Psyllid ID: psy7454


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MHMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEYKT
cccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHcccccccccccccHHHHccccHHHHHHHHccccccccccc
ccccEEcccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccEEEEcEEEccccccccccHccccEccccHHHHHHHHcccccccccccc
mhmprpnayryKYVCFACKFYtyntgnikrhlgmhlgekpftcnmcefkcrdnrtlkahhinihtgqkpypcrycdykarETQALKVHtkryhpkmydveykt
mhmprpnaYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHhinihtgqkpypCRYCDYKARETQALkvhtkryhpkmydveykt
MHMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEYKT
*******AYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKM*******
*HMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEY**
MHMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEYKT
***PRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEYKT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRYHPKMYDVEYKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
O13089 522 DNA-binding protein Ikaro N/A N/A 0.776 0.153 0.345 2e-10
Q9D0B1321 Zinc finger protein 524 O no N/A 0.805 0.258 0.357 2e-10
Q9Y330459 Zinc finger and BTB domai yes N/A 0.844 0.189 0.318 3e-10
Q2EI21 1501 RE1-silencing transcripti N/A N/A 0.825 0.056 0.302 3e-10
A2APF3 636 Transcriptional repressor no N/A 0.815 0.132 0.341 3e-10
Q6XDT4 562 Ikaros family zinc finger N/A N/A 0.728 0.133 0.355 4e-10
O42410 518 DNA-binding protein Ikaro yes N/A 0.776 0.154 0.345 4e-10
Q6DBW0 419 Zinc finger protein Pegas no N/A 0.815 0.200 0.364 5e-10
Q13422 519 DNA-binding protein Ikaro no N/A 0.776 0.154 0.345 5e-10
Q03267 517 DNA-binding protein Ikaro no N/A 0.825 0.164 0.336 6e-10
>sp|O13089|IKZF1_ONCMY DNA-binding protein Ikaros OS=Oncorhynchus mykiss GN=ikzf1 PE=2 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 13  YVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPC 72
           + C  C       GN+ RH+ +H GEKPF C++C + CR    L   H+  H+  KP+ C
Sbjct: 153 FQCTQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALSG-HLRTHSVGKPHKC 211

Query: 73  RYCDYKARETQALKVHTKRYH 93
            YC    ++  +L+ H +R H
Sbjct: 212 AYCGRSYKQRSSLEEHKERCH 232




Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Functions in the specification and the maturation of the T-lymphocyte. Also interacts with a critical control element in the TDT (terminal deoxynucleotidyltransferase) promoter as well as with the promoters for other genes expressed during early stages of B- and T-cell development.
Oncorhynchus mykiss (taxid: 8022)
>sp|Q9D0B1|ZN524_MOUSE Zinc finger protein 524 OS=Mus musculus GN=Znf524 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y330|ZBT12_HUMAN Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens GN=ZBTB12 PE=1 SV=1 Back     alignment and function description
>sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 Back     alignment and function description
>sp|A2APF3|CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus GN=Ctcfl PE=1 SV=1 Back     alignment and function description
>sp|Q6XDT4|IKZF_OIKDI Ikaros family zinc finger protein OS=Oikopleura dioica PE=2 SV=1 Back     alignment and function description
>sp|O42410|IKZF1_CHICK DNA-binding protein Ikaros OS=Gallus gallus GN=IKZF1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DBW0|IKZF5_DANRE Zinc finger protein Pegasus OS=Danio rerio GN=ikzf5 PE=2 SV=1 Back     alignment and function description
>sp|Q13422|IKZF1_HUMAN DNA-binding protein Ikaros OS=Homo sapiens GN=IKZF1 PE=1 SV=1 Back     alignment and function description
>sp|Q03267|IKZF1_MOUSE DNA-binding protein Ikaros OS=Mus musculus GN=Ikzf1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
432912303 905 PREDICTED: uncharacterized protein LOC10 0.902 0.102 0.329 2e-12
427782147 974 Putative gonadotropin inducible transcri 0.805 0.085 0.380 2e-12
72028083 939 PREDICTED: uncharacterized protein LOC59 0.834 0.091 0.356 5e-12
18539217 939 enhancer binding protein [Paracentrotus 0.834 0.091 0.356 5e-12
427780001 824 Putative gonadotropin inducible transcri 0.805 0.100 0.380 1e-11
90077898 327 unnamed protein product [Macaca fascicul 0.776 0.244 0.407 1e-11
260819951 463 hypothetical protein BRAFLDRAFT_89065 [B 0.582 0.129 0.402 3e-11
326678104 1219 PREDICTED: zinc finger protein 729 [Dani 0.757 0.063 0.417 3e-11
313229585 445 unnamed protein product [Oikopleura dioi 0.728 0.168 0.394 4e-11
322802269 711 hypothetical protein SINV_04694 [Solenop 0.786 0.113 0.402 5e-11
>gi|432912303|ref|XP_004078864.1| PREDICTED: uncharacterized protein LOC101163766 [Oryzias latipes] Back     alignment and taxonomy information
 Score = 76.6 bits (187), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 4   PRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINI 63
           P    +R +++C  C     +  N++ H+ +H GE+PF+C+ C  K   +  LK+H  N+
Sbjct: 802 PGAGLHRKRFICSMCNKTYASAQNLEVHMRIHTGERPFSCSQCGKKFTQSAHLKSHQ-NV 860

Query: 64  HTGQKPYPCRYCDYKARETQALKVHTKRYHPKMY 97
           HTG++PY C+ C        +LK+H K+ HP  +
Sbjct: 861 HTGERPYTCKLCSKSFMIKYSLKLHAKKSHPSSW 894




Source: Oryzias latipes

Species: Oryzias latipes

Genus: Oryzias

Family: Adrianichthyidae

Order: Beloniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|427782147|gb|JAA56525.1| Putative gonadotropin inducible transcription factor [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|72028083|ref|XP_797592.1| PREDICTED: uncharacterized protein LOC593001 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|18539217|emb|CAD22532.1| enhancer binding protein [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|427780001|gb|JAA55452.1| Putative gonadotropin inducible transcription factor [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|90077898|dbj|BAE88629.1| unnamed protein product [Macaca fascicularis] Back     alignment and taxonomy information
>gi|260819951|ref|XP_002605299.1| hypothetical protein BRAFLDRAFT_89065 [Branchiostoma floridae] gi|229290631|gb|EEN61309.1| hypothetical protein BRAFLDRAFT_89065 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|326678104|ref|XP_003200983.1| PREDICTED: zinc finger protein 729 [Danio rerio] Back     alignment and taxonomy information
>gi|313229585|emb|CBY18400.1| unnamed protein product [Oikopleura dioica] Back     alignment and taxonomy information
>gi|322802269|gb|EFZ22665.1| hypothetical protein SINV_04694 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
ZFIN|ZDB-GENE-070705-205 473 si:ch73-138e16.6 "si:ch73-138e 0.776 0.169 0.426 1.3e-15
ZFIN|ZDB-GENE-050306-3309 zgc:113407 "zgc:113407" [Danio 0.864 0.288 0.402 1.1e-14
ZFIN|ZDB-GENE-081031-35242 si:ch73-92e7.6 "si:ch73-92e7.6 0.757 0.322 0.414 1.4e-14
UNIPROTKB|F1NUB6186 ZNF513 "Uncharacterized protei 0.747 0.413 0.397 7.9e-14
ZFIN|ZDB-GENE-070112-222274 zgc:158517 "zgc:158517" [Danio 0.747 0.281 0.4 1e-13
ZFIN|ZDB-GENE-060512-206320 zgc:136308 "zgc:136308" [Danio 0.805 0.259 0.402 1.4e-13
ZFIN|ZDB-GENE-050913-91309 zgc:113886 "zgc:113886" [Danio 0.766 0.255 0.421 2.7e-13
ZFIN|ZDB-GENE-080219-18394 zgc:174268 "zgc:174268" [Danio 0.776 0.203 0.414 2.8e-13
ZFIN|ZDB-GENE-050913-148315 zgc:113377 "zgc:113377" [Danio 0.776 0.253 0.353 4.9e-13
MGI|MGI:3652571 636 Ctcfl "CCCTC-binding factor (z 0.883 0.143 0.326 5.7e-13
ZFIN|ZDB-GENE-070705-205 si:ch73-138e16.6 "si:ch73-138e16.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 1.3e-15, P = 1.3e-15
 Identities = 35/82 (42%), Positives = 53/82 (64%)

Query:    12 KYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYP 71
             +++CFAC       G++KRHL +H GEKP+ C+ CE +     ++KAH   IHTG+KPY 
Sbjct:   154 EFMCFACDKAFLTAGHLKRHLMIHTGEKPYKCSHCEMRFTRTESMKAHE-RIHTGEKPYK 212

Query:    72 CRYCDYKARETQALKVHTKRYH 93
             C +CD     +++LK+H +R H
Sbjct:   213 CSHCDMGFSRSESLKMH-ERIH 233


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-050306-3 zgc:113407 "zgc:113407" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081031-35 si:ch73-92e7.6 "si:ch73-92e7.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NUB6 ZNF513 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-222 zgc:158517 "zgc:158517" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060512-206 zgc:136308 "zgc:136308" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-91 zgc:113886 "zgc:113886" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-18 zgc:174268 "zgc:174268" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-148 zgc:113377 "zgc:113377" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:3652571 Ctcfl "CCCTC-binding factor (zinc finger protein)-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.002
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 35.5 bits (81), Expect = 0.002
 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 20/78 (25%)

Query: 36  LGEKPFTCNM--CEFKCRDNRTLKAHHINIHTGQ------------------KPYPCRYC 75
              KP+ C +  C  K ++   LK H ++ H  Q                  KPY C  C
Sbjct: 345 KDGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVC 404

Query: 76  DYKARETQALKVHTKRYH 93
           D + +    LK H K  H
Sbjct: 405 DKRYKNLNGLKYHRKHSH 422


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG2462|consensus279 99.89
KOG2462|consensus279 99.89
KOG3623|consensus1007 99.75
KOG3576|consensus267 99.72
KOG1074|consensus958 99.68
KOG1074|consensus 958 99.62
KOG3576|consensus267 99.62
KOG3623|consensus 1007 99.58
PHA00733128 hypothetical protein 99.4
KOG3608|consensus 467 99.4
PHA0276855 hypothetical protein; Provisional 99.23
KOG3608|consensus467 99.18
PHA0276855 hypothetical protein; Provisional 99.13
PLN03086567 PRLI-interacting factor K; Provisional 99.02
PHA00733128 hypothetical protein 99.02
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.97
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.86
PHA0061644 hypothetical protein 98.86
PLN03086567 PRLI-interacting factor K; Provisional 98.84
KOG3993|consensus 500 98.83
PHA0061644 hypothetical protein 98.79
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.53
PHA0073279 hypothetical protein 98.44
PHA0073279 hypothetical protein 98.41
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.38
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.37
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.19
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.13
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.09
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.07
COG5189423 SFP1 Putative transcriptional repressor regulating 97.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.98
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.96
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.88
KOG3993|consensus500 97.86
COG5189423 SFP1 Putative transcriptional repressor regulating 97.78
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.77
smart0035526 ZnF_C2H2 zinc finger. 97.62
PRK04860160 hypothetical protein; Provisional 97.6
smart0035526 ZnF_C2H2 zinc finger. 97.53
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.48
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.34
PRK04860160 hypothetical protein; Provisional 97.3
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.3
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.8
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.56
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.17
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 96.0
COG404965 Uncharacterized protein containing archaeal-type C 95.83
COG404965 Uncharacterized protein containing archaeal-type C 95.6
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.4
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.34
KOG1146|consensus 1406 95.16
COG5048 467 FOG: Zn-finger [General function prediction only] 94.88
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 94.68
COG5048467 FOG: Zn-finger [General function prediction only] 94.67
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.5
PF1371937 zinc_ribbon_5: zinc-ribbon domain 94.11
KOG2186|consensus 276 94.09
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 94.0
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 93.63
KOG2231|consensus 669 93.47
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 93.44
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.21
PF1371736 zinc_ribbon_4: zinc-ribbon domain 93.12
KOG2186|consensus 276 92.79
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.41
COG1592166 Rubrerythrin [Energy production and conversion] 92.1
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 92.06
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 92.01
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 91.93
KOG2893|consensus 341 91.7
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.24
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 90.76
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 90.61
PRK06266178 transcription initiation factor E subunit alpha; V 90.42
smart00531147 TFIIE Transcription initiation factor IIE. 90.38
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 89.75
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 89.71
PF05443132 ROS_MUCR: ROS/MUCR transcriptional regulator prote 89.36
PHA0062659 hypothetical protein 89.17
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.9
COG5236 493 Uncharacterized conserved protein, contains RING Z 88.53
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 87.89
PF0879028 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IP 87.31
COG4530129 Uncharacterized protein conserved in bacteria [Fun 86.76
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 86.27
PF14353128 CpXC: CpXC protein 86.07
PRK00464154 nrdR transcriptional regulator NrdR; Validated 85.9
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 85.61
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 85.15
KOG2593|consensus 436 84.59
KOG4173|consensus253 83.66
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 83.43
COG4957148 Predicted transcriptional regulator [Transcription 83.33
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 82.62
KOG2893|consensus 341 82.58
KOG4173|consensus 253 82.34
PF1387841 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO 81.94
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 81.83
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 81.8
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 80.49
KOG1280|consensus 381 80.41
KOG4167|consensus907 80.3
PF1345149 zf-trcl: Probable zinc-binding domain 80.13
>KOG2462|consensus Back     alignment and domain information
Probab=99.89  E-value=9.1e-24  Score=123.63  Aligned_cols=87  Identities=23%  Similarity=0.456  Sum_probs=69.1

Q ss_pred             CCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHH
Q psy7454          10 RYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHT   89 (103)
Q Consensus        10 ~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~   89 (103)
                      ++.+.|+.||+.|.....|..|+++|+  -+.+|.+||+.|..+=.|+.| +++|+|||||.|..|++.|..+++|..|+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH-iRTHTGEKPF~C~hC~kAFADRSNLRAHm  235 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH-IRTHTGEKPFSCPHCGKAFADRSNLRAHM  235 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc-cccccCCCCccCCcccchhcchHHHHHHH
Confidence            456777777777777777777777775  567788888888887778887 78888888888888888888888888888


Q ss_pred             HhhCCCCCcc
Q psy7454          90 KRYHPKMYDV   99 (103)
Q Consensus        90 ~~~~~~~~~~   99 (103)
                      ++|.+.++|.
T Consensus       236 QTHS~~K~~q  245 (279)
T KOG2462|consen  236 QTHSDVKKHQ  245 (279)
T ss_pred             HhhcCCcccc
Confidence            8888888774



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF05443 ROS_MUCR: ROS/MUCR transcriptional regulator protein; InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF08790 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>KOG2593|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>COG4957 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>KOG1280|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF13451 zf-trcl: Probable zinc-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-08
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-08
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 9e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 9e-07
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-05
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 6e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 7e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-05
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-04
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure

Iteration: 1

Score = 52.0 bits (123), Expect = 8e-08, Method: Compositional matrix adjust. Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Query: 17 ACKFYTYNTGNIKRHLGMHLGEKPFTCNMC--EFKCRDNRTLKAHHINIHTGQKPYPCRY 74 +C ++ N+ RH+ +H G+KPF C +C F D+ T HI HTG+KP+ C Sbjct: 11 SCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTT---HIRTHTGEKPFACDI 67 Query: 75 CDYKARETQALKVHTK 90 C K + K HTK Sbjct: 68 CGRKFARSDERKRHTK 83
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-07
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 4e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
 Score = 54.7 bits (132), Expect = 9e-12
 Identities = 15/65 (23%), Positives = 25/65 (38%), Gaps = 4/65 (6%)

Query: 35 HLGEKPFTCNMCEFKCRDNRTLKAHHINIHT---GQKPYPCRYCDYKARETQALKVHTKR 91
            G     C +C F CR   +L  H    H        +PC +C  +  +  ++  H  +
Sbjct: 2  SSGSSGLQCEICGFTCRQKASLNWHQ-RKHAETVAALRFPCEFCGKRFEKPDSVAAHRSK 60

Query: 92 YHPKM 96
           HP +
Sbjct: 61 SHPAL 65


>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.97
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.93
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.93
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.93
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.92
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.92
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.91
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.87
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.87
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.86
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.84
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.83
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.83
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.83
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.81
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.8
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.79
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.79
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.79
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.77
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.77
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.77
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.77
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.76
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.76
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.76
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.75
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.75
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.74
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.74
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.73
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.73
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.72
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.72
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.71
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.71
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.7
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.7
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.69
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.69
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.68
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.68
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.67
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.67
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.67
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.65
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.64
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.64
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.64
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.64
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.63
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.63
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.62
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.62
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.61
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.61
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.61
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.61
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.61
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.61
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.61
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.61
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.61
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.61
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.61
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.61
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.6
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.6
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.6
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.6
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.6
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.6
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.6
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.6
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.6
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.6
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.6
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.59
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.59
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.59
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.58
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.58
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.57
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.57
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.56
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.56
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.56
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.56
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.55
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.54
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.54
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.53
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.53
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.53
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.53
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.52
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.52
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.52
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.52
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.52
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.52
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.51
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.51
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.51
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.51
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.51
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.51
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.51
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.51
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.5
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.5
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.5
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.5
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.5
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.5
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.5
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.49
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.49
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.49
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.49
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.49
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.49
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.49
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.49
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.48
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.48
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.48
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.48
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.47
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.47
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.47
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.47
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.46
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.46
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.46
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.44
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.44
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.43
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.42
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.42
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.4
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.4
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.39
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.38
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.37
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.37
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.37
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.34
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.34
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.33
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.33
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.32
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.32
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.32
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.29
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.29
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.29
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.28
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.28
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.26
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.25
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.25
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.23
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.23
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.22
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.21
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.21
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 99.19
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.17
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.17
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.16
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.13
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.13
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.13
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 99.12
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.11
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.07
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.07
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.05
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.03
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.02
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 99.01
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.99
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.99
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.98
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.93
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.91
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.9
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.89
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.88
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.87
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.84
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.84
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.84
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.84
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.83
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.82
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.79
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.79
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.78
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.78
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.78
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.78
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.77
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.76
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.75
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.73
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.72
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.71
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.17
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.7
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.69
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.68
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.68
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.67
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.67
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.67
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.66
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.65
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.64
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.63
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.59
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.01
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.97
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.95
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.48
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.83
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.38
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.88
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.66
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.61
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.52
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.82
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.77
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.71
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.7
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.38
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.82
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 95.61
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.22
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.12
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 94.94
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 94.77
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.42
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 93.4
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 92.07
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.07
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 90.24
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 89.49
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 89.26
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 88.14
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 87.26
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 87.13
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 87.12
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 86.53
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 85.83
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 85.83
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 85.32
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 84.86
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 83.73
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 83.0
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 82.26
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.43
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 81.3
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=145.59  Aligned_cols=98  Identities=26%  Similarity=0.386  Sum_probs=92.8

Q ss_pred             CCCCCCCCCCceeeCCCCCcccCchhHHHHHhhcCCCCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccC
Q psy7454           2 HMPRPNAYRYKYVCFACKFYTYNTGNIKRHLGMHLGEKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARE   81 (103)
Q Consensus         2 ~~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~   81 (103)
                      |+.++|+|+++|.|++|++.|.....|..|+++|.++++|.|+.|++.|...+.|..| ++.|.+++||.|..||+.|..
T Consensus        12 h~~~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H-~~~H~~~k~~~C~~C~k~F~~   90 (133)
T 2lt7_A           12 HYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH-EIHHTGERRYQCLACGKSFIN   90 (133)
T ss_dssp             EEEEEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHH-HHHHHTCCCEEESSSCCEESS
T ss_pred             hceeecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhh-ccccCCCccccCCCCCCCcCC
Confidence            4567889999999999999999999999999999999999999999999999999998 899999999999999999999


Q ss_pred             cHHHHHHHHhhCCCCCccc
Q psy7454          82 TQALKVHTKRYHPKMYDVE  100 (103)
Q Consensus        82 ~~~l~~H~~~~~~~~~~~~  100 (103)
                      .+.|..|++++++++|+..
T Consensus        91 ~~~L~~H~~~hh~~~p~~~  109 (133)
T 2lt7_A           91 YQFMSSHIKSVHSQDPSGD  109 (133)
T ss_dssp             HHHHHHHHHHHTCCCTTSS
T ss_pred             HHHHHHHhHHhcCCCCCCC
Confidence            9999999999999887643



>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.6 bits (93), Expect = 1e-06
 Identities = 10/35 (28%), Positives = 15/35 (42%)

Query: 38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPC 72
           KP+ C  C         L  H   +HT ++P+ C
Sbjct: 3  GKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKC 37


>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.8
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.79
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.59
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.57
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.55
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.53
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.51
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.51
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.49
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.46
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.42
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.4
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.4
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.4
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.4
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.37
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.33
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.31
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.29
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.28
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.24
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.23
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.22
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.19
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.17
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.16
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.14
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.07
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.05
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.0
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.99
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.87
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.87
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.74
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.74
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.73
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.58
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.56
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.55
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.51
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.48
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.44
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.43
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.31
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.29
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.16
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.11
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.08
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.08
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.04
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.03
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.97
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.94
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.92
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.91
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.91
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.9
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.89
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.83
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.82
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.77
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.7
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.67
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.55
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.55
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.53
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.49
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.42
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.42
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.41
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.33
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.31
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.2
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.15
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.09
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.97
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.9
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.87
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.79
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.74
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.7
d1y0jb136 U-shaped transcription factor, different fingers { 96.52
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 96.48
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.41
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.4
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.38
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.38
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.27
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.15
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.92
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.9
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.74
d1y0jb136 U-shaped transcription factor, different fingers { 95.69
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.55
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.52
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 95.48
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 95.28
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 95.22
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.14
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 94.56
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.53
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.5
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.47
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 93.39
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 93.3
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 93.18
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 92.73
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 92.58
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 92.17
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 92.09
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.43
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 91.35
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 90.36
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.81
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.2
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 87.08
d1fu9a_36 U-shaped transcription factor, different fingers { 86.56
d1wira_121 Protein arginine N-methyltransferase 3 {Mouse (Mus 83.42
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 82.51
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 80.38
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=8.1e-20  Score=83.15  Aligned_cols=53  Identities=26%  Similarity=0.556  Sum_probs=28.8

Q ss_pred             CCCeecCCCCccccCchHHHHHHHHhcCCCCCeeCCCCCccccCcHHHHHHHHhh
Q psy7454          38 EKPFTCNMCEFKCRDNRTLKAHHINIHTGQKPYPCRYCDYKARETQALKVHTKRY   92 (103)
Q Consensus        38 ~~~~~c~~C~~~~~~~~~l~~h~~~~h~~~~~~~c~~C~~~f~~~~~l~~H~~~~   92 (103)
                      |+||.|. ||+.|.....|..| +++|++++||.|.+||+.|...+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H-~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRH-MSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHH-HHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHH-hhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            3455552 55555555555555 45555555555555555555555555555443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure