Psyllid ID: psy7578

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MPMAGQHIMLKEEVNISDISDSELYNSAQAVGSGADEEFGEADSSLDAESIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKAPAQKTKSTYTPHGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
ccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHccccEEEEcccHHHHHHHHHHHHccHHHHHccccccccccHHHHHHHHHHHHHccccc
ccccccHEEEEEEccccccccHHHccccHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccHHHHHHHHHHHHHHHHHHHHHccHHcccccHHHHHHHHHHHHHHcccc
mpmagqhimlkeevnisdisdselynsaqavgsgadeefgeadssldaesigsgdladnllideddlsQESIEKARFTAYMLWAKQIRQKLIksnpemdfsQVSKKLGELwhtvpfnekygwKRQADRLAAKYTQkmskapaqktkstytphgrvgrpplnkqTVEAVIetkpsppaaprvplvkptlpadlfkvtgtqplDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCAlgpllcltqqipeengcspetlSHVLDNIAYIMPGL
MPMAGQHIMLKEEVNISDISDSELYNSAQAVGSGADEEFGEADSSLDAESIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTvpfnekygwkRQADRLAAKYTqkmskapaqktkstytphgrvgrpplnKQTVEAVIETkpsppaaprvplVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
MPMAGQHIMLKEEVNISDISDSELYNSAQAVGSGADEEFGEADSSLDAESIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKAPAQKTKSTYTPHGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
***********************************************************************IEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRL**********************************************************LPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYI****
******************************************************************************AYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWK********************************************************************************************************MAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
MPMAGQHIMLKEEVNISDISDSELYNSA*********************SIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAK*******************HGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
*PMAGQHIMLKEEVNISDISD***YNS*********************************************EKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMS*********************************************************TGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPMAGQHIMLKEEVNISDISDSELYNSAQAVGSGADEEFGEADSSLDAESIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKAPAQKTKSTYTPHGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMPGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q9UGU5601 HMG domain-containing pro yes N/A 0.707 0.329 0.417 6e-41
Q5BL56554 HMG box-containing protei yes N/A 0.667 0.337 0.384 2e-38
Q6WKW9554 HMG box-containing protei N/A N/A 0.657 0.332 0.386 8e-37
P40647757 Transcription factor Sox- N/A N/A 0.392 0.145 0.289 6e-06
B3DM43753 Transcription factor Sox- no N/A 0.392 0.146 0.289 7e-06
Q91731 382 Transcription factor Sox- N/A N/A 0.385 0.282 0.282 2e-05
P35711763 Transcription factor SOX- no N/A 0.382 0.140 0.297 2e-05
Q3KQ35 380 Transcription factor Sox- N/A N/A 0.307 0.226 0.290 3e-05
Q9W602693 FACT complex subunit SSRP N/A N/A 0.214 0.086 0.35 4e-05
P40646 380 Transcription factor SOX- no N/A 0.25 0.184 0.328 4e-05
>sp|Q9UGU5|HMGX4_HUMAN HMG domain-containing protein 4 OS=Homo sapiens GN=HMGXB4 PE=1 SV=2 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 88/211 (41%), Positives = 133/211 (63%), Gaps = 13/211 (6%)

Query: 70  ESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRL 129
           E  +K   +AY ++ K+ R  ++  +P +DF ++SKKL E+W  +P  +K  WK++A  L
Sbjct: 404 EKPKKKNMSAYQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYL 463

Query: 130 AAKYTQKMSKAPAQKTKSTYTPHGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLP 189
             ++ Q  ++A   K K++ +     G   +   +V  +   K SPP           LP
Sbjct: 464 --QHKQNKAEATTVKRKASSSE----GSMKVKASSVGVLSPQKKSPPTTM-------LLP 510

Query: 190 ADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLL 249
           A   K   T+P+D+AAHL+LLG++L++IG RL++T+G +A+SG +S+LLDS +CALGPL 
Sbjct: 511 ASPAKAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSIICALGPLA 570

Query: 250 CLTQQIPEENGCSPETLSHVLDNIAYIMPGL 280
           CLT Q+PE NGC  + LS+ LDNIAYIMPGL
Sbjct: 571 CLTTQLPELNGCPKQVLSNTLDNIAYIMPGL 601
Negatively regulates Wnt/beta-catenin signaling during development.
Homo sapiens (taxid: 9606)
>sp|Q5BL56|HMGX4_XENTR HMG box-containing protein 4 OS=Xenopus tropicalis GN=hmgxb4 PE=2 SV=1 Back     alignment and function description
>sp|Q6WKW9|HMGX4_XENLA HMG box-containing protein 4 OS=Xenopus laevis GN=hmgxb4 PE=1 SV=1 Back     alignment and function description
>sp|P40647|SOX5_XENLA Transcription factor Sox-5 OS=Xenopus laevis GN=sox5 PE=2 SV=2 Back     alignment and function description
>sp|B3DM43|SOX5_XENTR Transcription factor Sox-5 OS=Xenopus tropicalis GN=sox5 PE=2 SV=1 Back     alignment and function description
>sp|Q91731|SX11A_XENLA Transcription factor Sox-11-A OS=Xenopus laevis GN=sox11-a PE=1 SV=2 Back     alignment and function description
>sp|P35711|SOX5_HUMAN Transcription factor SOX-5 OS=Homo sapiens GN=SOX5 PE=1 SV=3 Back     alignment and function description
>sp|Q3KQ35|S17AA_XENLA Transcription factor Sox-17-alpha-A OS=Xenopus laevis GN=sox17a-a PE=1 SV=1 Back     alignment and function description
>sp|Q9W602|SSRP1_XENLA FACT complex subunit SSRP1 OS=Xenopus laevis GN=ssrp1 PE=1 SV=1 Back     alignment and function description
>sp|P40646|SOX7_MOUSE Transcription factor SOX-7 OS=Mus musculus GN=Sox7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
307212938 452 High mobility group protein 2-like 1 [Ha 0.803 0.497 0.483 8e-51
332029527 411 HMG box-containing protein 4 [Acromyrmex 0.739 0.503 0.508 2e-50
350421737 443 PREDICTED: hypothetical protein LOC10074 0.739 0.467 0.520 4e-50
383851295 444 PREDICTED: uncharacterized protein LOC10 0.739 0.466 0.513 4e-50
340726764 444 PREDICTED: hypothetical protein LOC10064 0.739 0.466 0.508 6e-50
380020452 444 PREDICTED: uncharacterized protein LOC10 0.739 0.466 0.508 7e-50
307190876 423 High mobility group protein 2-like 1 [Ca 0.739 0.489 0.508 8e-50
328784700 445 PREDICTED: hypothetical protein LOC40924 0.739 0.465 0.508 1e-49
321475614 411 hypothetical protein DAPPUDRAFT_236433 [ 0.735 0.501 0.443 7e-43
345494986 445 PREDICTED: hypothetical protein LOC10012 0.778 0.489 0.458 8e-43
>gi|307212938|gb|EFN88531.1| High mobility group protein 2-like 1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 162/242 (66%), Gaps = 17/242 (7%)

Query: 56  LADNLLIDEDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVP 115
           + D  +I +    ++   K RFTAYMLWAK+IRQ+L++ +P MDF+ +SK+LGELW TVP
Sbjct: 211 IKDGKIIGKTKAQRKDKGKTRFTAYMLWAKKIRQELLEQSPYMDFAAISKRLGELWATVP 270

Query: 116 FNEKYGWKRQADRLAAKYTQ----------KMSKAPAQKTKSTYTPHGRVGRPPLNKQTV 165
             EKY W+R+A RLAAK             KM    ++K       +G+  +P   K+T+
Sbjct: 271 HLEKYNWRRRAKRLAAKPHSLPTSKDEPIWKMPPPASRKKFINKIGNGKETKPASTKKTI 330

Query: 166 E----AVIETKPSPPAAPRVP---LVKPTLPADLFKVTGTQPLDIAAHLRLLGDNLTIIG 218
           +    +V+   P  P A R     + +P +   ++KV GTQP+D+AAHL+LLG++LTIIG
Sbjct: 331 QLGVPSVVGNIPVSPPANRTGKDMVNEPVIGTGMYKVIGTQPIDVAAHLKLLGESLTIIG 390

Query: 219 ERLKDTQGRMAISGGMSLLLDSFLCALGPLLCLTQQIPEENGCSPETLSHVLDNIAYIMP 278
           ERLK+  G++A+SG +S+LLDS LCALGPL+CLTQQ+ E NG  PETLS +LDNIAY+MP
Sbjct: 391 ERLKEHDGQIAVSGSLSVLLDSLLCALGPLVCLTQQVSETNGAKPETLSQMLDNIAYLMP 450

Query: 279 GL 280
           GL
Sbjct: 451 GL 452

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332029527|gb|EGI69416.1| HMG box-containing protein 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350421737|ref|XP_003492941.1| PREDICTED: hypothetical protein LOC100748023 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383851295|ref|XP_003701169.1| PREDICTED: uncharacterized protein LOC100875509 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340726764|ref|XP_003401723.1| PREDICTED: hypothetical protein LOC100643546 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380020452|ref|XP_003694097.1| PREDICTED: uncharacterized protein LOC100863612 [Apis florea] Back     alignment and taxonomy information
>gi|307190876|gb|EFN74713.1| High mobility group protein 2-like 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328784700|ref|XP_392763.3| PREDICTED: hypothetical protein LOC409240 [Apis mellifera] Back     alignment and taxonomy information
>gi|321475614|gb|EFX86576.1| hypothetical protein DAPPUDRAFT_236433 [Daphnia pulex] Back     alignment and taxonomy information
>gi|345494986|ref|XP_001605138.2| PREDICTED: hypothetical protein LOC100121528 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
UNIPROTKB|E1C640583 HMGXB4 "Uncharacterized protei 0.707 0.339 0.431 1.2e-40
UNIPROTKB|F1MNG0602 HMGXB4 "Uncharacterized protei 0.707 0.328 0.421 2e-40
UNIPROTKB|Q9UGU5601 HMGXB4 "HMG domain-containing 0.732 0.341 0.416 2e-40
UNIPROTKB|E2RDI8600 HMGXB4 "Uncharacterized protei 0.728 0.34 0.423 1.4e-39
UNIPROTKB|I3LUS6196 HMGXB4 "Uncharacterized protei 0.696 0.994 0.418 1.4e-39
UNIPROTKB|Q6WKW9554 hmgxb4 "HMG box-containing pro 0.710 0.359 0.407 7.8e-39
UNIPROTKB|Q5BL56554 hmgxb4 "HMG box-containing pro 0.703 0.355 0.419 2.6e-38
FB|FBgn0029936418 CG4617 [Drosophila melanogaste 0.303 0.203 0.586 1.6e-34
RGD|1305783598 Hmgxb4 "HMG box domain contain 0.703 0.329 0.380 1.3e-33
RGD|3759121 Sry "sex determining region Y" 0.328 0.760 0.333 2.3e-07
UNIPROTKB|E1C640 HMGXB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 432 (157.1 bits), Expect = 1.2e-40, P = 1.2e-40
 Identities = 91/211 (43%), Positives = 133/211 (63%)

Query:    70 ESIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRL 129
             E  +K   +AY ++ K+ R  ++  +P +DF  +SKKL E+W  +P  +K  WK++A  L
Sbjct:   386 EKPKKKNMSAYQVFCKEYRTNIVSEHPGIDFGDLSKKLAEVWKQLPDKDKLIWKQKAQYL 445

Query:   130 AAKYTQKMSKAPAQKTKSTYTPHGRVGRPPLNKQTVEAVIETKPSPPAAPRVPLVKPTLP 189
               K  Q  ++A   K K++ +     G P +      A+   K SP +     +V P+ P
Sbjct:   446 QHK--QNKAEATTVKRKASSSD----GAPKIKASPPGAISPHKKSPTST----VVLPSSP 495

Query:   190 ADLFKVTGTQPLDIAAHLRLLGDNLTIIGERLKDTQGRMAISGGMSLLLDSFLCALGPLL 249
             A   K   T+P+D+AAHL+LLG++L++IG RL++T+G +A+SG +S+LLDS LCALGPL 
Sbjct:   496 A---KAPETEPIDVAAHLQLLGESLSLIGHRLQETEGMVAVSGSLSVLLDSILCALGPLA 552

Query:   250 CLTQQIPEENGCSPETLSHVLDNIAYIMPGL 280
             CLT Q+PE NGC    LS+ LDNIAYIMPGL
Sbjct:   553 CLTTQLPELNGCPKHVLSNTLDNIAYIMPGL 583
GO:0016589 "NURF complex" evidence=IEA
UNIPROTKB|F1MNG0 HMGXB4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UGU5 HMGXB4 "HMG domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDI8 HMGXB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUS6 HMGXB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6WKW9 hmgxb4 "HMG box-containing protein 4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5BL56 hmgxb4 "HMG box-containing protein 4" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
FB|FBgn0029936 CG4617 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|1305783 Hmgxb4 "HMG box domain containing 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|3759 Sry "sex determining region Y" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 4e-11
smart0039870 smart00398, HMG, high mobility group 8e-11
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 1e-10
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 5e-10
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 1e-07
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 2e-05
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 4e-05
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 9e-05
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 0.001
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information 
 Score = 57.2 bits (139), Expect = 4e-11
 Identities = 17/60 (28%), Positives = 38/60 (63%)

Query: 78  TAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKM 137
           +AY L++++ R ++   NP +   ++SK LGE+W ++   EK  ++ +A++   +Y ++M
Sbjct: 6   SAYFLFSQEHRAEVKAENPGLSVGEISKILGEMWKSLSEEEKKKYEEKAEKDKERYEKEM 65

HMGs bind to the minor groove of DNA and have been classified by DNA binding preferences. Two phylogenically distinct groups of Class I proteins bind DNA in a sequence specific fashion and contain a single HMG box. One group (SOX-TCF) includes transcription factors, TCF-1, -3, -4; and also SRY and LEF-1, which bind four-way DNA junctions and duplex DNA targets. The second group (MATA) includes fungal mating type gene products MC, MATA1 and Ste11. Class II and III proteins (HMGB-UBF) bind DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions. Length = 66
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
PTZ0019994 high mobility group protein; Provisional 99.85
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.85
KOG0527|consensus331 99.82
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.8
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.77
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.75
smart0039870 HMG high mobility group. 99.73
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.7
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.7
COG5648211 NHP6B Chromatin-associated proteins containing the 99.68
KOG0381|consensus96 99.66
KOG0526|consensus615 99.54
KOG0528|consensus511 99.4
KOG3248|consensus421 99.12
KOG4715|consensus 410 98.92
KOG2746|consensus 683 98.72
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.12
COG5648211 NHP6B Chromatin-associated proteins containing the 97.17
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.0
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 96.75
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 94.46
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 94.12
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 89.77
PRK15117211 ABC transporter periplasmic binding protein MlaC; 84.44
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 84.38
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information 
Probab=99.85  E-value=6e-21  Score=151.09  Aligned_cols=77  Identities=26%  Similarity=0.502  Sum_probs=73.3

Q ss_pred             cccccCCCCCCCCCChHHHHHHHHHHHHHHhCCCCC--HHHHHHHHHHHHcCCChhhHHHHHHHHHHHHHHHHHHHhhC
Q psy7578          64 EDDLSQESIEKARFTAYMLWAKQIRQKLIKSNPEMD--FSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKA  140 (280)
Q Consensus        64 ~~~~~d~~~PKRP~sAY~LF~ke~R~kik~e~P~ls--~~eIsK~Lge~Wk~LseeEK~~Y~~kA~~~kekY~~ema~~  140 (280)
                      ++..+|+++||||+||||+|++++|.+|..+||+++  +.+|+++||++|++|+++||++|+++|+.++++|.++|.+|
T Consensus        14 ~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~dk~rY~~e~~~Y   92 (94)
T PTZ00199         14 KRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQEDKVRYEKEKAEY   92 (94)
T ss_pred             CCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345679999999999999999999999999999986  89999999999999999999999999999999999999987

>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0527|consensus Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0381|consensus Back     alignment and domain information
>KOG0526|consensus Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>KOG4715|consensus Back     alignment and domain information
>KOG2746|consensus Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 1e-05
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 3e-05
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 6e-05
1hrz_A76 The 3d Structure Of The Human Sry-Dna Complex Solve 1e-04
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 1e-04
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 1e-04
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 1e-04
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 2e-04
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 2e-04
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 3e-04
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 4e-04
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 5e-04
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 6e-04
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 7e-04
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure 
Iteration: 1

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 37/57 (64%)
Query: 79  AYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQ 135
           A+M+WAK  R++L + NP++  +++SK LG+ W  +   EK  +  +A+RL  ++ Q
Sbjct: 13  AFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQ 69
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 1e-15
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 1e-14
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 4e-14
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 5e-14
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 4e-13
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 5e-14
1hme_A77 High mobility group protein fragment-B; DNA-bindin 8e-14
1wgf_A90 Upstream binding factor 1; transcription factor, D 8e-14
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 9e-14
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 1e-13
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 1e-13
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 2e-13
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 2e-13
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 3e-13
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 3e-13
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 3e-13
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 4e-13
3tq6_A214 Transcription factor A, mitochondrial; transcripti 5e-13
3tq6_A214 Transcription factor A, mitochondrial; transcripti 3e-06
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 6e-13
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 7e-13
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 7e-13
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 7e-13
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 7e-13
1ckt_A71 High mobility group 1 protein; high-mobility group 5e-12
2lhj_A97 High mobility group protein homolog NHP1; structur 7e-12
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 1e-11
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 7e-06
2yrq_A173 High mobility group protein B1; HMG box domain, DN 2e-11
2yrq_A173 High mobility group protein B1; HMG box domain, DN 5e-09
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 3e-11
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 4e-11
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 7e-09
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 2e-08
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 2e-06
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
 Score = 69.8 bits (171), Expect = 1e-15
 Identities = 16/71 (22%), Positives = 37/71 (52%)

Query: 78  TAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKM 137
           +A  L+ +  R + +  NP+      + ++ ELW T+   EK  ++ +A +   +Y  +M
Sbjct: 13  SASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLKYEEKATKDLERYNSQM 72

Query: 138 SKAPAQKTKST 148
            +A  Q+++ +
Sbjct: 73  KRAIEQESQMS 83
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.88
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.87
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.87
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.87
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.87
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.87
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.87
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.87
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.87
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.87
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.86
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.86
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.86
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.86
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.86
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.86
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.86
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.85
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.85
1ckt_A71 High mobility group 1 protein; high-mobility group 99.84
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.84
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.84
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.84
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.84
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.83
2lhj_A97 High mobility group protein homolog NHP1; structur 99.82
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.81
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.81
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.79
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.78
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.78
2cto_A93 Novel protein; high mobility group box domain, hel 99.77
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.76
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.76
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.75
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.75
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.72
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.72
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.7
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
Probab=99.88  E-value=1.7e-23  Score=176.82  Aligned_cols=123  Identities=17%  Similarity=0.295  Sum_probs=103.2

Q ss_pred             cccccccch--hhhhhhhccCCCCCCccccccCCcc---cccccCCCCcccccccccccccCCCCCCCCCChHHHHHHHH
Q psy7578          13 EVNISDISD--SELYNSAQAVGSGADEEFGEADSSL---DAESIGSGDLADNLLIDEDDLSQESIEKARFTAYMLWAKQI   87 (280)
Q Consensus        13 ~v~~se~sk--se~~~t~s~~~~g~~e~~~~a~s~~---~~~s~g~~k~~kk~~~k~~~~~d~~~PKRP~sAY~LF~ke~   87 (280)
                      .++|+|||+  ++.|++++..++...++.+..+...   +...+......     +.+..+|+++||||+||||+||+++
T Consensus        29 ~~~~~eisk~lg~~Wk~ls~~eK~~y~~~A~~~k~~y~~~~~~y~~~k~~-----~kk~~kdp~~pKrp~say~lf~~~~  103 (159)
T 2gzk_A           29 RMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRKGE-----TKKKFKDPNAPKRPPSAFFLFCSEY  103 (159)
T ss_dssp             SCCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCSSCSCCCCC-----CGGGSCCTTCCCCCCCHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHhhHHHhccHHHHHHHHHHHHHHHhhcccccccc-----ccccccccccccccccccchhhHhh
Confidence            367899999  9999999998888888877655432   22233222111     1224578999999999999999999


Q ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHcCCChhhHHHHHHHHHHHHHHHHHHHhhC
Q psy7578          88 RQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKA  140 (280)
Q Consensus        88 R~kik~e~P~ls~~eIsK~Lge~Wk~LseeEK~~Y~~kA~~~kekY~~ema~~  140 (280)
                      |.+|+.+||+++++||+++||++|++|+++||++|.++|++++++|+++|.+|
T Consensus       104 r~~~~~~~p~~~~~ei~k~lg~~Wk~ls~~eK~~y~~~A~~~k~~y~~~~~~y  156 (159)
T 2gzk_A          104 RPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAY  156 (159)
T ss_dssp             HHHHHHHCSCCCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhCCCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999887
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 8e-15
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 1e-13
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 2e-13
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 6e-13
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 7e-13
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 7e-13
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-12
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-11
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 2e-11
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 2e-11
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-11
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-09
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 66.0 bits (161), Expect = 8e-15
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 78  TAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKM 137
            A+M+W++  R+K+ + NP+M  S++SK+LG  W  +   EK  +  +A RL A + ++ 
Sbjct: 8   NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEH 67

Query: 138 S---KAPAQKTKS 147
                 P +KTK+
Sbjct: 68  PDYKYRPRRKTKT 80
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.84
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.83
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.83
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.82
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.81
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.8
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.79
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.7
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.69
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 96.68
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.88  E-value=1.3e-22  Score=153.21  Aligned_cols=77  Identities=27%  Similarity=0.463  Sum_probs=73.8

Q ss_pred             CCCCCCCChHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHcCCChhhHHHHHHHHHHHHHHHHHHHhhCCCCCCCc
Q psy7578          71 SIEKARFTAYMLWAKQIRQKLIKSNPEMDFSQVSKKLGELWHTVPFNEKYGWKRQADRLAAKYTQKMSKAPAQKTKS  147 (280)
Q Consensus        71 ~~PKRP~sAY~LF~ke~R~kik~e~P~ls~~eIsK~Lge~Wk~LseeEK~~Y~~kA~~~kekY~~ema~~~~~p~Kk  147 (280)
                      ++||||+||||||++++|.+++.+||++++.||+++||++|++|+++||++|+++|+.++++|.+++.+|...|+++
T Consensus         1 ~kiKRP~nAy~lF~~~~r~~~~~~~p~~~~~eisk~~g~~W~~l~~eeK~~y~~~A~~~k~~y~~~~p~Yk~~p~rk   77 (80)
T d1gt0d_           1 DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRK   77 (80)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHCTTCCCCCCCC
T ss_pred             CCCCCCCcHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHCcCCHHHHHHHHHHHHHHHHHHHHHCccccCCCCCC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999997777664
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure