Psyllid ID: psy7453


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MLVTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH
ccccccccHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHcccc
ccEEccHHHHHHHHHHHcccHHHcccccccHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHEEEEcccccccccHHHHHHHccccHHHHHcccccEEcccccccccccHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHccccEEccccccEEcHHHHHHHHHHHHcc
MLVTITPTLAKVFLVILEptlernrtnitsDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTtiptqnhslckhchsqlshldlldhcktcsymirpnanntfspFCIYCKAVLSTNLNELIEHCRTcksmirtdpfrhkfvcyacdyfsynigcmrshirthtgekpyacgqcafrsasvAGLHYHLKKTYH
mlvtitptlaKVFLVILEptlernrtnitSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH
MLVTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQilnlnlsvllvttiPTQNHSLCKhchsqlshldlldhcKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH
**VTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHL*****
*****TPTL*********************DVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLS*********TCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLH*HL*****
MLVTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH
MLVTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHL*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVTITPTLAKVFLVILEPTLERNRTNITSDVYIAVLVFSNLTFFITAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLLDHCKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKTYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
Q8VIG1 1082 RE1-silencing transcripti yes N/A 0.485 0.089 0.285 1e-07
O54963 1069 RE1-silencing transcripti yes N/A 0.485 0.090 0.276 1e-07
Q08705 728 Transcriptional repressor yes N/A 0.38 0.104 0.382 3e-07
Q61164 736 Transcriptional repressor no N/A 0.38 0.103 0.382 4e-07
Q9R1D1 737 Transcriptional repressor no N/A 0.38 0.103 0.382 4e-07
P49711 727 Transcriptional repressor yes N/A 0.38 0.104 0.382 4e-07
A2APF3636 Transcriptional repressor no N/A 0.38 0.119 0.393 1e-06
Q13127 1097 RE1-silencing transcripti no N/A 0.485 0.088 0.267 1e-06
Q03172 2688 Zinc finger protein 40 OS no N/A 0.485 0.036 0.267 1e-06
Q2EI21 1501 RE1-silencing transcripti N/A N/A 0.49 0.065 0.292 2e-06
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 45/112 (40%), Gaps = 15/112 (13%)

Query: 95  CKTCSYMIRPNANNTFSPFCIYCKAVLSTNLNELIEHCRTC----------KSMIRTDPF 144
           C  C Y       N +  +  + K  L    NE I  C  C          +  +R    
Sbjct: 213 CDRCGY-----NTNRYDHYMAHLKHHLRAGENERIYKCIICTYTTVSEYHWRKHLRNHFP 267

Query: 145 RHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLK 196
           R  + C  C+YFS        H+RTHTGE+PY C  C + S+    L  H++
Sbjct: 268 RKVYTCSKCNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMR 319




Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.
Mus musculus (taxid: 10090)
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|Q08705|CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus GN=CTCF PE=1 SV=1 Back     alignment and function description
>sp|Q61164|CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus GN=Ctcf PE=1 SV=2 Back     alignment and function description
>sp|Q9R1D1|CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus GN=Ctcf PE=2 SV=1 Back     alignment and function description
>sp|P49711|CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens GN=CTCF PE=1 SV=1 Back     alignment and function description
>sp|A2APF3|CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus GN=Ctcfl PE=1 SV=1 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|Q03172|ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus GN=Hivep1 PE=1 SV=1 Back     alignment and function description
>sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
260792114 921 hypothetical protein BRAFLDRAFT_69373 [B 0.655 0.142 0.262 4e-08
260810935 1052 hypothetical protein BRAFLDRAFT_66686 [B 0.19 0.036 0.406 1e-06
391346127 1161 PREDICTED: uncharacterized protein LOC10 0.41 0.070 0.317 1e-06
260823036 1004 hypothetical protein BRAFLDRAFT_71723 [B 0.21 0.041 0.464 2e-06
444518559 1981 Leucine-rich repeat-containing protein 1 0.525 0.053 0.328 3e-06
357609802 671 putative CTCF-like protein [Danaus plexi 0.405 0.120 0.350 3e-06
260813386 1077 hypothetical protein BRAFLDRAFT_103420 [ 0.285 0.052 0.413 3e-06
391343767299 PREDICTED: zinc finger protein 775-like 0.37 0.247 0.383 4e-06
355749386 1095 Neural-restrictive silencer factor [Maca 0.485 0.088 0.276 4e-06
432950074 473 PREDICTED: zinc finger and SCAN domain-c 0.515 0.217 0.313 4e-06
>gi|260792114|ref|XP_002591072.1| hypothetical protein BRAFLDRAFT_69373 [Branchiostoma floridae] gi|229276272|gb|EEN47083.1| hypothetical protein BRAFLDRAFT_69373 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score = 63.5 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 46/175 (26%), Positives = 75/175 (42%), Gaps = 44/175 (25%)

Query: 69  TTIPTQNHSLCKHC-------HSQLSHLDLLD-----HCKTCSY--------MIRPNANN 108
           T +  +   +CK C       H+ L+HL L        C  C Y         +    N 
Sbjct: 664 THVEKKTPLVCKKCGYQTIRKHNFLAHLRLHTGEKPFSCGQCDYKTAFKTSLTLHFKTNK 723

Query: 109 TFSP-------FCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFV------------ 149
           +  P       F   CK  + T+L +    C+TC +++ +     K V            
Sbjct: 724 SKEPLSCEDCSFSTTCKRAMRTHLKDHTYACKTCDAVLNSKEELQKHVRNHQKEESEKAL 783

Query: 150 -CYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHL----KKTY 199
            C  CDY +++  C+  H+R HTGEKP+AC +C++R+ + + L  H+    KKT+
Sbjct: 784 RCKVCDYKAFSRPCLEIHMRKHTGEKPFACQECSYRAKAKSTLKIHIANKHKKTF 838




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260810935|ref|XP_002600178.1| hypothetical protein BRAFLDRAFT_66686 [Branchiostoma floridae] gi|229285464|gb|EEN56190.1| hypothetical protein BRAFLDRAFT_66686 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|391346127|ref|XP_003747330.1| PREDICTED: uncharacterized protein LOC100905253 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|260823036|ref|XP_002603989.1| hypothetical protein BRAFLDRAFT_71723 [Branchiostoma floridae] gi|229289314|gb|EEN60000.1| hypothetical protein BRAFLDRAFT_71723 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|444518559|gb|ELV12229.1| Leucine-rich repeat-containing protein 16C [Tupaia chinensis] Back     alignment and taxonomy information
>gi|357609802|gb|EHJ66686.1| putative CTCF-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|260813386|ref|XP_002601399.1| hypothetical protein BRAFLDRAFT_103420 [Branchiostoma floridae] gi|229286694|gb|EEN57411.1| hypothetical protein BRAFLDRAFT_103420 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|391343767|ref|XP_003746177.1| PREDICTED: zinc finger protein 775-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|355749386|gb|EHH53785.1| Neural-restrictive silencer factor [Macaca fascicularis] Back     alignment and taxonomy information
>gi|432950074|ref|XP_004084376.1| PREDICTED: zinc finger and SCAN domain-containing protein 2-like [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
UNIPROTKB|P49711 727 CTCF "Transcriptional represso 0.38 0.104 0.382 3.5e-09
UNIPROTKB|E2RJR9 728 CTCF "Uncharacterized protein" 0.38 0.104 0.382 3.5e-09
MGI|MGI:109447 736 Ctcf "CCCTC-binding factor" [M 0.38 0.103 0.382 3.6e-09
RGD|621344 737 Ctcf "CCCTC-binding factor (zi 0.38 0.103 0.382 3.6e-09
UNIPROTKB|Q9R1D1 737 Ctcf "Transcriptional represso 0.38 0.103 0.382 3.6e-09
UNIPROTKB|F1NFT1 728 CTCF "Transcriptional represso 0.38 0.104 0.382 5.6e-09
UNIPROTKB|E1BZC3 733 CTCF "Transcriptional represso 0.38 0.103 0.382 5.7e-09
UNIPROTKB|Q08705 728 CTCF "Transcriptional represso 0.38 0.104 0.382 7.2e-09
RGD|2321501635 Ctcfl "CCCTC-binding factor (z 0.38 0.119 0.382 3.9e-08
UNIPROTKB|I3L710 399 LOC100624697 "Uncharacterized 0.38 0.190 0.382 3.9e-08
UNIPROTKB|P49711 CTCF "Transcriptional repressor CTCF" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 133 (51.9 bits), Expect = 3.5e-09, Sum P(2) = 3.5e-09
 Identities = 34/89 (38%), Positives = 42/89 (47%)

Query:   114 CIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGE 173
             C YC AV       LI+H ++ K+         +F C  CDY       M  H RTHTGE
Sbjct:   469 CRYCDAVFHERY-ALIQHQKSHKN-------EKRFKCDQCDYACRQERHMIMHKRTHTGE 520

Query:   174 KPYACGQC--AFRSASVAGLHYHLKKTYH 200
             KPYAC  C   FR   +  +H+   K YH
Sbjct:   521 KPYACSHCDKTFRQKQLLDMHF---KRYH 546


GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0007059 "chromosome segregation" evidence=IEA
GO:0016568 "chromatin modification" evidence=IEA
GO:0006349 "regulation of gene expression by genetic imprinting" evidence=IEA
GO:0010216 "maintenance of DNA methylation" evidence=IEA
GO:0031060 "regulation of histone methylation" evidence=IEA
GO:0035065 "regulation of histone acetylation" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0008270 "zinc ion binding" evidence=TAS
GO:0005730 "nucleolus" evidence=IDA
GO:0005654 "nucleoplasm" evidence=IDA
GO:0000793 "condensed chromosome" evidence=IDA
GO:0000775 "chromosome, centromeric region" evidence=IDA
GO:0070602 "regulation of centromeric sister chromatid cohesion" evidence=NAS
GO:0010628 "positive regulation of gene expression" evidence=IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IMP;IDA
GO:0016584 "nucleosome positioning" evidence=IDA
GO:0043035 "chromatin insulator sequence binding" evidence=IDA
GO:0044212 "transcription regulatory region DNA binding" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0040029 "regulation of gene expression, epigenetic" evidence=IMP
GO:0040030 "regulation of molecular function, epigenetic" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003714 "transcription corepressor activity" evidence=TAS
UNIPROTKB|E2RJR9 CTCF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:109447 Ctcf "CCCTC-binding factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621344 Ctcf "CCCTC-binding factor (zinc finger protein)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9R1D1 Ctcf "Transcriptional repressor CTCF" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFT1 CTCF "Transcriptional repressor CTCF" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZC3 CTCF "Transcriptional repressor CTCF" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q08705 CTCF "Transcriptional repressor CTCF" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2321501 Ctcfl "CCCTC-binding factor (zinc finger protein)-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L710 LOC100624697 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
KOG2462|consensus279 99.95
KOG2462|consensus279 99.9
KOG3608|consensus 467 99.71
KOG3576|consensus267 99.69
KOG3623|consensus1007 99.68
KOG1074|consensus 958 99.67
KOG1074|consensus958 99.64
KOG3623|consensus 1007 99.59
KOG3576|consensus267 99.58
KOG3608|consensus467 99.55
PHA00733128 hypothetical protein 99.41
PHA0276855 hypothetical protein; Provisional 99.16
PLN03086567 PRLI-interacting factor K; Provisional 99.11
PLN03086567 PRLI-interacting factor K; Provisional 99.08
PHA00733128 hypothetical protein 99.03
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.0
PHA0276855 hypothetical protein; Provisional 98.91
KOG3993|consensus 500 98.66
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.65
KOG3993|consensus500 98.62
PHA0061644 hypothetical protein 98.57
PHA0073279 hypothetical protein 98.5
PHA0061644 hypothetical protein 98.36
PHA0073279 hypothetical protein 98.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.3
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.2
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.08
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.02
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.94
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.92
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.91
COG5189423 SFP1 Putative transcriptional repressor regulating 97.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.61
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.57
smart0035526 ZnF_C2H2 zinc finger. 97.46
COG5189423 SFP1 Putative transcriptional repressor regulating 97.43
PRK04860160 hypothetical protein; Provisional 97.34
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.14
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.12
smart0035526 ZnF_C2H2 zinc finger. 97.05
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.02
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.75
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.58
PRK04860160 hypothetical protein; Provisional 96.49
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.26
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.08
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.03
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.12
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.05
KOG2231|consensus 669 94.57
COG5048467 FOG: Zn-finger [General function prediction only] 94.24
KOG1146|consensus 1406 94.11
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.02
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.76
COG5048 467 FOG: Zn-finger [General function prediction only] 93.67
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.52
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.1
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.6
COG404965 Uncharacterized protein containing archaeal-type C 90.7
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.11
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.99
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.3
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.17
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 89.0
KOG1146|consensus1406 88.73
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 88.61
KOG2231|consensus 669 88.48
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 88.42
PHA0062659 hypothetical protein 88.25
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.59
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 87.44
COG1198 730 PriA Primosomal protein N' (replication factor Y) 87.02
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.76
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 86.65
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 85.92
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 85.59
KOG2482|consensus423 85.42
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 85.33
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 85.17
COG404965 Uncharacterized protein containing archaeal-type C 84.43
PF09986214 DUF2225: Uncharacterized protein conserved in bact 84.26
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 83.62
KOG2893|consensus 341 82.9
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 82.57
COG1592166 Rubrerythrin [Energy production and conversion] 82.33
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 82.16
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 81.44
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.32
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.6
>KOG2462|consensus Back     alignment and domain information
Probab=99.95  E-value=2e-28  Score=188.46  Aligned_cols=116  Identities=24%  Similarity=0.362  Sum_probs=107.2

Q ss_pred             CCCCccccccccccccccccc---------------ccccccCcccCCCC-------CCCCcccccChhhhccCHHHHHh
Q psy7453          73 TQNHSLCKHCHSQLSHLDLLD---------------HCKTCSYMIRPNAN-------NTFSPFCIYCKAVLSTNLNELIE  130 (200)
Q Consensus        73 ~~~~~~C~~C~~~f~~~~~l~---------------~C~~C~~~f~~~~~-------~~~~~~C~~C~~~f~~~~~~l~~  130 (200)
                      ....|.|+.||+.+.+.++|.               .|++||+.|.....       ..-+++|.+|||.|+. .|-|+.
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~l~c~C~iCGKaFSR-PWLLQG  205 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHTLPCECGICGKAFSR-PWLLQG  205 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccCCCcccccccccccc-hHHhhc
Confidence            344699999999999998873               79999999987654       5568999999999999 999999


Q ss_pred             chhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHh
Q psy7453         131 HCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLK  196 (200)
Q Consensus       131 H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~  196 (200)
                      |      + |+|+|||||.|+.|+++|.+.++|+.|+++|.+.|+|+|+.|+|+|+.++-|.+|.-
T Consensus       206 H------i-RTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~E  264 (279)
T KOG2462|consen  206 H------I-RTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSE  264 (279)
T ss_pred             c------c-ccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhh
Confidence            9      9 999999999999999999999999999999999999999999999999999999974



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 5e-04
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-04
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure

Iteration: 1

Score = 40.8 bits (94), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 22/32 (68%) Query: 166 HIRTHTGEKPYACGQCAFRSASVAGLHYHLKK 197 H+RTHTGEKPY C C + +A L YHL++ Sbjct: 23 HLRTHTGEKPYKCEFCEYAAAQKTSLRYHLER 54
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-05
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-05
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 3e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
 Score = 47.9 bits (115), Expect = 3e-08
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 150 CYACDY-FSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKK 197
           C  C Y  S     +R H R H  ++P+ C  C+F +   + L  H+KK
Sbjct: 12  CSECSYSCSSK-AALRIHERIHCTDRPFKCNYCSFDTKQPSNLSKHMKK 59


>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.88
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.88
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.86
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.86
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.85
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.84
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.83
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.83
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.81
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.8
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.8
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.78
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.77
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.76
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.74
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.72
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.71
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.7
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.7
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.7
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.69
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.69
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.68
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.67
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.67
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.65
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.64
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.63
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.61
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.61
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.58
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.57
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.56
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.56
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.55
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.53
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.5
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.5
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.49
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.48
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.47
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.47
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.46
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.46
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.46
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.46
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.45
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.45
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.45
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.45
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.45
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.44
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.44
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.42
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.4
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.39
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.38
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.36
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.34
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.34
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.34
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.33
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.32
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.31
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.3
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.3
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.28
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.25
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.24
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.22
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.21
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.14
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.1
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.1
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.09
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.01
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.01
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.99
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.96
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.95
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.88
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.88
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.88
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.88
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.86
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.86
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.85
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.83
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.81
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.8
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.79
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.74
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.74
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.7
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.69
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.69
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.66
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.65
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.64
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.63
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.63
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.63
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.6
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.6
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.59
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.58
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.57
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.56
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.55
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.55
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.54
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.54
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.54
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.54
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.53
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.51
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.51
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.48
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.48
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.47
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.47
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.46
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.46
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.46
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.83
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.44
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.82
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.44
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.81
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.8
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.79
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.42
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.39
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.36
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.34
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.32
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.5
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.1
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.89
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.52
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.16
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.81
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.71
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.44
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.33
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.61
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.48
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.72
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.81
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 89.74
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 89.24
2k5c_A95 Uncharacterized protein PF0385; structural genomic 86.96
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 83.5
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 82.85
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 82.06
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 82.01
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 81.76
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 81.73
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 81.03
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=3.8e-30  Score=193.97  Aligned_cols=143  Identities=24%  Similarity=0.338  Sum_probs=121.4

Q ss_pred             hcccccccccchhhhhhhhhhhcCCCCCCCcccccccccccccccc------------cccccccCcccCCCC-------
Q psy7453          47 TAQLVLMSLDQILNLNLSVLLVTTIPTQNHSLCKHCHSQLSHLDLL------------DHCKTCSYMIRPNAN-------  107 (200)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l------------~~C~~C~~~f~~~~~-------  107 (200)
                      ....+...|.....|..|+..   |.++++|.|+.|++.|.+...|            +.|+.|++.|.....       
T Consensus        23 ~C~~C~~~f~~~~~l~~H~~~---h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~   99 (190)
T 2i13_A           23 ACPECGKSFSRSDHLAEHQRT---HTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRT   99 (190)
T ss_dssp             --------CCSSHHHHHGGGC---C---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHH
T ss_pred             cCCCCccccCCHHHHHHHHHH---cCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHh
Confidence            445667788888888888877   8889999999999999988777            379999999976544       


Q ss_pred             --CCCCcccccChhhhccCHHHHHhchhhhhhhhhcCCCCCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccc
Q psy7453         108 --NTFSPFCIYCKAVLSTNLNELIEHCRTCKSMIRTDPFRHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRS  185 (200)
Q Consensus       108 --~~~~~~C~~C~~~f~~~~~~l~~H~~~~~~~~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f  185 (200)
                        ++++|.|++|++.|.+ ...|..|      + ++|.+++||.|+.|++.|.....|..|+++|+++++|.|++|++.|
T Consensus       100 h~~~~~~~C~~C~~~f~~-~~~l~~H------~-~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f  171 (190)
T 2i13_A          100 HTGEKPYACPECGKSFSQ-LAHLRAH------Q-RTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSF  171 (190)
T ss_dssp             HHTCCCEECTTTCCEESS-HHHHHHH------H-HHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEE
T ss_pred             cCCCCCCcCCCCCCccCC-HHHHHHH------H-HHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCcc
Confidence              7899999999999999 9999999      9 9999999999999999999999999999999999999999999999


Q ss_pred             cCHHHHHHHHhhhcC
Q psy7453         186 ASVAGLHYHLKKTYH  200 (200)
Q Consensus       186 ~~~~~L~~H~~~h~g  200 (200)
                      .+...|..|+++|+|
T Consensus       172 ~~~~~L~~H~~~H~~  186 (190)
T 2i13_A          172 SRRDALNVHQRTHTG  186 (190)
T ss_dssp             SSHHHHHHHHTTC--
T ss_pred             CCHHHHHHHHHhcCC
Confidence            999999999999986



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.7 bits (88), Expect = 3e-05
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 168 RTHTGEKPYACGQCAFRSASVAGLHYHLKKT 198
           RTH+GEKPY C  C  R      +  H+ + 
Sbjct: 1   RTHSGEKPYECYICHARFTQSGTMKMHILQK 31


>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.79
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.69
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.49
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.46
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.43
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.42
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.42
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.4
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.35
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.34
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.34
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.27
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.25
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.21
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.18
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.17
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.15
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.15
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.14
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.0
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.96
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.94
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.93
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.9
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.83
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.83
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.71
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.45
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.38
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.26
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.21
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.16
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.15
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.93
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.9
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.78
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.78
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.75
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.7
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.61
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.6
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.52
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.46
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.44
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.42
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.39
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.38
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.36
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.35
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.35
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.34
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.33
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.22
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.21
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.13
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.13
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.12
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.09
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.0
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.88
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.81
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.62
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.52
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.36
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.3
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.14
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.02
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.98
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.96
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.9
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.85
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.64
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.58
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.27
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.52
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.29
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.06
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.9
d1y0jb136 U-shaped transcription factor, different fingers { 93.07
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.98
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.2
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.58
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.18
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.12
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.7
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 90.63
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.38
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.36
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.07
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.78
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.36
d1y0jb136 U-shaped transcription factor, different fingers { 88.66
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.52
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 88.26
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.49
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.17
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.5
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 85.06
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.45
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.79  E-value=4.4e-20  Score=109.11  Aligned_cols=53  Identities=25%  Similarity=0.442  Sum_probs=50.1

Q ss_pred             CCceecCccCcccCChHHHHHHHHHcCCCCCcccccCcccccCHHHHHHHHhhh
Q psy7453         145 RHKFVCYACDYFSYNIGCMRSHIRTHTGEKPYACGQCAFRSASVAGLHYHLKKT  198 (200)
Q Consensus       145 ~k~~~C~~C~~~f~~~~~l~~H~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~h  198 (200)
                      ||||+|+ ||+.|.....|..|+++|+|++||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            6899995 9999999999999999999999999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure