomy information

>gi\|380023432\|ref\|XP_003695527.1\| PREDICTED: hrp65 protein-like [Apis florea]	Back alignment and taxonomy information

>gi\|383861809\|ref\|XP_003706377.1\| PREDICTED: hrp65 protein-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|340708632\|ref\|XP_003392926.1\| PREDICTED: hrp65 protein-like [Bombus terrestris]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		279
UNIPROTKB\|Q9U1N0		535	HRP65 "Hrp65 protein" [Chirono	0.781	0.407	0.343	4.2e-33
UNIPROTKB\|Q9GRW7		697	nonA "Protein no-on-transient	0.777	0.311	0.350	5.4e-32
FB\|FBgn0004227		700	nonA "no on or off transient A	0.777	0.31	0.352	7.1e-32
ZFIN\|ZDB-GENE-030131-9530		512	pspc1 "paraspeckle component 1	0.505	0.275	0.415	1.7e-31
FB\|FBgn0015520		642	nonA-l "nonA-like" [Drosophila	0.767	0.333	0.343	2.3e-31
UNIPROTKB\|Q9GRX4		698	nonA "Protein no-on-transient	0.777	0.310	0.341	1.4e-30
UNIPROTKB\|F1N941		524	PSPC1 "Paraspeckle component 1	0.745	0.396	0.355	3.7e-30
UNIPROTKB\|Q91017		241	SFPQ "Uncharacterized protein"	0.684	0.792	0.394	7.9e-30
UNIPROTKB\|F1P555		647	SFPQ "Uncharacterized protein"	0.720	0.310	0.397	8.2e-30
UNIPROTKB\|F1LQW3		606	Sfpq "Protein Sfpq" [Rattus no	0.720	0.331	0.392	1.1e-29

UNIPROTKB\|Q9U1N0 HRP65 "Hrp65 protein" [Chironomus tentans (taxid:7153)]	Back alignment and assigned GO terms

 Score = 362 (132.5 bits), Expect = 4.2e-33, P = 4.2e-33
 Identities = 79/230 (34%), Positives = 123/230 (53%)

Query:     3 IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62
             +ERAV++VDDRG +  EGI+EF RK  A  ALK C +  +FLT SL+P +VE  D +D+ 
Sbjct:   213 VERAVIIVDDRGKTTGEGIVEFARKSGAMSALKYCSEKCYFLTSSLRPCVVETFDHIDET 272

Query:    63 EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYXXXXXXXXXXXXXXXXX 122
             +G  E+++ +KS+DY+K R  GPRFA +GSFE E+GT+WKQ+Y                 
Sbjct:   273 DGFPEKSLMRKSNDYYKARQNGPRFAEMGSFEHEFGTKWKQMYDMYKQKHDALKREMQLE 332

Query:   123 XXXXXXXMEFARYENETEILRERECRFVXXXXXXXXXXXXXXXXXXMEFARYENETEILR 182
                    ME+A++E+ETE LRE+                        +  R  +E+ I  
Sbjct:   333 EEKLEAQMEYAKFEHETESLREQ--------LRKREQDRDRQKKEWEDRERQADESRIRD 384

Query:   183 EQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQD 232
             EQ  +R+ D      +  ++ +  E +RR  E ++  Q +++   + QQ+
Sbjct:   385 EQQMRRQQD----DMQMRMQRQDEEMRRRQQENSLFMQAQQLSNMLDQQE 430

GO:0003723 "RNA binding" evidence=NAS

GO:0005634 "nucleus" evidence=IDA

GO:0005737 "cytoplasm" evidence=IDA

GO:0006406 "mRNA export from nucleus" evidence=NAS

UNIPROTKB\|Q9GRW7 nonA "Protein no-on-transient A" [Drosophila virilis (taxid:7244)]	Back alignment and assigned GO terms

FB\|FBgn0004227 nonA "no on or off transient A" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-9530 pspc1 "paraspeckle component 1" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

FB\|FBgn0015520 nonA-l "nonA-like" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9GRX4 nonA "Protein no-on-transient A" [Drosophila littoralis (taxid:47316)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N941 PSPC1 "Paraspeckle component 1" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q91017 SFPQ "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P555 SFPQ "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LQW3 Sfpq "Protein Sfpq" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		279
cd12945		100	cd12945, NOPS_NONA_like, NOPS domain, including C-	4e-40
cd12931		90	cd12931, eNOPS_SF, NOPS domain, including C-termin	3e-25
cd12333		80	cd12333, RRM2_p54nrb_like, RNA recognition motif 2	5e-24
cd12590		80	cd12590, RRM2_PSF, RNA recognition motif 2 in vert	2e-18
cd12589		80	cd12589, RRM2_PSP1, RNA recognition motif 2 in ver	3e-17
cd12591		80	cd12591, RRM2_p54nrb, RNA recognition motif 2 in v	3e-17
pfam08075		52	pfam08075, NOPS, NOPS (NUC059) domain	7e-17
cd12946		93	cd12946, NOPS_p54nrb_PSF_PSPC1, NOPS domain, inclu	2e-15
cd12949		94	cd12949, NOPS_PSPC1, NOPS domain, including C-term	4e-15
cd12947		94	cd12947, NOPS_p54nrb, NOPS domain, including C-ter	8e-15
cd12948		97	cd12948, NOPS_PSF, NOPS domain, including C-termin	1e-14
pfam12037		276	pfam12037, DUF3523, Domain of unknown function (DU	5e-05
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	9e-04
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	0.001
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.002
TIGR02680		1353	TIGR02680, TIGR02680, TIGR02680 family protein	0.003

>gnl\|CDD\|240580 cd12945, NOPS_NONA_like, NOPS domain, including C-terminal coiled-coil region, in p54nrb/PSF/PSP1 homologs from invertebrate species	Back alignment and domain information

 Score =  134 bits (339), Expect = 4e-40
 Identities = 67/97 (69%), Positives = 88/97 (90%)

Query: 48  LKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYEL 107
           L+P +VEP++ +DDE+GL E++++KK+ ++ K+RSIGPRFA   SFE EYGTRWKQL+EL
Sbjct: 1   LRPCVVEPMEEIDDEDGLPEKSLNKKNPEFNKERSIGPRFAEPNSFEHEYGTRWKQLHEL 60

Query: 108 YKQKEEALQKELKLEEEKLEAQMEFARYENETEILRE 144
           YKQKEEAL++ELK+EEEKLEAQME+ARYE+ETE+LRE
Sbjct: 61  YKQKEEALKRELKMEEEKLEAQMEYARYEHETELLRE 97

The family contains a DBHS domain (for Drosophila behavior, human splicing), which comprises two conserved RNA recognition motifs (RRMs), also termed RBDs (RNA binding domains) or RNPs (ribonucleoprotein domains), and a charged protein-protein interaction NOPS (NONA and PSP1) domain. This model corresponds to the NOPS domain, with a long helical C-terminal extension , found in Drosophila melanogaster gene no-ontransient A (nonA) encoding puff-specific protein Bj6 (also termed NONA), Chironomus tentans hrp65 gene encoding protein Hrp65 and similar proteins. D. melanogaster NONA is involved in eye development and behavior, and may play a role in circadian rhythm maintenance, similar to vertebrate p54nrb. C. tentans hrp65 is a component of nuclear fibers associated with ribonucleoprotein particles in transit from the gene to the nuclear pore. The NOPS domain specifically binds to the second RNA recognition motif (RRM2) domain of the partner DBHS protein via a substantial interaction surface. Its highly conserved C-terminal residues are critical for functional DBHS dimerization while the highly conserved C-terminal helical extension, forming a right-handed antiparallel heterodimeric coiled-coil, is essential for localization of these proteins to subnuclear bodies. Length = 100

>gnl\|CDD\|240579 cd12931, eNOPS_SF, NOPS domain, including C-terminal helical extension region, in the p54nrb/PSF/PSP1 family	Back alignment and domain information

>gnl\|CDD\|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family	Back alignment and domain information

>gnl\|CDD\|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF)	Back alignment and domain information

>gnl\|CDD\|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1)	Back alignment and domain information

>gnl\|CDD\|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb)	Back alignment and domain information

>gnl\|CDD\|149257 pfam08075, NOPS, NOPS (NUC059) domain	Back alignment and domain information

>gnl\|CDD\|240581 cd12946, NOPS_p54nrb_PSF_PSPC1, NOPS domain, including C-terminal coiled-coil region, in p54nrb/PSF/PSPC1 family proteins	Back alignment and domain information

>gnl\|CDD\|240584 cd12949, NOPS_PSPC1, NOPS domain, including C-terminal coiled-coil region, in paraspeckle protein component 1 (PSPC1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240582 cd12947, NOPS_p54nrb, NOPS domain, including C-terminal coiled-coil region, in 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240583 cd12948, NOPS_PSF, NOPS domain, including C-terminal coiled-coil region, in polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) and similar proteins	Back alignment and domain information

>gnl\|CDD\|221389 pfam12037, DUF3523, Domain of unknown function (DUF3523)	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233973 TIGR02680, TIGR02680, TIGR02680 family protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		279
KOG0115\|consensus		275		100.0
PF08075		52	NOPS: NOPS (NUC059) domain; InterPro: IPR012975 Th	99.93
KOG0115\|consensus		275		98.06
KOG0149\|consensus		247		96.61
smart00362		72	RRM_2 RNA recognition motif.	96.42
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	96.21
smart00361		70	RRM_1 RNA recognition motif.	96.12
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	95.85
smart00360		71	RRM RNA recognition motif.	95.78
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	95.62
COG0724		306	RNA-binding proteins (RRM domain) [General functio	95.4
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	95.19
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	94.97
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	94.63
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	94.54
KOG1029\|consensus		1118		94.03
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	93.99
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	93.71
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	93.32
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	92.46
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	92.44
KOG0123\|consensus		369		92.42
KOG1029\|consensus		1118		91.84
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	91.74
KOG0144\|consensus		510		91.73
PLN03120		260	nucleic acid binding protein; Provisional	91.03
KOG0148\|consensus		321		90.83
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	90.26
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	89.5
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	89.14
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	88.65
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	88.15
PLN03121		243	nucleic acid binding protein; Provisional	87.59
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	86.47
PTZ00121		2084	MAEBL; Provisional	81.73
KOG0147\|consensus		549		80.65
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	80.37

>KOG0115\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.8e-52  Score=382.80  Aligned_cols=216  Identities=37%  Similarity=0.484  Sum_probs=194.8

Q ss_pred             CcceeEEEeCCCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecCcccccccCchhhhhcccCchhhhhh
Q psy7437           2 NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQR   81 (279)
Q Consensus         2 ~VERAVViVDdRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~e~~DdeDGLpEK~l~~k~~~f~kER   81 (279)
                      +||+|||+|||+|++||+|||+|++||+|.+|+++|++|||++|++++||+|+|+++.||+||+|++ +..+++.|.+||
T Consensus        57 ~~e~av~~vD~r~k~t~eg~v~~~~k~~a~~a~rr~~~~g~~~~~~~~p~~VeP~eq~~d~~G~~~k-~~~~~~~~~~e~  135 (275)
T KOG0115|consen   57 PIERAVAKVDDRGKPTREGIVEFAKKPNARKAARRCREGGFGGTTGGRPVGVEPMEQPDDNDGGPEK-GGGGGPSGPKER  135 (275)
T ss_pred             ccchheeeecccccccccchhhhhcchhHHHHHHHhccCccccCCCCCccCCChhhccCCCCcchhh-cCCCCCCCCccc
Confidence            7999999999999999999999999999999999999999999999999999999999999999999 678999999999


Q ss_pred             ccCCCCCCCCCchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh-hhhHHHHHHHHHHhHHHHHHHHHHHH
Q psy7437          82 SIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFAR-YENETEILRERECRFVEEALQKELKL  160 (279)
Q Consensus        82 E~gPRfa~~gsFE~EygqRWK~L~e~eKqqrE~l~reikee~EKLEaEME~a~-~ehq~~lLre~l~r~~~e~~~~~~~~  160 (279)
                      +.|||||.+|||+|+|+++||.|++++|++.+.|+.+|+++.+|||++||+|+ |+||++|+|++|+++++++++     
T Consensus       136 ~~p~r~a~~g~fe~e~~~~~k~l~~mekq~qd~v~~n~kea~~klE~~me~arghe~q~~l~rq~lmrrqeelrr-----  210 (275)
T KOG0115|consen  136 EQPPRFAQQGSFEVEYGSRWKMLGGMEKQGQDQVDRNIKEAQDKLEAPMEKARGHECQLMLGRQPLMRREEELRR-----  210 (275)
T ss_pred             cCCchhccccccccccCccccccccccccCCcccccccchhhhccccccccccCccceeeecCCCcccccHHHHH-----
Confidence            99999999999999999999999999999999999999999999999999999 999999999999999999999     


Q ss_pred             HHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHhHHHHHHHHhhhhHHHHHHhh
Q psy7437         161 EEEKLEAQMEFARYENETEILREQLRQREADRERQKQEWELKERHAEEQRRCDEEAMRRQTEEIHLRMQQQDEELRRRHQ  240 (279)
Q Consensus       161 ~~~kle~qmE~a~~e~e~~~~Rq~l~~rqe~~~rqk~e~em~~r~~ee~rr~~Ee~mrrq~ee~~~r~~~q~~~~~rr~q  240 (279)
                              |+..  ++++++.|.++..++++.++..                +++++++..           .++++|||
T Consensus       211 --------me~l--~nqe~qkr~~~~~~eee~r~r~----------------~~~~~~~~~-----------~~~~~rqq  253 (275)
T KOG0115|consen  211 --------MEEL--HNQEAKKRKEINLREEEERLRR----------------IEEMDNHEE-----------GEMYRRQQ  253 (275)
T ss_pred             --------HHHH--hhHHHHHhhhhhhhHHHHHHHH----------------HHHHhccCc-----------hhcccccc
Confidence                    9977  8888888888877776653333                333333321           15679999


Q ss_pred             hchhHHHHHHHhhchhhhhh
Q psy7437         241 ENSIFMQVIVWLGDLKQGVY  260 (279)
Q Consensus       241 e~~~~~q~~~~~~~~~~~~~  260 (279)
                      |+++|++..-.++..|...+
T Consensus       254 e~~~~~~~y~d~~~~~e~~g  273 (275)
T KOG0115|consen  254 EPGGMFGSYGDNGYPDEKKG  273 (275)
T ss_pred             ccCceeccccccCCchhhcc
Confidence            99999998888877776543

>PF08075 NOPS: NOPS (NUC059) domain; InterPro: IPR012975 This domain is found C-terminal to 1 or 2 IPR000504 from INTERPRO domains [] in NONA and PSP1 proteins	Back alignment and domain information

>KOG0115\|consensus	Back alignment and domain information

>KOG0149\|consensus	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG1029\|consensus	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG0123\|consensus	Back alignment and domain information

>KOG1029\|consensus	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>KOG0144\|consensus	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0148\|consensus	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>PTZ00121 MAEBL; Provisional	Back alignment and domain information

>KOG0147\|consensus	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		279
3sde_B		261	Crystal Structure Of A Paraspeckle-Protein Heterodi		9e-28
3sde_A		261	Crystal Structure Of A Paraspeckle-Protein Heterodi		3e-27

>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261

Back alignment and structure

Iteration: 1

Score = 120 bits (301), Expect = 9e-28, Method: Compositional matrix adjust. Identities = 62/140 (44%), Positives = 82/140 (58%), Gaps = 1/140 (0%) Query: 3 IERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDE 62 +ERAVV+VDDRG +GI+EF+ KPAA +AL RC +G F LT +PV VEP+D +DDE Sbjct: 123 VERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDE 182 Query: 63 EGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYXXXXXXXXXXXXXXXXX 122 EGL E+ V K+ + K+R PRFA GSFE+EY RWK L Sbjct: 183 EGLPEKLVI-KNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEA 241 Query: 123 XXXXXXXMEFARYENETEIL 142 ME AR+E++ ++ Sbjct: 242 REKLEMEMEAARHEHQVMLM 261

PyMOL of 3sde

>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		279
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	6e-35
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	9e-08
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-06
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	6e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	4e-07
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	6e-07
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-06
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	4e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	8e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	9e-05
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	2e-04
2qag_C		418	Septin-7; cell cycle, cell division, GTP-binding,	5e-04

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261	Back alignment and structure

 Score =  125 bits (316), Expect = 6e-35
 Identities = 68/141 (48%), Positives = 101/141 (71%), Gaps = 1/141 (0%)

Query: 2   NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDD 61
            +E+AVV+VDDRG +  +G +EF  KP A +AL+RC DG F LT + +PVIVEP++  DD
Sbjct: 122 PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDD 181

Query: 62  EEGLSERTVSKKSSDYFKQRSIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKL 121
           E+GL E+ + +K+  Y K+R   PRFA  G+FEFEY +RWK L E+ KQ+ E + + ++ 
Sbjct: 182 EDGLPEKLM-QKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIRE 240

Query: 122 EEEKLEAQMEFARYENETEIL 142
            +EKLEA+ME AR+E++  ++
Sbjct: 241 AKEKLEAEMEAARHEHQLMLM 261

PyMOL of 3sde

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 418	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		279
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.98
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	97.54
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	97.35
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	97.32
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	97.31
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	97.29
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	97.26
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	97.21
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	97.18
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	97.18
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.17
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	97.17
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	97.13
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	97.13
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	97.13
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	97.12
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	97.12
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	97.09
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	97.05
1x5o_A		114	RNA binding motif, single-stranded interacting pro	97.04
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	97.04
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	97.02
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	97.0
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	96.99
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	96.99
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	96.97
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	96.95
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	96.94
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	96.91
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	96.91
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	96.91
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	96.89
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	96.86
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	96.86
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	96.86
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	96.85
2div_A		99	TRNA selenocysteine associated protein; structural	96.83
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	96.81
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	96.81
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	96.8
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	96.79
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	96.77
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	96.76
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	96.76
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	96.75
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	96.75
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	96.74
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	96.73
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	96.69
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	96.67
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	96.67
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	96.67
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	96.67
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	96.66
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	96.66
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	96.66
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	96.63
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	96.63
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	96.62
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	96.61
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	96.61
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	96.6
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	96.6
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	96.6
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	96.59
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	96.59
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	96.59
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	96.58
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	96.57
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	96.57
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	96.56
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	96.55
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	96.54
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	96.54
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	96.52
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	96.51
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	96.49
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	96.49
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	96.48
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	96.47
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	96.47
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	96.46
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	96.45
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	96.44
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	96.43
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	96.42
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	96.33
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	96.32
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	96.31
1x4e_A		85	RNA binding motif, single-stranded interacting pro	96.31
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	96.29
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	96.28
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	96.28
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	96.26
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.25
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	96.23
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	96.21
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	96.19
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	96.18
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	96.18
2dis_A		109	Unnamed protein product; structural genomics, RRM	96.17
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	96.11
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	96.11
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	96.11
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	96.11
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	96.1
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	96.1
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	96.09
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	96.08
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	96.07
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	96.04
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	96.02
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	95.96
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	95.93
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	95.82
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	95.76
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	95.75
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	95.74
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	95.72
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	95.7
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	95.7
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	95.7
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	95.65
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	95.62
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	95.6
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	95.56
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	95.48
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	94.42
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	95.39
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	95.36
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	95.34
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	95.27
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	95.19
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	94.9
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	94.88
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	94.81
1x5p_A		97	Negative elongation factor E; structure genomics,	94.73
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	94.71
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	94.69
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	94.6
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	94.59
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	94.52
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	94.38
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	94.2
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	94.08
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	94.06
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	94.02
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	93.98
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	93.76
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	93.24
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	92.95
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	92.86
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	92.73
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	92.55
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	92.53
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	92.52
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	92.5
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	92.21
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	92.13
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	91.85
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	91.83
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	91.8
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	91.73
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	91.54
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	91.16
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	91.15
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	91.01
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	90.95
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	90.76
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	90.33
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	90.17
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	90.03
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	89.92
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	89.5
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	89.49
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	89.46
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	89.45
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	89.45
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	89.26
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	89.1
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	89.03
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	88.97
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	88.95
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	88.6
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	88.49
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	88.35
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	87.79
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	87.67
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	87.43
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	86.77
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	86.49
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	84.42
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	83.65
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	82.57

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

Probab=99.98  E-value=1.4e-32  Score=236.82  Aligned_cols=140  Identities=49%  Similarity=0.869  Sum_probs=135.9

Q ss_pred             CcceeEEEeCCCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecCcccccccCchhhhhcccCchhhhhh
Q psy7437           2 NIERAVVLVDDRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPLDLVDDEEGLSERTVSKKSSDYFKQR   81 (279)
Q Consensus         2 ~VERAVViVDdRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~e~~DdeDGLpEK~l~~k~~~f~kER   81 (279)
                      +|..+.|+.|..|+|.|.|+|+|+...+|.+||..++.|.|+++.++|||+|.|....++.+|+|++.+. +++.|+++|
T Consensus       122 ~i~~v~i~~~~~g~~~g~afV~f~~~~~A~~A~~~l~~~~~~~~~~~r~i~v~~~~~~~~~~~~~~~~~~-~~~~~~~~r  200 (261)
T 3sde_A          122 PVEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDEDGLPEKLMQ-KTQQYHKER  200 (261)
T ss_dssp             CEEEEEEEEETTSCEEEEEEEEESSHHHHHHHHHHHHHSCEESSSSCCBCEEEECCCEESSSCCCGGGSC-CCHHHHHHH
T ss_pred             CeEEEEeeeCCCCCcCcEEEEEeCCHHHHHHHHHHhcCCeEEecCCCceEEEeeccccCccCCCcchhhh-cchhhhhhc
Confidence            5788999999999999999999999999999999999999999999999999999999999999999885 799999999


Q ss_pred             ccCCCCCCCCCchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHH
Q psy7437          82 SIGPRFATIGSFEFEYGTRWKQLYELYKQKEEALQKELKLEEEKLEAQMEFARYENETEIL  142 (279)
Q Consensus        82 E~gPRfa~~gsFE~EygqRWK~L~e~eKqqrE~l~reikee~EKLEaEME~a~~ehq~~lL  142 (279)
                      +.||||+.||||+|+|+++|++|++++++++++++++++++++||++||++|+|+||++||
T Consensus       201 ~~~p~~~~pgs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~  261 (261)
T 3sde_A          201 EQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAKEKLEAEMEAARHEHQLMLM  261 (261)
T ss_dssp             TSCSEECCTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             cCCCCCCCCCcccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhcC
Confidence            9999999999999999999999999999999999999999999999999999999999874

PyMOL of 3sde

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		279
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	97.6
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	97.52
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	97.5
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	97.28
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	97.26
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.23
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.22
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	97.19
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	97.19
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	97.17
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	97.16
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	97.15
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.07
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	97.06
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	97.0
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	96.97
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	96.92
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	96.91
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	96.9
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	96.9
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	96.89
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	96.88
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	96.88
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	96.81
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	96.71
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	96.68
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	96.67
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	96.64
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	96.62
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	96.6
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	96.56
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	96.52
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	96.47
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	96.47
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	96.46
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	96.44
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	96.42
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	96.37
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	96.3
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	96.28
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	96.26
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	96.22
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	96.15
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	96.05
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	96.01
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	95.97
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	95.95
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	95.92
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.87
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	95.76
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	95.71
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	95.31
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	95.3
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	95.26
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	95.15
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	95.06
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	94.36
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	94.32
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	93.75
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	93.71
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	93.66
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	93.57
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	93.44
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	92.95
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	92.16
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	91.87
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	91.62
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	91.35
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	90.84
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	90.64
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	90.59
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	90.04
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	89.73
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	89.58
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	89.03
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	88.77
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	87.03
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	86.36
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	86.26
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	86.02
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	85.14
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	85.11
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	84.97
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	83.89
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	83.08
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	82.84
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	82.81

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein 12
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.60  E-value=2.5e-05  Score=57.35  Aligned_cols=49  Identities=14%  Similarity=0.228  Sum_probs=40.1

Q ss_pred             cceeEEEeC-CCCCCCCceeeeccCCHHHHHHHHHccCCceeecCCCCceEeecC
Q psy7437           3 IERAVVLVD-DRGNSKNEGIIEFTRKPAAAQALKRCQDGVFFLTQSLKPVIVEPL   56 (279)
Q Consensus         3 VERAVViVD-dRGrstGeGiVEFa~Kp~A~kAL~rc~eg~FlLTtsprPviVEp~   56 (279)
                      |..+|++++ +.|+|+|.|+|+|....+|.+||. + .|.+|   .-|+|.|.|.
T Consensus        35 i~~~~~~~~~~~g~~~G~afV~F~s~~~a~~Al~-~-n~~~i---~gr~i~V~~~   84 (103)
T d2cpya1          35 DENAVHVLVDNNGQGLGQALVQFKNEDDARKSER-L-HRKKL---NGREAFVHVV   84 (103)
T ss_dssp             CSTTEEECCCTTSSCSSCEEEECSSHHHHHHHGG-G-CSEEE---TTEEEEEEEE
T ss_pred             EEEEEEEEeCCCCCcCccEEEEECCHHHHHHHHh-c-CCCeE---CCcEEEEEEC
Confidence            455566655 559999999999999999999997 4 57766   5689999886

PyMOL of d2cpya1

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure