Psyllid ID: psy7604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MERYYDGDQEQLFAEARVINPLVKNSQPSTSSKSKCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
ccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHccccHHHHHHHHHHHHHcccc
ccHHccccHHHHHHHccccccccccccccccccccccEEEccccHHHcccccccccHHHHHHHHHHHHEHccccccEEEEccccccccEccHHHHHHHcccHHHHHHHHHHHHHHccc
meryydgdQEQLFAEARVinplvknsqpstsskskceicftnmpstlmtglecshrfctQCWCEYLTTKIIQEGMGQTIACAAhgcnilvddgtvmrlvrdpkvklkYQHLITNSFVE
meryydgdqeQLFAEARvinplvknsqpstsskskCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRdpkvklkyqhlitnsfve
MERYYDGDQEQLFAEARVINPLVKNSQPSTSSKSKCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
***********************************CEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITN****
MERYYDGDQEQLFAE*********************EICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
MERYYDGDQEQLFAEARVINPLVK***********CEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
*ER*YDGDQEQLFAEARVINP**********SKSKCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERYYDGDQEQLFAEARVINPLVKNSQPSTSSKSKCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
B1H1E4 529 E3 ubiquitin-protein liga yes N/A 1.0 0.223 0.642 3e-42
Q9Z1K5 555 E3 ubiquitin-protein liga yes N/A 1.0 0.212 0.642 3e-42
A2VEA3 555 E3 ubiquitin-protein liga yes N/A 1.0 0.212 0.642 3e-42
Q9Y4X5 557 E3 ubiquitin-protein liga yes N/A 1.0 0.211 0.642 3e-42
Q32NS4 529 E3 ubiquitin-protein liga N/A N/A 1.0 0.223 0.642 6e-42
Q6NW85 533 E3 ubiquitin-protein liga yes N/A 1.0 0.221 0.650 1e-40
Q6PFJ9 527 E3 ubiquitin-protein liga no N/A 1.0 0.223 0.617 3e-40
Q94981 503 Protein ariadne-1 OS=Dros yes N/A 1.0 0.234 0.557 8e-35
Q9LVX0 537 Probable E3 ubiquitin-pro yes N/A 0.737 0.162 0.406 6e-13
Q949V6 597 Probable E3 ubiquitin-pro no N/A 0.966 0.190 0.319 7e-13
>sp|B1H1E4|ARI1_XENTR E3 ubiquitin-protein ligase arih1 OS=Xenopus tropicalis GN=arih1 PE=2 SV=1 Back     alignment and function desciption
 Score =  170 bits (430), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 5/123 (4%)

Query: 1   MERYYDGDQEQLFAEARVINPLVKNSQPSTSSKSK-----CEICFTNMPSTLMTGLECSH 55
           MERY+DG+ E+LF+E  VINP  K+     +++S      C+IC+ N P++  TGLEC H
Sbjct: 118 MERYFDGNLEKLFSECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGH 177

Query: 56  RFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNS 115
           +FC QCW EYLTTKII+EGMGQTI+C AHGC+ILVDD TVMRL+ D KVKLKYQHLITNS
Sbjct: 178 KFCMQCWSEYLTTKIIEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNS 237

Query: 116 FVE 118
           FVE
Sbjct: 238 FVE 240
E3 ubiquitin-protein ligase, which catalyzes polyubiquitination of target proteins together with ubiquitin-conjugating enzyme E2 ube2l3.
Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9Z1K5|ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus GN=Arih1 PE=2 SV=3 Back     alignment and function description
>sp|A2VEA3|ARI1_BOVIN E3 ubiquitin-protein ligase ARIH1 OS=Bos taurus GN=ARIH1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4X5|ARI1_HUMAN E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens GN=ARIH1 PE=1 SV=2 Back     alignment and function description
>sp|Q32NS4|ARI1_XENLA E3 ubiquitin-protein ligase arih1 OS=Xenopus laevis GN=arih1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NW85|ARI1L_DANRE E3 ubiquitin-protein ligase arih1l OS=Danio rerio GN=arih1l PE=2 SV=1 Back     alignment and function description
>sp|Q6PFJ9|ARI1_DANRE E3 ubiquitin-protein ligase arih1 OS=Danio rerio GN=arih1 PE=2 SV=1 Back     alignment and function description
>sp|Q94981|ARI1_DROME Protein ariadne-1 OS=Drosophila melanogaster GN=ari-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVX0|ARI3_ARATH Probable E3 ubiquitin-protein ligase ARI3 OS=Arabidopsis thaliana GN=ARI3 PE=2 SV=1 Back     alignment and function description
>sp|Q949V6|ARI1_ARATH Probable E3 ubiquitin-protein ligase ARI1 OS=Arabidopsis thaliana GN=ARI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
242016336 506 protein ariadne-1, putative [Pediculus h 1.0 0.233 0.742 1e-48
328711886 507 PREDICTED: protein ariadne-1 homolog [Ac 0.991 0.230 0.697 2e-46
91076172 515 PREDICTED: similar to ariadne ubiquitin- 1.0 0.229 0.702 4e-46
270014562 501 hypothetical protein TcasGA2_TC004596 [T 1.0 0.235 0.685 8e-46
157134279 356 zinc finger protein [Aedes aegypti] gi|1 0.974 0.323 0.698 3e-45
170038021 498 ariadne ubiquitin-conjugating enzyme E2 0.974 0.230 0.698 4e-45
170062530 441 zinc finger protein [Culex quinquefascia 0.974 0.260 0.698 9e-45
350401290 509 PREDICTED: E3 ubiquitin-protein ligase a 1.0 0.231 0.659 2e-44
340720568 509 PREDICTED: e3 ubiquitin-protein ligase A 1.0 0.231 0.666 3e-44
307214633 510 Protein ariadne-1 [Harpegnathos saltator 1.0 0.231 0.659 9e-44
>gi|242016336|ref|XP_002428785.1| protein ariadne-1, putative [Pediculus humanus corporis] gi|212513470|gb|EEB16047.1| protein ariadne-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 107/128 (83%), Gaps = 10/128 (7%)

Query: 1   MERYYDGDQEQLFAEARVINPLVKNS------QP----STSSKSKCEICFTNMPSTLMTG 50
           MER+YDGDQ+QLFAEARVINP  K +      QP    ST+S  +CEICF  +PS++MTG
Sbjct: 91  MERFYDGDQDQLFAEARVINPFRKPTLIKQKFQPVRRTSTTSTEECEICFMILPSSMMTG 150

Query: 51  LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQH 110
           LEC HRFCTQCW EYLTTKI++EG+GQTIACAAHGC+ILVDD TVMRLVRD KVKLKYQH
Sbjct: 151 LECGHRFCTQCWAEYLTTKIMEEGVGQTIACAAHGCDILVDDATVMRLVRDSKVKLKYQH 210

Query: 111 LITNSFVE 118
           LITNSFVE
Sbjct: 211 LITNSFVE 218

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328711886|ref|XP_001947883.2| PREDICTED: protein ariadne-1 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91076172|ref|XP_971560.1| PREDICTED: similar to ariadne ubiquitin-conjugating enzyme E2 binding protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270014562|gb|EFA11010.1| hypothetical protein TcasGA2_TC004596 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157134279|ref|XP_001663221.1| zinc finger protein [Aedes aegypti] gi|108870536|gb|EAT34761.1| AAEL013028-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170038021|ref|XP_001846852.1| ariadne ubiquitin-conjugating enzyme E2 binding protein [Culex quinquefasciatus] gi|167881438|gb|EDS44821.1| ariadne ubiquitin-conjugating enzyme E2 binding protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170062530|ref|XP_001866709.1| zinc finger protein [Culex quinquefasciatus] gi|167880390|gb|EDS43773.1| zinc finger protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350401290|ref|XP_003486110.1| PREDICTED: E3 ubiquitin-protein ligase arih1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720568|ref|XP_003398706.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 1 [Bombus terrestris] gi|340720570|ref|XP_003398707.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 2 [Bombus terrestris] gi|340720572|ref|XP_003398708.1| PREDICTED: e3 ubiquitin-protein ligase ARIH1-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307214633|gb|EFN89583.1| Protein ariadne-1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
UNIPROTKB|F1NF42 445 ARIH1 "Uncharacterized protein 1.0 0.265 0.658 5.9e-41
UNIPROTKB|A2VEA3 555 ARIH1 "E3 ubiquitin-protein li 1.0 0.212 0.658 5.9e-41
UNIPROTKB|F1PG97 554 ARIH1 "Uncharacterized protein 1.0 0.212 0.658 5.9e-41
UNIPROTKB|J9NWH8 523 ARIH1 "Uncharacterized protein 1.0 0.225 0.658 5.9e-41
UNIPROTKB|Q9Y4X5 557 ARIH1 "E3 ubiquitin-protein li 1.0 0.211 0.658 5.9e-41
UNIPROTKB|B1H1E4 529 arih1 "E3 ubiquitin-protein li 1.0 0.223 0.658 5.9e-41
MGI|MGI:1344363 555 Arih1 "ariadne ubiquitin-conju 1.0 0.212 0.658 5.9e-41
RGD|1308131 381 Arih1 "ariadne homolog, ubiqui 1.0 0.309 0.658 5.9e-41
UNIPROTKB|Q32NS4 529 arih1 "E3 ubiquitin-protein li 1.0 0.223 0.658 1.6e-40
ZFIN|ZDB-GENE-040426-2395 533 arih1l "ariadne homolog, ubiqu 1.0 0.221 0.650 5.3e-40
UNIPROTKB|F1NF42 ARIH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 435 (158.2 bits), Expect = 5.9e-41, P = 5.9e-41
 Identities = 81/123 (65%), Positives = 98/123 (79%)

Query:     1 MERYYDGDQEQLFAEARVINPLVKNS--QPSTSSKSK---CEICFTNMPSTLMTGLECSH 55
             MERY+DG+ E+LFAE  VINP  K+   Q +T S ++   C+IC+ N P++  TGLEC H
Sbjct:    34 MERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQDMPCQICYLNYPNSYFTGLECGH 93

Query:    56 RFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNS 115
             +FC QCW EYLTTKI++EGMGQTI+C AHGC+ILVDD TVMRL+ D KVKLKYQHLITNS
Sbjct:    94 KFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDSKVKLKYQHLITNS 153

Query:   116 FVE 118
             FVE
Sbjct:   154 FVE 156
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0031625 "ubiquitin protein ligase binding" evidence=IEA
UNIPROTKB|A2VEA3 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PG97 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWH8 ARIH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4X5 ARIH1 "E3 ubiquitin-protein ligase ARIH1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1H1E4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1344363 Arih1 "ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308131 Arih1 "ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32NS4 arih1 "E3 ubiquitin-protein ligase arih1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2395 arih1l "ariadne homolog, ubiquitin-conjugating enzyme E2 binding protein, 1 like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4X5ARI1_HUMAN6, ., 3, ., 2, ., -0.64221.00.2118yesN/A
B1H1E4ARI1_XENTR6, ., 3, ., 2, ., -0.64221.00.2230yesN/A
Q6NW85ARI1L_DANRE6, ., 3, ., 2, ., -0.65041.00.2213yesN/A
Q9Z1K5ARI1_MOUSE6, ., 3, ., 2, ., -0.64221.00.2126yesN/A
A2VEA3ARI1_BOVIN6, ., 3, ., 2, ., -0.64221.00.2126yesN/A
Q94981ARI1_DROMENo assigned EC number0.55731.00.2345yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG1815|consensus 444 99.66
KOG1814|consensus 445 99.63
KOG1812|consensus 384 99.36
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.09
KOG0320|consensus187 98.94
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.93
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.86
KOG0823|consensus 230 98.8
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.79
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.79
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.72
KOG0317|consensus293 98.64
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.62
PF1463444 zf-RING_5: zinc-RING finger domain 98.57
KOG2164|consensus 513 98.47
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.44
PHA02926242 zinc finger-like protein; Provisional 98.38
PHA02929238 N1R/p28-like protein; Provisional 98.38
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.24
KOG0978|consensus698 98.21
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.1
KOG0287|consensus 442 98.09
KOG2177|consensus 386 98.04
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.99
KOG1002|consensus 791 97.8
KOG0006|consensus 446 97.76
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.61
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.61
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.51
KOG0824|consensus 324 97.31
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.26
KOG4628|consensus348 97.2
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.16
COG5152259 Uncharacterized conserved protein, contains RING a 97.1
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.03
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.01
KOG1645|consensus 463 96.89
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.88
KOG1039|consensus344 96.86
KOG2879|consensus298 96.84
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.77
KOG1428|consensus 3738 96.77
KOG4159|consensus 398 96.7
KOG0311|consensus 381 96.54
KOG0826|consensus357 96.22
KOG2660|consensus 331 96.09
KOG0802|consensus 543 96.04
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.02
KOG4265|consensus349 96.01
KOG4692|consensus489 95.92
KOG2817|consensus394 95.57
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 95.56
KOG4185|consensus 296 95.2
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.16
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 95.05
PF04641260 Rtf2: Rtf2 RING-finger 95.02
KOG1785|consensus 563 94.9
KOG1001|consensus 674 94.78
KOG1813|consensus313 94.25
KOG0828|consensus636 94.19
KOG4739|consensus 233 94.14
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.13
KOG1734|consensus328 93.75
PHA03096284 p28-like protein; Provisional 93.49
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 92.99
KOG0297|consensus 391 92.59
KOG0827|consensus 465 92.58
KOG4172|consensus62 92.33
KOG4367|consensus 699 92.13
KOG1952|consensus 950 91.41
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.76
KOG4445|consensus 368 90.63
KOG3002|consensus 299 90.31
KOG0804|consensus 493 89.68
KOG2034|consensus911 89.51
KOG3970|consensus 299 89.1
KOG3039|consensus303 88.81
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 88.79
KOG3579|consensus352 88.56
KOG3800|consensus 300 88.39
KOG1941|consensus518 88.07
PF1444557 Prok-RING_2: Prokaryotic RING finger family 2 87.61
COG52191525 Uncharacterized conserved protein, contains RING Z 87.58
KOG3161|consensus 861 87.41
COG5222427 Uncharacterized conserved protein, contains RING Z 87.34
KOG0825|consensus 1134 87.32
COG5109396 Uncharacterized conserved protein, contains RING Z 86.79
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.67
KOG4275|consensus350 86.39
KOG1493|consensus84 86.36
KOG3268|consensus234 85.78
KOG2979|consensus262 84.36
KOG3053|consensus 293 80.63
>KOG1815|consensus Back     alignment and domain information 
Probab=99.66  E-value=4.9e-17  Score=127.37  Aligned_cols=114  Identities=37%  Similarity=0.598  Sum_probs=88.4

Q ss_pred             cccCCChhHHHHHcCcCCCCCCC---CCC--CCCCccccccccccCCCCCcccCCCCccchHHHHHHHHHHHhhhcCCce
Q psy7604           3 RYYDGDQEQLFAEARVINPLVKN---SQP--STSSKSKCEICFTNMPSTLMTGLECSHRFCTQCWCEYLTTKIIQEGMGQ   77 (118)
Q Consensus         3 ~y~~~~~~~~~~~~gl~~~~~~~---~~~--~~~~~~~C~IC~~~~~~~~~~~l~CgH~fC~~C~~~y~~~~i~~~g~~~   77 (118)
                      .+|.||.++++.+..-.......   ...  ......+|+||++.++. .+..+.|||.||..||..|+..+|. +|...
T Consensus        35 ~~~~W~~~kl~~~~~~~~~~~~~~~g~~~~~~~~~~~~c~ic~~~~~~-~~~~~~c~H~~c~~cw~~yl~~kI~-~~~~~  112 (444)
T KOG1815|consen   35 AHFCWNVEKLLEEWVEDEETGCFFVGLLLWPKKKGDVQCGICVESYDG-EIIGLGCGHPFCPPCWTGYLGTKIH-EGEEA  112 (444)
T ss_pred             HhcCcchHHHHHHHHhcCcchhhhccccccCCCCccccCCcccCCCcc-hhhhcCCCcHHHHHHHHHHhhheee-ccccc
Confidence            45677777777765421111100   011  23567899999999854 6788899999999999999999996 55544


Q ss_pred             eeecCCccccccccHHHHhcccCChHHHHHHHHHHHhcccC
Q psy7604          78 TIACAAHGCNILVDDGTVMRLVRDPKVKLKYQHLITNSFVE  118 (118)
Q Consensus        78 ~i~CP~~~C~~~i~~~~i~~ll~~~~~~~ky~~~~~~~yve  118 (118)
                      .|+||..+|...+..++|..++++++..++|+++++++|||
T Consensus       113 ~i~cp~~~C~a~v~~~~i~~~~s~~~~~~ky~~~i~~syve  153 (444)
T KOG1815|consen  113 KIKCPAHGCPALVGEDTVEKLVSDKEDKEKYQRYILRSYVE  153 (444)
T ss_pred             cccCCCCCccccCCCceeeeecCCHHHHHHHHHHHHHHHHh
Confidence            49999999999999999999998545899999999999996

>KOG1814|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF14445 Prok-RING_2: Prokaryotic RING finger family 2 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG2979|consensus Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 5e-14
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
 Score = 61.8 bits (150), Expect = 5e-14
 Identities = 22/91 (24%), Positives = 39/91 (42%), Gaps = 5/91 (5%)

Query: 31  SSKSKCEICFTNMPSTLMTGL-ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCN-- 87
           S  S C++C    P   MT + +C   FCT C  +Y+    I+EG+   I+C    C   
Sbjct: 3   SGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELL-IKEGLETAISCPDAACPKQ 61

Query: 88  ILVDDGTVMRLVRDPKVKLKYQHLITNSFVE 118
             + +  +  +V   ++  +Y+ L       
Sbjct: 62  GHLQENEIECMV-AAEIMQRYKKLQFERSGP 91

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 99.91
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.17
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.14
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.1
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.04
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.03
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.03
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.03
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.03
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.01
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.0
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.99
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.98
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.97
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.97
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.93
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.92
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.92
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.92
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.89
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.87
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.85
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.82
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.81
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.81
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.81
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.8
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.8
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.79
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.79
2ect_A78 Ring finger protein 126; metal binding protein, st 98.78
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.77
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.74
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.74
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.73
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.72
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.71
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.7
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.7
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.7
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.68
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.68
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.67
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.66
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.65
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.59
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.48
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.45
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.38
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.37
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.28
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.23
2ea5_A68 Cell growth regulator with ring finger domain prot 98.2
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.2
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.19
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.13
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.05
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.8
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.61
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.54
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.5
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.1
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.98
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.37
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 96.25
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.09
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 92.0
3nw0_A238 Non-structural maintenance of chromosomes element 91.39
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 81.56
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 80.44
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
Probab=99.91  E-value=8.6e-25  Score=137.21  Aligned_cols=86  Identities=26%  Similarity=0.570  Sum_probs=75.9

Q ss_pred             CCccccccccccCCCCCcccC-CCCccchHHHHHHHHHHHhhhcCCceeeecCCcccccc--ccHHHHhcccCChHHHHH
Q psy7604          31 SSKSKCEICFTNMPSTLMTGL-ECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNIL--VDDGTVMRLVRDPKVKLK  107 (118)
Q Consensus        31 ~~~~~C~IC~~~~~~~~~~~l-~CgH~fC~~C~~~y~~~~i~~~g~~~~i~CP~~~C~~~--i~~~~i~~ll~~~~~~~k  107 (118)
                      ++.++|+||+++++..+++.+ +|||.||++||++|+..+|. +|....++||..+|+..  ++++.|+.+++ +++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~~~~l~~CgH~FC~~Cl~~~~~~~i~-~g~~~~i~CP~~~C~~~~~~~~~~i~~ll~-~~~~~k   80 (94)
T 1wim_A            3 SGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIK-EGLETAISCPDAACPKQGHLQENEIECMVA-AEIMQR   80 (94)
T ss_dssp             CSBCCCSSSCCCCBGGGEEEETTTTEEEEHHHHHHHHHHHHH-HCSCCCEECSCTTCSSCCEECHHHHHHHSC-HHHHHH
T ss_pred             CCCcCCcccCcccccccceEcCCCCCcccHHHHHHHHHHHhh-cCCcccccCccccCCCCCccCHHHHHHHCC-HHHHHH
Confidence            357899999999865556555 69999999999999999996 67656799999999999  99999999997 789999


Q ss_pred             HHHHHHhcccC
Q psy7604         108 YQHLITNSFVE  118 (118)
Q Consensus       108 y~~~~~~~yve  118 (118)
                      |+++++++||+
T Consensus        81 y~~~~~~~~v~   91 (94)
T 1wim_A           81 YKKLQFERSGP   91 (94)
T ss_dssp             HHHHHHHSSCS
T ss_pred             HHHHHHHhhhc
Confidence            99999999986
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 4e-11
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.2 bits (127), Expect = 4e-11
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 5/92 (5%)

Query: 30  TSSKSKCEICFTNMPSTLMTGLE-CSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGC-- 86
           +S  S C++C    P   MT +  C   FCT C  +Y+    I+EG+   I+C    C  
Sbjct: 2   SSGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELL-IKEGLETAISCPDAACPK 60

Query: 87  NILVDDGTVMRLVRDPKVKLKYQHLITNSFVE 118
              + +  +  +V   ++  +Y+ L       
Sbjct: 61  QGHLQENEIECMV-AAEIMQRYKKLQFERSGP 91

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 99.88
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.15
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.07
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.01
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.97
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.92
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.91
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.78
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.77
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.72
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.7
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.69
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.58
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.24
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.23
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.98
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 96.41
d2d8va154 Zinc finger FYVE domain-containing protein 19 {Mou 89.06
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 87.64
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 83.41
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: UbcM4-interacting protein 4 (KIAA0161)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=2.2e-23  Score=129.32  Aligned_cols=86  Identities=26%  Similarity=0.554  Sum_probs=74.0

Q ss_pred             CCccccccccccCCCCCccc-CCCCccchHHHHHHHHHHHhhhcCCceeeecCCccccc--cccHHHHhcccCChHHHHH
Q psy7604          31 SSKSKCEICFTNMPSTLMTG-LECSHRFCTQCWCEYLTTKIIQEGMGQTIACAAHGCNI--LVDDGTVMRLVRDPKVKLK  107 (118)
Q Consensus        31 ~~~~~C~IC~~~~~~~~~~~-l~CgH~fC~~C~~~y~~~~i~~~g~~~~i~CP~~~C~~--~i~~~~i~~ll~~~~~~~k  107 (118)
                      +....|+||+++++.++++. +.|||.||.+||+.|++++|+ +|.+..|+||..+|+.  .+++.+|+.+++ +++++|
T Consensus         3 ~~~~~C~IC~~~~~~~~~~~~~~C~H~fC~~Cl~~~~~~~i~-~~~~~~i~CP~~~C~~~~~~~~~~i~~ll~-~~~~~k   80 (94)
T d1wima_           3 SGSSGCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQYVELLIK-EGLETAISCPDAACPKQGHLQENEIECMVA-AEIMQR   80 (94)
T ss_dssp             CSBCCCSSSCCCCBGGGEEEETTTTEEEEHHHHHHHHHHHHH-HCSCCCEECSCTTCSSCCEECHHHHHHHSC-HHHHHH
T ss_pred             CCCCcCccCCCcccCCceEEECCCCCEeCCcCHHHHHHHHHh-cCCccccCCcCCCCCCCcccCHHHHHHhCC-HHHHHH
Confidence            35678999999987666654 589999999999999999996 6766789999988865  688999999996 789999


Q ss_pred             HHHHHHhcccC
Q psy7604         108 YQHLITNSFVE  118 (118)
Q Consensus       108 y~~~~~~~yve  118 (118)
                      |+++++++.+.
T Consensus        81 y~~~~l~~~~~   91 (94)
T d1wima_          81 YKKLQFERSGP   91 (94)
T ss_dssp             HHHHHHHSSCS
T ss_pred             HHHHHHHhccc
Confidence            99999998763
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8va1 g.43.1.1 (A:8-61) Zinc finger FYVE domain-containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure