Psyllid ID: psy7602
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| 242016336 | 506 | protein ariadne-1, putative [Pediculus h | 0.810 | 0.152 | 0.564 | 1e-19 | |
| 91076172 | 515 | PREDICTED: similar to ariadne ubiquitin- | 0.810 | 0.149 | 0.541 | 1e-18 | |
| 270014562 | 501 | hypothetical protein TcasGA2_TC004596 [T | 0.810 | 0.153 | 0.541 | 2e-18 | |
| 328711886 | 507 | PREDICTED: protein ariadne-1 homolog [Ac | 0.810 | 0.151 | 0.564 | 2e-18 | |
| 170038021 | 498 | ariadne ubiquitin-conjugating enzyme E2 | 0.515 | 0.098 | 0.795 | 5e-18 | |
| 322797457 | 493 | hypothetical protein SINV_05140 [Solenop | 0.810 | 0.156 | 0.541 | 6e-18 | |
| 332029156 | 495 | Protein ariadne-1-like protein [Acromyrm | 0.810 | 0.155 | 0.541 | 9e-18 | |
| 307214633 | 510 | Protein ariadne-1 [Harpegnathos saltator | 0.810 | 0.150 | 0.541 | 9e-18 | |
| 357623277 | 519 | putative ariadne ubiquitin-conjugating e | 0.757 | 0.138 | 0.6 | 1e-17 | |
| 241053358 | 506 | E3 ubiquitin ligase, putative [Ixodes sc | 0.810 | 0.152 | 0.529 | 1e-17 |
| >gi|242016336|ref|XP_002428785.1| protein ariadne-1, putative [Pediculus humanus corporis] gi|212513470|gb|EEB16047.1| protein ariadne-1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 100 bits (248), Expect = 1e-19, Method: Composition-based stats.
Identities = 48/85 (56%), Positives = 59/85 (69%), Gaps = 8/85 (9%)
Query: 1 MPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEFD--- 57
+PS++MTGLEC HRFCTQCW EYLTTKI++EG+GQTIACAAHGC+ILVDD +
Sbjct: 143 LPSSMMTGLECGHRFCTQCWAEYLTTKIMEEGVGQTIACAAHGCDILVDDATVMRLVRDS 202
Query: 58 ----VYQGILSNQVTNC-RLASLVP 77
YQ +++N C RL P
Sbjct: 203 KVKLKYQHLITNSFVECNRLLRWCP 227
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91076172|ref|XP_971560.1| PREDICTED: similar to ariadne ubiquitin-conjugating enzyme E2 binding protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270014562|gb|EFA11010.1| hypothetical protein TcasGA2_TC004596 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328711886|ref|XP_001947883.2| PREDICTED: protein ariadne-1 homolog [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|170038021|ref|XP_001846852.1| ariadne ubiquitin-conjugating enzyme E2 binding protein [Culex quinquefasciatus] gi|167881438|gb|EDS44821.1| ariadne ubiquitin-conjugating enzyme E2 binding protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|322797457|gb|EFZ19528.1| hypothetical protein SINV_05140 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332029156|gb|EGI69167.1| Protein ariadne-1-like protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307214633|gb|EFN89583.1| Protein ariadne-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|357623277|gb|EHJ74502.1| putative ariadne ubiquitin-conjugating enzyme E2 binding protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|241053358|ref|XP_002407580.1| E3 ubiquitin ligase, putative [Ixodes scapularis] gi|215492235|gb|EEC01876.1| E3 ubiquitin ligase, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 95 | ||||||
| UNIPROTKB|F1SI92 | 343 | ARIH1 "Uncharacterized protein | 0.747 | 0.206 | 0.531 | 8.9e-20 | |
| UNIPROTKB|Q32NS4 | 529 | arih1 "E3 ubiquitin-protein li | 0.8 | 0.143 | 0.523 | 1.1e-19 | |
| UNIPROTKB|F1NF42 | 445 | ARIH1 "Uncharacterized protein | 0.8 | 0.170 | 0.511 | 1.1e-19 | |
| UNIPROTKB|B1H1E4 | 529 | arih1 "E3 ubiquitin-protein li | 0.8 | 0.143 | 0.523 | 1.3e-19 | |
| UNIPROTKB|J9NWH8 | 523 | ARIH1 "Uncharacterized protein | 0.8 | 0.145 | 0.511 | 2.6e-19 | |
| UNIPROTKB|F1PG97 | 554 | ARIH1 "Uncharacterized protein | 0.8 | 0.137 | 0.511 | 3.4e-19 | |
| UNIPROTKB|A2VEA3 | 555 | ARIH1 "E3 ubiquitin-protein li | 0.8 | 0.136 | 0.511 | 3.4e-19 | |
| MGI|MGI:1344363 | 555 | Arih1 "ariadne ubiquitin-conju | 0.8 | 0.136 | 0.511 | 3.4e-19 | |
| UNIPROTKB|Q9Y4X5 | 557 | ARIH1 "E3 ubiquitin-protein li | 0.8 | 0.136 | 0.511 | 3.5e-19 | |
| ZFIN|ZDB-GENE-030131-5213 | 527 | arih1 "ariadne ubiquitin-conju | 0.8 | 0.144 | 0.5 | 9.9e-19 |
| UNIPROTKB|F1SI92 ARIH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 218 (81.8 bits), Expect = 8.9e-20, Sum P(2) = 8.9e-20
Identities = 42/79 (53%), Positives = 51/79 (64%)
Query: 7 TGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEFDV-------Y 59
TGLEC H+FC QCW EYLTTKI++EGMGQTI+C AHGC+ILVDD + Y
Sbjct: 23 TGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKY 82
Query: 60 QGILSNQVTNC-RLASLVP 77
Q +++N C RL P
Sbjct: 83 QHLITNSFVECNRLLKWCP 101
|
|
| UNIPROTKB|Q32NS4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NF42 ARIH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B1H1E4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWH8 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PG97 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VEA3 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1344363 Arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4X5 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5213 arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| KOG1814|consensus | 445 | 99.64 | ||
| KOG1815|consensus | 444 | 99.62 | ||
| KOG1812|consensus | 384 | 99.25 | ||
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 98.34 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 98.06 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 97.94 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.85 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.76 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.57 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.42 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.41 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.22 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.03 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 96.96 | |
| KOG0320|consensus | 187 | 96.77 | ||
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 96.76 | |
| KOG0006|consensus | 446 | 96.69 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.53 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 96.45 | |
| KOG0317|consensus | 293 | 96.38 | ||
| KOG1002|consensus | 791 | 96.29 | ||
| KOG2164|consensus | 513 | 95.95 | ||
| KOG0978|consensus | 698 | 95.88 | ||
| PHA02926 | 242 | zinc finger-like protein; Provisional | 95.37 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 95.12 | |
| KOG0823|consensus | 230 | 95.12 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 95.09 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 94.18 | |
| KOG2177|consensus | 386 | 93.02 | ||
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 90.94 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 89.99 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 89.89 | |
| KOG0287|consensus | 442 | 87.85 | ||
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 85.82 | |
| KOG4739|consensus | 233 | 83.53 | ||
| KOG2660|consensus | 331 | 82.64 | ||
| PF06844 | 68 | DUF1244: Protein of unknown function (DUF1244); In | 81.19 | |
| KOG0824|consensus | 324 | 80.38 |
| >KOG1814|consensus | Back alignment and domain information |
|---|
Probab=99.64 E-value=3e-16 Score=120.13 Aligned_cols=80 Identities=26% Similarity=0.458 Sum_probs=74.2
Q ss_pred CCcccCCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcccccchhhhH------HHHHHHHHHHHHhhCCCCCCC
Q psy7602 4 TLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGKPIEF------DVYQGILSNQVTNCRLASLVP 77 (95)
Q Consensus 4 ~~~~~l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~i~~~~i~~l------~ky~~~l~~~~v~~~~~~~~~ 77 (95)
..++.++|+|+||+.|++.|.++.|+ +|++..++||+++|+...++.+++++ +||+++++++-++...
T Consensus 198 ~c~~~lpC~Hv~Ck~C~kdY~~~~i~-eg~v~~l~Cp~~~C~~~a~~g~vKelvg~EL~arYe~l~lqk~l~~ms----- 271 (445)
T KOG1814|consen 198 HCFKFLPCSHVFCKSCLKDYFTIQIQ-EGQVSCLKCPDPKCGSVAPPGQVKELVGDELFARYEKLMLQKTLELMS----- 271 (445)
T ss_pred ceeeecccchHHHHHHHHHHHHHhhh-cceeeeecCCCCCCcccCCchHHHHHHHHHHHHHHHHHHHHHHHHhhc-----
Confidence 34667899999999999999999998 79988999999999999999999988 9999999999999984
Q ss_pred CCCCCeeeCCCCCCcc
Q psy7602 78 CKCSWVRFPPGADFIL 93 (95)
Q Consensus 78 ~~~~~~~~CP~~~C~~ 93 (95)
++.|||++.|+.
T Consensus 272 ----dv~yCPr~~Cq~ 283 (445)
T KOG1814|consen 272 ----DVVYCPRACCQL 283 (445)
T ss_pred ----ccccCChhhccC
Confidence 999999999986
|
|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0006|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 95 | |||
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 2e-06 |
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 | Back alignment and structure |
|---|
Score = 41.4 bits (97), Expect = 2e-06
Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
Query: 9 LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN 45
+C FCT C +Y+ I+EG+ I+C C
Sbjct: 24 AQCQCIFCTLCLKQYVELL-IKEGLETAISCPDAACP 59
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.7 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.18 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.13 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.02 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.01 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 97.96 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 97.92 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.9 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.82 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 97.82 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 97.81 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.8 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.78 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 97.77 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.69 | |
| 2jmo_A | 80 | Parkin; IBR, E3 ligase, zinc binding domain, RBR; | 97.59 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.55 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.53 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.52 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.5 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.5 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.49 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.37 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.35 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.31 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.27 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.26 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.26 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 97.23 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 97.23 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.22 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 97.16 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.1 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 97.08 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.02 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 96.99 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 96.98 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 96.98 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 96.95 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 96.89 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 96.83 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 96.73 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 96.66 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 96.66 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 96.63 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 96.54 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 96.46 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 96.31 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 96.28 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 96.16 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.98 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 95.94 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 95.9 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 95.87 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 95.6 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 95.58 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 95.34 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 95.18 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 95.01 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 93.17 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 91.93 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 91.57 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 91.3 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 89.46 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 89.42 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 89.4 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 88.35 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 87.51 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 86.83 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 80.69 |
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Probab=99.70 E-value=2.9e-18 Score=106.52 Aligned_cols=67 Identities=22% Similarity=0.472 Sum_probs=57.9
Q ss_pred CCcccC-CCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCcc--cccchhhhH------HHHHHHHHHHHHhhC
Q psy7602 4 TLMTGL-ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNIL--VDDGKPIEF------DVYQGILSNQVTNCR 71 (95)
Q Consensus 4 ~~~~~l-~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~~--i~~~~i~~l------~ky~~~l~~~~v~~~ 71 (95)
.+++.+ .|||.||++||++|++.+|. +|...+|+||+++|+.. ++++.++.+ ++|+++++++||+++
T Consensus 18 ~~~~~l~~CgH~FC~~Cl~~~~~~~i~-~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky~~~~~~~~v~~~ 93 (94)
T 1wim_A 18 EQMTTIAQCQCIFCTLCLKQYVELLIK-EGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFERSGPSS 93 (94)
T ss_dssp GGEEEETTTTEEEEHHHHHHHHHHHHH-HCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHHHHHHHHSSCSSC
T ss_pred ccceEcCCCCCcccHHHHHHHHHHHhh-cCCcccccCccccCCCCCccCHHHHHHHCCHHHHHHHHHHHHHhhhccC
Confidence 345554 69999999999999999997 67656899999999999 999999887 899999999988764
|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 95 | ||||
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 6e-04 |
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: UbcM4-interacting protein 4 (KIAA0161) species: Human (Homo sapiens) [TaxId: 9606]
Score = 33.5 bits (76), Expect = 6e-04
Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 1/43 (2%)
Query: 2 PSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGC 44
+ T +C FCT C +Y+ I+EG+ I+C C
Sbjct: 17 VEQMTTIAQCQCIFCTLCLKQYVELL-IKEGLETAISCPDAAC 58
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 95 | |||
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 99.63 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.96 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.88 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.65 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 97.54 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.53 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.35 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.21 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 96.93 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 96.83 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 96.81 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.74 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 95.66 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 95.58 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 95.21 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 93.98 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 92.16 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 91.78 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 86.58 |
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: UbcM4-interacting protein 4 (KIAA0161) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63 E-value=2.4e-17 Score=100.90 Aligned_cols=66 Identities=24% Similarity=0.496 Sum_probs=53.4
Q ss_pred CCCCccc-CCCCchhhHHHHHHHHHhhhhcCCceeeeecCccccCc--ccccchhhhH------HHHHHHHHHHHH
Q psy7602 2 PSTLMTG-LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNI--LVDDGKPIEF------DVYQGILSNQVT 68 (95)
Q Consensus 2 ~~~~~~~-l~CgH~FC~~C~~~yl~~~I~~~g~~~~i~Cp~~~C~~--~i~~~~i~~l------~ky~~~l~~~~v 68 (95)
|.++++. +.|||.||.+||++|++++|+ +|...+|+||..+|.. .+++.+|+.+ +||+++.+++.+
T Consensus 16 ~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~-~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~~~~~~ky~~~~l~~~~ 90 (94)
T d1wima_ 16 PVEQMTTIAQCQCIFCTLCLKQYVELLIK-EGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFERSG 90 (94)
T ss_dssp BGGGEEEETTTTEEEEHHHHHHHHHHHHH-HCSCCCEECSCTTCSSCCEECHHHHHHHSCHHHHHHHHHHHHHSSC
T ss_pred cCCceEEECCCCCEeCCcCHHHHHHHHHh-cCCccccCCcCCCCCCCcccCHHHHHHhCCHHHHHHHHHHHHHhcc
Confidence 3455555 479999999999999999998 6766789999999965 5788888877 888888776544
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|