Psyllid ID: psy7563

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MPSSILSSGIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEIEDRRRTGEEKASHSENKPYLFTINFATAGIESAI
cEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEEccccccccEEEEEEEccccccccEEEEEcccccEEEEEEEcccccccccEEEEEEEEcccccccEEEEcccEEEEEccccccccccEEEEEEEEEccccccEEEEEEEEEEEEEcccccEEccccEEEEEEcccccccEEEEEEEEEcccccccEEEEEEEcccccccEEEEcccEEEEEccccccccEEEccEEEEEEEEEccccccEEEcccccccEEEccccEEEEEcccc
cEEEEEccccccccEEEEEEEEEccccccccccccEEEEEccccccccEEEEccccccccEEcccccccccEEEEEEEEcccccccccccEEEEEEEccccccEEEEEccccEEEEEcccccccccEEEEEEEEEccccccccEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEEccccccccEEEEEEEccccccEEEEEccccEEEEEcccccHHHHHcccEEEEEEEEccccccEEEEccccccEEEccEEEEEEccccc
mpssilssgiqpcstevsVNVKvidksmpvfdkqfysvsvrediqihsplpltiraesplnRKLIYSitggnsreqFAVDFNTGLYSLNRKLIYsitggnsreqfavdfntgsitvvdeldFETVQEYTLTvratdsvsghsaEVFVSVRVtdvndcppefpqdwynvsiseaapfGTLILKVRaldndsgkqkisSTAQIAHSFLEIFFLSLHRYMFTigkgffperellqprcyrseiEDRRrtgeekashsenkpylfTINFATAGIESAI
mpssilssgiqpcstEVSVNVKVIDKSMPVFDKQFYSVSVrediqihsplpltiraesplNRKLIYSitggnsreqFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTvratdsvsghSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGffperellqprcyRSEIEdrrrtgeekashsenkpylftiNFATAGIESAI
MPSSILSSGIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEIEDRRRTGEEKASHSENKPYLFTINFATAGIESAI
*************STEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDND****KISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCY**********************YLFTINFATA******
MPSSILSSGIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEIEDRRRTGEEKASHSENKPYLFTINFATAGIESAI
***********PCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDN*********TAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEI**************ENKPYLFTINFATAGIESAI
MPSSILSSGIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEIEDRRRTGEEKASHSENKPYLFTINFATAGI*S**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSSILSSGIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPRCYRSEIEDRRRTGEEKASHSENKPYLFTINFATAGIESAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query274 2.2.26 [Sep-21-2011]
Q9VW71 4705 Fat-like cadherin-related yes N/A 0.558 0.032 0.475 1e-41
Q14517 4588 Protocadherin Fat 1 OS=Ho yes N/A 0.540 0.032 0.435 7e-31
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.576 0.034 0.374 1e-27
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.558 0.033 0.373 2e-27
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.558 0.033 0.384 2e-26
O88277 4351 Protocadherin Fat 2 OS=Ra no N/A 0.576 0.036 0.358 9e-23
Q5F226 4351 Protocadherin Fat 2 OS=Mu no N/A 0.576 0.036 0.352 3e-22
Q9NYQ8 4349 Protocadherin Fat 2 OS=Ho no N/A 0.572 0.036 0.349 3e-19
Q9HCU4 2923 Cadherin EGF LAG seven-pa no N/A 0.645 0.060 0.324 6e-17
Q9R0M0 2920 Cadherin EGF LAG seven-pa no N/A 0.627 0.058 0.319 6e-17
>sp|Q9VW71|FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster GN=kug PE=2 SV=2 Back     alignment and function desciption
 Score =  170 bits (430), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 118/183 (64%), Gaps = 30/183 (16%)

Query: 9    GIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSI 68
             I PCS+E  + VKVID+SMPVF+KQFY+VSV+ED++++S L ++I AESPL R LIY+I
Sbjct: 2216 AITPCSSEAPLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTI 2275

Query: 69   TGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEY 128
            +                              +  + F +D+NTGSI VV+ELD+E +  +
Sbjct: 2276 S------------------------------SESQSFEIDYNTGSIFVVNELDYEKISSH 2305

Query: 129  TLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDN 188
             +++RATDS+SG  AEV +SV + DVNDC PE   D YN++I E A FGT ILK+ A DN
Sbjct: 2306 DVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDN 2365

Query: 189  DSG 191
            DSG
Sbjct: 2366 DSG 2368
Required for the planar polarity of actin filament orientation at the basal side of ovarian follicle cells. Required for proper egg chamber shape; elongation of the egg chamber during oogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q14517|FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|O88277|FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus GN=Fat2 PE=1 SV=1 Back     alignment and function description
>sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus GN=Fat2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NYQ8|FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens GN=FAT2 PE=1 SV=2 Back     alignment and function description
>sp|Q9HCU4|CELR2_HUMAN Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R0M0|CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus GN=Celsr2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query274
307179930 3508 Putative fat-like cadherin-related tumor 0.565 0.044 0.617 1e-53
383855810 4739 PREDICTED: fat-like cadherin-related tum 0.565 0.032 0.617 2e-53
350417212 4739 PREDICTED: fat-like cadherin-related tum 0.562 0.032 0.615 7e-53
328790298 3599 PREDICTED: fat-like cadherin-related tum 0.562 0.042 0.615 7e-53
345497484 4817 PREDICTED: fat-like cadherin-related tum 0.565 0.032 0.612 8e-53
340715254 3597 PREDICTED: fat-like cadherin-related tum 0.562 0.042 0.615 8e-53
380020280 4753 PREDICTED: LOW QUALITY PROTEIN: fat-like 0.562 0.032 0.609 1e-52
332019420 3467 Putative fat-like cadherin-related tumor 0.565 0.044 0.601 4e-52
307210681 3435 Putative fat-like cadherin-related tumor 0.598 0.047 0.585 5e-52
328703039 4140 PREDICTED: fat-like cadherin-related tum 0.580 0.038 0.588 6e-52
>gi|307179930|gb|EFN68065.1| Putative fat-like cadherin-related tumor suppressor-like protein [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/183 (61%), Positives = 130/183 (71%), Gaps = 28/183 (15%)

Query: 9    GIQPCSTEVSVNVKVIDKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSI 68
            GI PCS EV VNVKVID+SMPVFDKQFY+ SV E I++HSPL L+I+AESPLNRK     
Sbjct: 983  GITPCSIEVPVNVKVIDRSMPVFDKQFYTDSVLESIEVHSPLALSIQAESPLNRK----- 1037

Query: 69   TGGNSREQFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEY 128
                                   LIYSIT GN  E+FA+DFNTG I VVDELD+E  ++Y
Sbjct: 1038 -----------------------LIYSITKGNDFEEFALDFNTGVIYVVDELDYEQKKQY 1074

Query: 129  TLTVRATDSVSGHSAEVFVSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDN 188
             LTVRATDSVSG  AEV VS+ V DVNDCPPEF QD YN+SISEAAPFGT +L+V + DN
Sbjct: 1075 ELTVRATDSVSGVYAEVLVSILVLDVNDCPPEFTQDSYNISISEAAPFGTSVLRVSSRDN 1134

Query: 189  DSG 191
            D+G
Sbjct: 1135 DTG 1137

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383855810|ref|XP_003703403.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417212|ref|XP_003491311.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|328790298|ref|XP_394631.4| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|345497484|ref|XP_001600457.2| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340715254|ref|XP_003396132.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|380020280|ref|XP_003694018.1| PREDICTED: LOW QUALITY PROTEIN: fat-like cadherin-related tumor suppressor homolog [Apis florea] Back     alignment and taxonomy information
>gi|332019420|gb|EGI59904.1| Putative fat-like cadherin-related tumor suppressor-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307210681|gb|EFN87104.1| Putative fat-like cadherin-related tumor suppressor-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328703039|ref|XP_003242076.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 1 [Acyrthosiphon pisum] gi|328703043|ref|XP_003242078.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query274
ZFIN|ZDB-GENE-050425-1 4611 fat1 "FAT tumor suppressor hom 0.383 0.022 0.514 1.8e-26
UNIPROTKB|F1LP84 4586 Fat1 "Protein Fat1" [Rattus no 0.364 0.021 0.52 4.7e-26
RGD|621254 4589 Fat1 "FAT tumor suppressor hom 0.364 0.021 0.52 4.7e-26
UNIPROTKB|G3V9W9 4589 Fat1 "RCG59113" [Rattus norveg 0.364 0.021 0.52 4.7e-26
UNIPROTKB|F1LR23 4589 Fat1 "Protein Fat1" [Rattus no 0.364 0.021 0.52 4.7e-26
UNIPROTKB|F1NXZ3 4029 FAT3 "Uncharacterized protein" 0.514 0.034 0.379 1.7e-17
FB|FBgn0261574 4705 kug "kugelei" [Drosophila mela 0.536 0.031 0.437 4.3e-25
UNIPROTKB|F1NXZ5 4557 FAT3 "Uncharacterized protein" 0.514 0.030 0.379 1.9e-17
UNIPROTKB|F1SER9 4587 FAT1 "Uncharacterized protein" 0.364 0.021 0.51 5.2e-25
UNIPROTKB|E2R353 4591 FAT1 "Uncharacterized protein" 0.364 0.021 0.51 8.5e-25
ZFIN|ZDB-GENE-050425-1 fat1 "FAT tumor suppressor homolog 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 270 (100.1 bits), Expect = 1.8e-26, Sum P(2) = 1.8e-26
 Identities = 54/105 (51%), Positives = 72/105 (68%)

Query:    91 KLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVFVSVR 150
             +++Y+IT G+   QF ++FNTG I VV  LDFET   Y L+VRATDS++G  AEVFV + 
Sbjct:  2211 RIVYTITEGDPLNQFTINFNTGVIQVVKTLDFETHPAYKLSVRATDSLTGAKAEVFVDII 2270

Query:   151 VTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKI 195
             + DVND PP F    YN S+SEA+  GT +L+V A D D+G  K+
Sbjct:  2271 LEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKV 2315
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0007155 "cell adhesion" evidence=IEA
GO:0016020 "membrane" evidence=IEA;ISS
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|F1LP84 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|621254 Fat1 "FAT tumor suppressor homolog 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9W9 Fat1 "RCG59113" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR23 Fat1 "Protein Fat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXZ3 FAT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0261574 kug "kugelei" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXZ5 FAT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SER9 FAT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query274
smart0011281 smart00112, CA, Cadherin repeats 2e-20
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 4e-19
pfam0002892 pfam00028, Cadherin, Cadherin domain 7e-12
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 0.002
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information 
 Score = 82.8 bits (205), Expect = 2e-20
 Identities = 36/83 (43%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 78  AVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDS 137
           A D ++G    N K+ YSI  GN    F++D  TG IT    LD E   EYTLTV ATD 
Sbjct: 2   ATDADSGE---NGKVTYSILSGNDDGLFSIDPETGEITTTKPLDREEQPEYTLTVEATDG 58

Query: 138 VS-GHSAEVFVSVRVTDVNDCPP 159
                S+   V++ V DVND  P
Sbjct: 59  GGPPLSSTATVTITVLDVNDNAP 81

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium. Length = 81
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 274
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 100.0
KOG1219|consensus 4289 100.0
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.97
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.8
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.73
KOG1834|consensus 952 99.64
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.61
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.56
KOG1834|consensus 952 98.95
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 98.64
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.37
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.18
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 96.74
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 96.66
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.09
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 96.04
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 93.52
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 90.13
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 87.61
>KOG4289|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.3e-39  Score=309.00  Aligned_cols=217  Identities=23%  Similarity=0.334  Sum_probs=202.2

Q ss_pred             CeEEEEECCCCCceEEEEEEEEec--cCCCCeeeCCceEEEEeCCCCCCCeEEEEEEEeCCC---CCeEEEEEecCCCCC
Q psy7563           1 MPSSILSSGIQPCSTEVSVNVKVI--DKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPL---NRKLIYSITGGNSRE   75 (274)
Q Consensus         1 l~v~A~D~g~~~~~~~~~v~I~v~--Ndn~P~F~~~~y~~~v~E~~~~g~~v~~~v~a~D~d---~~~i~y~i~~~~~~~   75 (274)
                      |+|+|.|.|.|+++++.+|+|.|.  |||.|+|.+.+|..+++||.++|..| ++|.|+|.|   |+.|+|++.+|++..
T Consensus       237 lrVtA~d~~~P~~SAtttv~V~V~D~nDhsPvFEq~~Y~e~lREn~evGy~v-LtvrAtD~Dsp~Nani~Yrl~eg~~~~  315 (2531)
T KOG4289|consen  237 LRVTAQDHGDPRRSATTTVTVLVLDTNDHSPVFEQDEYREELRENLEVGYEV-LTVRATDGDSPPNANIRYRLLEGNAKN  315 (2531)
T ss_pred             EEEEeeecCCCcccceeEEEEEEeecCCCCcccchhHHHHHHhhccccCceE-EEEEeccCCCCCCCceEEEecCCCccc
Confidence            589999999999988888777775  99999999999999999999999999 999999999   999999999999889


Q ss_pred             cEEEeCCCceEEeceeeEEEeecCCCccceEEeCceeEEEECCCCCcCcccEEEEEEEEEeCCCC-ceEEEEEEEEEEec
Q psy7563          76 QFAVDFNTGLYSLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSG-HSAEVFVSVRVTDV  154 (274)
Q Consensus        76 ~F~i~~~tg~v~~~~~~~~~~~~~~~~~~f~i~~~tg~l~~~~~lD~E~~~~~~l~v~a~d~~~~-~~~~~~v~I~v~dv  154 (274)
                      .|.|++.+|                            .|.+..+||||+...|.|.|.|+|.|.+ ...++.|.|+|.|+
T Consensus       316 ~f~in~rSG----------------------------vI~T~a~lDRE~~~~y~L~VeAsDqG~~pgp~Ta~V~itV~D~  367 (2531)
T KOG4289|consen  316 VFEINPRSG----------------------------VISTRAPLDREELESYQLDVEASDQGRPPGPRTAMVEITVEDE  367 (2531)
T ss_pred             eeEEcCccc----------------------------eeeccCccCHHhhhheEEEEEeccCCCCCCCceEEEEEEEEec
Confidence            999999999                            9999999999999999999999999853 55599999999999


Q ss_pred             CCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCCCCCceEEEEEecCCCCcceEEeccceEEEEeccCCCCcccCCCc
Q psy7563         155 NDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPERELLQPR  234 (274)
Q Consensus       155 Ndn~P~f~~~~~~~~v~E~~~~g~~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~~F~i~~~~g~~~i~~~~~ld~e~~~~~  234 (274)
                      |||+|+|..+.|.+.|.|+..+++.|++|+|+|.|.|.|+.++|+|++++..+.|.|+..+|.+.+..  .||.|.   .
T Consensus       368 NDNaPqFse~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~G~f~id~~tGel~vv~--plD~e~---~  442 (2531)
T KOG4289|consen  368 NDNAPQFSEKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASGNGRGQFYIDSLTGELDVVE--PLDFEN---S  442 (2531)
T ss_pred             CCCCccccccceEEEecccCCCCceEEEEEecccCCCcCceEEEEeeccCccccEEEecccceEEEec--cccccC---C
Confidence            99999999999999999999999999999999999999999999999999999999999999999988  677775   2


Q ss_pred             EEEEEEEEeCCCCCcee
Q psy7563         235 CYRSEIEDRRRTGEEKA  251 (274)
Q Consensus       235 ~y~~~v~a~d~~g~~~~  251 (274)
                      .|.+.|+|.|+.-.+..
T Consensus       443 ~ytl~IrAqDggrPpLs  459 (2531)
T KOG4289|consen  443 EYTLRIRAQDGGRPPLS  459 (2531)
T ss_pred             eeEEEEEcccCCCCCcc
Confidence            69999999997555444

>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query274
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 3e-12
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 3e-10
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 6e-10
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 2e-09
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 2e-09
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 2e-09
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 2e-09
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 2e-09
1q1p_A212 E-Cadherin Activation Length = 212 2e-09
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 2e-09
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 3e-09
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 3e-09
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 3e-09
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 3e-09
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 6e-09
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 8e-09
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 9e-09
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 1e-08
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 1e-08
2o72_A213 Crystal Structure Analysis Of Human E-Cadherin (1-2 3e-08
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 4e-08
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 5e-08
1suh_A146 Amino-Terminal Domain Of Epithelial Cadherin In The 7e-08
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 3e-07
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 3e-07
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 9e-07
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 1e-06
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 1e-06
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 1e-06
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 3e-06
1l3w_A 546 C-Cadherin Ectodomain Length = 546 2e-06
1l3w_A 546 C-Cadherin Ectodomain Length = 546 4e-06
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 5e-05
3ubf_A316 Crystal Structure Of Drosophila N-Cadherin Ec1-3, I 2e-04
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 65/108 (60%), Gaps = 5/108 (4%)
Query: 89  NRKLIYSITG-GNSREQFAVDFNTGSITVVDELDFETVQE---YTLTVRATDSVSGHSAE 144
           +R++ Y++   G     F +   +G + +  ELDFE +++   Y+L V AT+   G S  
Sbjct: 248 DREIRYTLKAQGQGAGTFNIGPTSGIVKLAKELDFEDLRQPHVYSLIVTATEDSGGFSTS 307
Query: 145 VFVSVRVTDVNDCPPEFP-QDWYNVSISEAAPFGTLILKVRALDNDSG 191
           V +++RVTDVND  P+F   D+   ++ E  P GT IL+V+A+D+DSG
Sbjct: 308 VDLTIRVTDVNDNAPKFELPDYQAHNVDEDIPLGTSILRVKAMDSDSG 355
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 Back     alignment and structure
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure
>pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query274
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-36
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 6e-21
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 7e-07
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 3e-34
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-19
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-33
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-29
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-27
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-23
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-08
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-33
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-29
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-28
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 9e-23
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-10
1q55_A880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-10
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-09
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 6e-33
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-29
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-28
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-24
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-10
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 2e-32
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 5e-21
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-32
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-29
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-27
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 8e-23
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-10
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 3e-32
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 6e-29
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 4e-16
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 5e-32
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 2e-23
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 7e-32
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 1e-19
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 5e-31
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-19
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-30
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-30
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 9e-20
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 6e-11
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 2e-30
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-23
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-22
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 3e-30
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-16
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 3e-21
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 5e-21
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-19
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-05
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 3e-20
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 3e-14
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 2e-19
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 5e-17
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 4e-13
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 2e-15
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 6e-15
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 1e-14
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 4e-13
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 7e-12
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 3e-11
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 6e-05
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 6e-04
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
 Score =  127 bits (322), Expect = 2e-36
 Identities = 44/165 (26%), Positives = 66/165 (40%), Gaps = 33/165 (20%)

Query: 29  PVFDKQFY--SVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLY 86
           P F   F+   + + ED  + S +   + A                       D      
Sbjct: 6   PFFTNHFFDTYLLISEDTPVGSSV-TQLLARDM--------------------D------ 38

Query: 87  SLNRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQEYTLTVRATDSVSGHSAEVF 146
             N  L++ ++G  +   FAV+ +TG + +   LD ET  E+T+    +D          
Sbjct: 39  --NDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSD--HQGVITRK 94

Query: 147 VSVRVTDVNDCPPEFPQDWYNVSISEAAPFGTLILKVRALDNDSG 191
           V+++V DVND  P F    Y+V I E  P GT I  V A D D G
Sbjct: 95  VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLG 139
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Length = 159 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query274
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.97
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.97
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.97
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.97
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.95
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.95
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.94
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.93
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.92
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.91
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.91
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.91
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.91
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.89
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.88
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.86
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.85
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.84
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.83
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.81
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.73
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.71
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.71
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.71
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.69
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.67
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.53
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.53
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.45
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.43
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.35
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.33
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.3
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.29
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.21
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.15
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 98.81
3rb5_A298 Na/Ca exchange protein; CBD12, calcium binding and 94.16
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 93.16
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 92.15
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 88.05
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 84.81
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 83.59
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=8.7e-41  Score=307.86  Aligned_cols=240  Identities=24%  Similarity=0.378  Sum_probs=202.6

Q ss_pred             CeEEEEECCCC---CceEEEEEEE--EeccCCCCeeeCCc--eEEEEeCCCCCCCeEEEEEEEeCCC-CCeEEEEEecCC
Q psy7563           1 MPSSILSSGIQ---PCSTEVSVNV--KVIDKSMPVFDKQF--YSVSVREDIQIHSPLPLTIRAESPL-NRKLIYSITGGN   72 (274)
Q Consensus         1 l~v~A~D~g~~---~~~~~~~v~I--~v~Ndn~P~F~~~~--y~~~v~E~~~~g~~v~~~v~a~D~d-~~~i~y~i~~~~   72 (274)
                      |+|.|+|.|.|   .+++.++|+|  .++|||+|+|.+..  |...|+|++++|+.| +++.|+|+| +..+.|+|..++
T Consensus        76 ~~V~a~d~g~~~~~~~~~~~~v~I~V~DvNDn~P~F~~~~~~~~~~v~E~~~~gt~v-~~v~A~D~D~g~n~~y~i~~~~  154 (419)
T 3ubh_A           76 FWVIITNMGHNAGIKYTDNQRVIILVKDVNDEPPYFINRPLPMQAVVQLNAPPNTPV-FTLQARDPDTDHNIHYFIVRDR  154 (419)
T ss_dssp             EEEEEEC--CCSSSCCEEEEEEEEEEECCCCSCCEECCSSSSCEEEECTTCCTTCEE-EECCEECSSTTCCEEEEEEEES
T ss_pred             EEEEEEeCCCCCCCCCcceEEEEEEEEECCCCCCcccCCCCcEEEEEeCCCCCCCEE-EEEEEECCCCCceeEEEEEeCC
Confidence            47899999865   5665555544  55699999999887  789999999999999 999999999 556999999877


Q ss_pred             CCCcEEEeCCCceEEeceeeEEEe--------------------------------------------------------
Q psy7563          73 SREQFAVDFNTGLYSLNRKLIYSI--------------------------------------------------------   96 (274)
Q Consensus        73 ~~~~F~i~~~tg~v~~~~~~~~~~--------------------------------------------------------   96 (274)
                      ..++|.|++.+|.|++.+.++|+.                                                        
T Consensus       155 ~~~~F~I~~~tG~i~~~~~ld~e~~~~y~l~V~A~D~g~~~~~~~~~~t~~v~I~V~dndn~P~F~~~~y~~~v~En~~~  234 (419)
T 3ubh_A          155 TGGRFEVDERSGVVRTRGTDLFQLDMEYVLYVKAEDQNGKVDDRRFQSTPEERLSIVGGKRAPQFYMPSYEAEIPENQKK  234 (419)
T ss_dssp             SSSCEEECTTTCEEEECSSSCCCBTCEEEEEEEEEEEEEEC--CCEEECCCEEEEEEESCCCCEESSSCEEEEEETTCCT
T ss_pred             CCCeEEEeCCceEEEEecccccccccEEEEEEEEEECCCCccCcccccceEEEEEEECCCCCCceecCeeEEEecCCCCC
Confidence            778999999999888755444332                                                        


Q ss_pred             ---------------------e-cCCCccceEEeCceeEEEECCCCCcCccc---EEEEEEEEEeCCCCceEEEEEEEEE
Q psy7563          97 ---------------------T-GGNSREQFAVDFNTGSITVVDELDFETVQ---EYTLTVRATDSVSGHSAEVFVSVRV  151 (274)
Q Consensus        97 ---------------------~-~~~~~~~f~i~~~tg~l~~~~~lD~E~~~---~~~l~v~a~d~~~~~~~~~~v~I~v  151 (274)
                                           . .++..++|.|++.+|.|++.++||||...   .|.|.|.|+|.++++++++.|+|.|
T Consensus       235 gt~v~~v~A~D~dn~~i~Ysi~~~~~~~~~F~I~~~tG~i~~~~~LD~E~~~~~~~y~l~V~a~dd~~~~s~~~~v~I~V  314 (419)
T 3ubh_A          235 DSDIISIKAKSFADREIRYTLKAQGQGAGTFNIGPTSGIVKLAKELDFEDLRQPHVYSLIVTATEDSGGFSTSVDLTIRV  314 (419)
T ss_dssp             TCEEEECCEECSSCCCCEEEEEESSSCCSSEEECTTTCEEEECSCCCTTCTTSCSEEEEEEEEECTTTSCEEEEEEEEEE
T ss_pred             CcEEEEEEEecCCCCceEEEEecCCCCCCcEEEECCCCEEEECcccCccccccccEEEEEEEEEeCCCCcEEEEEEEEEE
Confidence                                 1 14556899999999999999999999876   7999999997666788999999999


Q ss_pred             EecCCCCCccCCCceEE-EEeCCCCCCcEEEEEEEEeCCCCCCceEEEEEecCCCCcceEEeccceEEEEeccCCCCccc
Q psy7563         152 TDVNDCPPEFPQDWYNV-SISEAAPFGTLILKVRALDNDSGKQKISSTAQIAHSFLEIFFLSLHRYMFTIGKGFFPEREL  230 (274)
Q Consensus       152 ~dvNdn~P~f~~~~~~~-~v~E~~~~g~~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~~F~i~~~~g~~~i~~~~~ld~e~  230 (274)
                      .|+|||+|+|....|.. .|+|+.++|+.|++|.|+|+|.|.|+.++|+|..    ++|.|++ +|.+.+..  .||||.
T Consensus       315 ~DvNDn~P~f~~~~~~~~~v~E~~~~gt~v~~v~A~D~D~g~n~~v~Y~i~~----~~F~Id~-~G~i~~~~--~ld~E~  387 (419)
T 3ubh_A          315 TDVNDNAPKFELPDYQAHNVDEDIPLGTSILRVKAMDSDSGSNAEIEYLVSD----DHFAVDS-NGIIVNNK--QLDADN  387 (419)
T ss_dssp             ECCCCCCCEESSSEEEEEEEETTCCTTCEEEECCEECSSCGGGGCEEEEESC----TTEEECT-TCEEEECS--CSSSSC
T ss_pred             EccCCCCCcccCCcceeEEecCCCCCCCEEEEEEEEeCCCCCCCEEEEEEcC----CcEEECC-CeEEEECc--ccCccc
Confidence            99999999999999987 7999999999999999999999999999999954    4799998 78877665  889886


Q ss_pred             CCCcEEEEEEEEeCCCCCc
Q psy7563         231 LQPRCYRSEIEDRRRTGEE  249 (274)
Q Consensus       231 ~~~~~y~~~v~a~d~~g~~  249 (274)
                      . ...|.|.|.|.|.++..
T Consensus       388 ~-~~~y~l~V~a~D~G~p~  405 (419)
T 3ubh_A          388 N-NAYYEFIVTAKDKGEPP  405 (419)
T ss_dssp             T-TCEEEEEEEEEECCSSC
T ss_pred             C-CceEEEEEEEEECCcCC
Confidence            2 34699999999986543
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 274
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 2e-08
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 4e-04
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 5e-08
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 8e-06
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 2e-07
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 2e-05
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 2e-07
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 4e-05
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 8e-07
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 3e-06
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 2e-06
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 2e-06
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 5e-06
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 8e-06
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 6e-06
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 48.8 bits (115), Expect = 2e-08
 Identities = 22/131 (16%), Positives = 37/131 (28%), Gaps = 32/131 (24%)

Query: 29  PVFDKQFYSVSVREDIQIHSPLPLTIRAESPLNRKLIYSITGGNSREQFAVDFNTGLYSL 88
           P F      V V ED+     +   +                   +              
Sbjct: 4   PFFVPAVSRVDVSEDLSRGEKIISLVA---------QDPDKQQIQK-------------- 40

Query: 89  NRKLIYSITGGNSREQFAVDFNTGSITVVDELDFETVQE----YTLTVRATDS-VSGHSA 143
               +    G +      V+ + G +T    LD E+       YT+ +  TD  VS  + 
Sbjct: 41  ----LSYFIGNDPARWLTVNKDNGIVTGNGNLDRESEYVKNNTYTVIMLVTDDGVSVGTG 96

Query: 144 EVFVSVRVTDV 154
              + + V DV
Sbjct: 97  TGTLILHVLDV 107
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query274
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.85
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.85
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.82
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.81
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.8
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.77
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.7
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.69
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.67
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.63
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.63
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.54
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.52
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.52
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.48
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.41
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.15
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.03
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.0
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 98.97
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 86.8
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.85  E-value=4.6e-21  Score=142.61  Aligned_cols=100  Identities=27%  Similarity=0.415  Sum_probs=88.1

Q ss_pred             cCCCCeeeCCceEEEEeCCCCCCCeEEEEEEEeCCC------CCeEEEEEecCCC----CCcEEEeCCCceEEeceeeEE
Q psy7563          25 DKSMPVFDKQFYSVSVREDIQIHSPLPLTIRAESPL------NRKLIYSITGGNS----REQFAVDFNTGLYSLNRKLIY   94 (274)
Q Consensus        25 Ndn~P~F~~~~y~~~v~E~~~~g~~v~~~v~a~D~d------~~~i~y~i~~~~~----~~~F~i~~~tg~v~~~~~~~~   94 (274)
                      |||+|+|.+..|.+.|+|+.++|+.| +++.|+|+|      ++.+.|+|..+++    ..+|.|++.+|          
T Consensus         1 NDn~P~F~~~~y~~~V~E~~~~gt~v-~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG----------   69 (112)
T d1edha2           1 NDNRPEFTQEVFEGSVAEGAVPGTSV-MKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTG----------   69 (112)
T ss_dssp             SCCCCEESCSEEEEEEETTCCTTCEE-EECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTC----------
T ss_pred             CCCCCccCCCEEEEEEECCCCCCCEE-EEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccc----------
Confidence            89999999999999999999999999 999999998      4679999986432    35788888888          


Q ss_pred             EeecCCCccceEEeCceeEEEEC-CCCCcCcccEEEEEEEEEeCCCC-ceEEEEEEEEEEe
Q psy7563          95 SITGGNSREQFAVDFNTGSITVV-DELDFETVQEYTLTVRATDSVSG-HSAEVFVSVRVTD  153 (274)
Q Consensus        95 ~~~~~~~~~~f~i~~~tg~l~~~-~~lD~E~~~~~~l~v~a~d~~~~-~~~~~~v~I~v~d  153 (274)
                                        .|++. +.||||....|.|.|+|+|.|.+ ++++++|.|.|.|
T Consensus        70 ------------------~i~~~~~~lD~E~~~~y~l~V~a~D~g~~~~~~~~~v~I~V~D  112 (112)
T d1edha2          70 ------------------VISVLTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKD  112 (112)
T ss_dssp             ------------------EEEECSSCCCTTTCCEEEEEEEEETGGGTSCEEEEEEEEEEEC
T ss_pred             ------------------eEEEEecccccccCcEEEEEEEEEECCCCccEEEEEEEEEEEC
Confidence                              88764 57999999999999999998754 8899999999987
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure