Psyllid ID: psy7649
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| 260791285 | 1115 | hypothetical protein BRAFLDRAFT_125550 [ | 0.59 | 0.052 | 0.616 | 4e-13 | |
| 449682416 | 369 | PREDICTED: hydroxyacid oxidase 1-like [H | 0.51 | 0.138 | 0.666 | 2e-12 | |
| 390335593 | 375 | PREDICTED: hydroxyacid oxidase 1-like [S | 0.55 | 0.146 | 0.6 | 2e-12 | |
| 260824425 | 374 | hypothetical protein BRAFLDRAFT_57337 [B | 0.54 | 0.144 | 0.629 | 2e-12 | |
| 291224809 | 443 | PREDICTED: hydroxyacid oxidase 1-like [S | 0.49 | 0.110 | 0.693 | 3e-12 | |
| 299115220 | 394 | Glycolate Oxidase [Ectocarpus siliculosu | 0.5 | 0.126 | 0.68 | 4e-12 | |
| 260786697 | 302 | hypothetical protein BRAFLDRAFT_199062 [ | 0.54 | 0.178 | 0.629 | 8e-12 | |
| 6453563 | 239 | glycolate oxidase [Laminaria digitata] | 0.56 | 0.234 | 0.625 | 1e-11 | |
| 340383151 | 368 | PREDICTED: hydroxyacid oxidase 1-like [A | 0.7 | 0.190 | 0.528 | 1e-11 | |
| 325192617 | 379 | peroxisomal (S)2hydroxyacid oxidase puta | 0.55 | 0.145 | 0.563 | 1e-11 |
| >gi|260791285|ref|XP_002590670.1| hypothetical protein BRAFLDRAFT_125550 [Branchiostoma floridae] gi|229275866|gb|EEN46681.1| hypothetical protein BRAFLDRAFT_125550 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
Score = 78.6 bits (192), Expect = 4e-13, Method: Composition-based stats.
Identities = 37/60 (61%), Positives = 47/60 (78%), Gaps = 1/60 (1%)
Query: 2 EVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSLVHKILPEAVA 61
EVYLDGG+R GTDV KA+ LGA+ VF+GR ALWGLAH+G+ G +VLQ L + L +A+A
Sbjct: 280 EVYLDGGVRTGTDVLKALALGARCVFIGRPALWGLAHNGAEGVQQVLQILTEE-LSQAMA 338
|
Source: Branchiostoma floridae Species: Branchiostoma floridae Genus: Branchiostoma Family: Branchiostomidae Order: Class: Phylum: Chordata Superkingdom: Eukaryota |
| >gi|449682416|ref|XP_002166250.2| PREDICTED: hydroxyacid oxidase 1-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|390335593|ref|XP_791249.3| PREDICTED: hydroxyacid oxidase 1-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|260824425|ref|XP_002607168.1| hypothetical protein BRAFLDRAFT_57337 [Branchiostoma floridae] gi|229292514|gb|EEN63178.1| hypothetical protein BRAFLDRAFT_57337 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|291224809|ref|XP_002732395.1| PREDICTED: hydroxyacid oxidase 1-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|299115220|emb|CBN74053.1| Glycolate Oxidase [Ectocarpus siliculosus] | Back alignment and taxonomy information |
|---|
| >gi|260786697|ref|XP_002588393.1| hypothetical protein BRAFLDRAFT_199062 [Branchiostoma floridae] gi|229273555|gb|EEN44404.1| hypothetical protein BRAFLDRAFT_199062 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|6453563|emb|CAB61335.1| glycolate oxidase [Laminaria digitata] | Back alignment and taxonomy information |
|---|
| >gi|340383151|ref|XP_003390081.1| PREDICTED: hydroxyacid oxidase 1-like [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|325192617|emb|CCA27043.1| peroxisomal (S)2hydroxyacid oxidase putative [Albugo laibachii Nc14] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 100 | ||||||
| UNIPROTKB|E1BRR7 | 369 | HAO1 "Uncharacterized protein" | 0.51 | 0.138 | 0.607 | 4.9e-12 | |
| UNIPROTKB|E1C0E1 | 373 | HAO2 "Uncharacterized protein" | 0.51 | 0.136 | 0.647 | 5.1e-12 | |
| UNIPROTKB|Q3ZBW2 | 353 | HAO2 "Hydroxyacid oxidase 2" [ | 0.51 | 0.144 | 0.647 | 7.2e-12 | |
| ZFIN|ZDB-GENE-040426-1239 | 378 | hao2 "hydroxyacid oxidase 2 (l | 0.52 | 0.137 | 0.566 | 1.1e-11 | |
| UNIPROTKB|F1PEF7 | 389 | HAO2 "Uncharacterized protein" | 0.48 | 0.123 | 0.666 | 2.5e-11 | |
| UNIPROTKB|F1SAZ7 | 353 | LOC100522133 "Uncharacterized | 0.51 | 0.144 | 0.647 | 2.6e-11 | |
| UNIPROTKB|F6XM23 | 370 | HAO1 "Uncharacterized protein" | 0.51 | 0.137 | 0.588 | 3.8e-11 | |
| UNIPROTKB|I3LVF1 | 370 | HAO1 "Uncharacterized protein" | 0.51 | 0.137 | 0.607 | 3.8e-11 | |
| MGI|MGI:96011 | 370 | Hao1 "hydroxyacid oxidase 1, l | 0.51 | 0.137 | 0.607 | 3.8e-11 | |
| UNIPROTKB|E1BC79 | 371 | HAO1 "Uncharacterized protein" | 0.51 | 0.137 | 0.607 | 3.8e-11 |
| UNIPROTKB|E1BRR7 HAO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 168 (64.2 bits), Expect = 4.9e-12, P = 4.9e-12
Identities = 31/51 (60%), Positives = 38/51 (74%)
Query: 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSL 51
+EV+LDGGIR GTD+ KA+ LGAK VF+GR +WGL + G GA VLQ L
Sbjct: 285 VEVFLDGGIRKGTDILKALALGAKAVFIGRPLIWGLVYQGEEGAKEVLQML 335
|
|
| UNIPROTKB|E1C0E1 HAO2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBW2 HAO2 "Hydroxyacid oxidase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1239 hao2 "hydroxyacid oxidase 2 (long chain)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PEF7 HAO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SAZ7 LOC100522133 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XM23 HAO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVF1 HAO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96011 Hao1 "hydroxyacid oxidase 1, liver" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BC79 HAO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 100 | |||
| cd02809 | 299 | cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom | 8e-22 | |
| pfam01070 | 302 | pfam01070, FMN_dh, FMN-dependent dehydrogenase | 1e-21 | |
| cd02922 | 344 | cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-b | 2e-17 | |
| TIGR03966 | 385 | TIGR03966, actino_HemFlav, heme/flavin dehydrogena | 1e-14 | |
| COG1304 | 360 | COG1304, idi, Isopentenyl diphosphate isomerase (B | 8e-14 | |
| PLN02535 | 364 | PLN02535, PLN02535, glycolate oxidase | 2e-13 | |
| cd03332 | 383 | cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) | 1e-12 | |
| PLN02979 | 366 | PLN02979, PLN02979, glycolate oxidase | 4e-12 | |
| cd04736 | 361 | cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li | 5e-12 | |
| PLN02493 | 367 | PLN02493, PLN02493, probable peroxisomal (S)-2-hyd | 6e-12 | |
| cd04737 | 351 | cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN | 2e-11 | |
| PRK11197 | 381 | PRK11197, lldD, L-lactate dehydrogenase; Provision | 2e-07 | |
| TIGR02708 | 367 | TIGR02708, L_lactate_ox, L-lactate oxidase | 2e-07 | |
| PRK05437 | 352 | PRK05437, PRK05437, isopentenyl pyrophosphate isom | 7e-06 | |
| COG0069 | 485 | COG0069, GltB, Glutamate synthase domain 2 [Amino | 3e-05 | |
| cd02808 | 392 | cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-b | 9e-05 | |
| pfam01645 | 367 | pfam01645, Glu_synthase, Conserved region in gluta | 2e-04 | |
| TIGR02151 | 333 | TIGR02151, IPP_isom_2, isopentenyl-diphosphate del | 8e-04 | |
| pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductas | 0.001 |
| >gnl|CDD|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
Score = 86.0 bits (214), Expect = 8e-22
Identities = 30/51 (58%), Positives = 35/51 (68%)
Query: 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSL 51
+EV LDGGIR GTDV KA+ LGA V +GR L+GLA G G A VL+ L
Sbjct: 228 IEVLLDGGIRRGTDVLKALALGADAVLIGRPFLYGLAAGGEAGVAHVLEIL 278
|
This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO). In green plants, glycolate oxidase is one of the key enzymes in photorespiration where it oxidizes glycolate to glyoxylate. LMO catalyzes the oxidation of L-lactate to acetate and carbon dioxide. MDH oxidizes (S)-mandelate to phenylglyoxalate. It is an enzyme in the mandelate pathway that occurs in several strains of Pseudomonas which converts (R)-mandelate to benzoate. Length = 299 |
| >gnl|CDD|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239238 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|188481 TIGR03966, actino_HemFlav, heme/flavin dehydrogenase, mycofactocin system | Back alignment and domain information |
|---|
| >gnl|CDD|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215294 PLN02535, PLN02535, glycolate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|239448 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|166620 PLN02979, PLN02979, glycolate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|240088 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131755 TIGR02708, L_lactate_ox, L-lactate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|235465 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223147 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239202 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|233750 TIGR02151, IPP_isom_2, isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 99.86 | |
| KOG0538|consensus | 363 | 99.82 | ||
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 99.82 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 99.81 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 99.81 | |
| PLN02979 | 366 | glycolate oxidase | 99.81 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 99.8 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 99.8 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 99.79 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 99.77 | |
| PLN02535 | 364 | glycolate oxidase | 99.76 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 99.75 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 99.75 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 99.7 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 99.69 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 99.67 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 99.66 | |
| PF01645 | 368 | Glu_synthase: Conserved region in glutamate syntha | 99.64 | |
| COG0069 | 485 | GltB Glutamate synthase domain 2 [Amino acid trans | 99.6 | |
| PRK11750 | 1485 | gltB glutamate synthase subunit alpha; Provisional | 99.43 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 99.33 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 99.26 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 99.16 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 99.08 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.06 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 99.01 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 98.98 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 98.98 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 98.95 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 98.95 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 98.94 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.91 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 98.89 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 98.86 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 98.78 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.7 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 98.63 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 98.61 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 98.48 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 98.46 | |
| COG2070 | 336 | Dioxygenases related to 2-nitropropane dioxygenase | 98.44 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 98.38 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.37 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 98.35 | |
| PF03060 | 330 | NMO: Nitronate monooxygenase; InterPro: IPR004136 | 98.31 | |
| KOG0399|consensus | 2142 | 98.26 | ||
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 98.25 | |
| KOG2550|consensus | 503 | 98.08 | ||
| cd04742 | 418 | NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom | 98.07 | |
| TIGR02814 | 444 | pfaD_fam PfaD family protein. The protein PfaD is | 98.05 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 97.93 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 97.91 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 97.9 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 97.84 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 97.8 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 97.79 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 97.79 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 97.78 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 97.75 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 97.72 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 97.66 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 97.62 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 97.61 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 97.61 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 97.58 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 97.55 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 97.5 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 97.39 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 97.36 | |
| cd04743 | 320 | NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma | 97.32 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 97.31 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.3 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.28 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 97.27 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.27 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.22 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 97.2 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 97.14 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 97.13 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.13 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 97.1 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 97.09 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.08 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.08 | |
| cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN | 97.08 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 97.05 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 97.04 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 97.02 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 97.0 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.0 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.99 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 96.98 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 96.97 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 96.97 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 96.93 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 96.92 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 96.91 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.9 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 96.9 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 96.9 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 96.89 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 96.86 | |
| PLN02591 | 250 | tryptophan synthase | 96.85 | |
| PF01884 | 230 | PcrB: PcrB family; InterPro: IPR008205 This entry | 96.8 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 96.78 | |
| KOG1436|consensus | 398 | 96.7 | ||
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 96.65 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 96.64 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 96.55 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.54 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 96.53 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 96.51 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 96.47 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 96.46 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 96.44 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 96.39 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 96.38 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 96.34 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 96.32 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 96.24 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.23 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.19 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 96.18 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 96.13 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 96.13 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.12 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 96.11 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 96.07 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 96.03 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 96.03 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 96.02 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 96.01 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 96.0 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 95.99 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 95.98 | |
| PLN02334 | 229 | ribulose-phosphate 3-epimerase | 95.92 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 95.89 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 95.88 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 95.84 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 95.49 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 95.45 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 95.4 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 95.39 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 95.36 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 95.33 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 95.27 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 95.22 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 95.13 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 95.12 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 95.05 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 94.99 | |
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 94.97 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 94.82 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 94.79 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 94.67 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 94.61 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 94.6 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 94.59 | |
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 94.36 | |
| PRK07226 | 267 | fructose-bisphosphate aldolase; Provisional | 94.08 | |
| cd00429 | 211 | RPE Ribulose-5-phosphate 3-epimerase (RPE). This e | 93.96 | |
| TIGR01163 | 210 | rpe ribulose-phosphate 3-epimerase. This family co | 93.77 | |
| COG0159 | 265 | TrpA Tryptophan synthase alpha chain [Amino acid t | 93.76 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 93.76 | |
| PRK08883 | 220 | ribulose-phosphate 3-epimerase; Provisional | 93.7 | |
| PRK07028 | 430 | bifunctional hexulose-6-phosphate synthase/ribonuc | 93.6 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 93.6 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 93.4 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 93.4 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 93.35 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 93.35 | |
| PF00290 | 259 | Trp_syntA: Tryptophan synthase alpha chain; InterP | 93.24 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 93.12 | |
| PRK05581 | 220 | ribulose-phosphate 3-epimerase; Validated | 93.09 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 92.99 | |
| TIGR00126 | 211 | deoC deoxyribose-phosphate aldolase. Deoxyribose-p | 92.94 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 92.91 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 92.89 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 92.88 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 92.72 | |
| PRK11750 | 1485 | gltB glutamate synthase subunit alpha; Provisional | 92.42 | |
| PRK13307 | 391 | bifunctional formaldehyde-activating enzyme/3-hexu | 92.12 | |
| COG1646 | 240 | Predicted phosphate-binding enzymes, TIM-barrel fo | 92.07 | |
| PF04309 | 175 | G3P_antiterm: Glycerol-3-phosphate responsive anti | 92.03 | |
| TIGR01949 | 258 | AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep | 91.84 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 91.52 | |
| KOG2335|consensus | 358 | 91.28 | ||
| PLN02460 | 338 | indole-3-glycerol-phosphate synthase | 91.2 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 90.97 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 90.92 | |
| COG0214 | 296 | SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta | 90.89 | |
| cd00956 | 211 | Transaldolase_FSA Transaldolase-like fructose-6-ph | 90.59 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 90.59 | |
| KOG1606|consensus | 296 | 90.49 | ||
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 90.03 | |
| PRK03903 | 274 | transaldolase; Provisional | 89.77 | |
| cd00405 | 203 | PRAI Phosphoribosylanthranilate isomerase (PRAI) c | 89.58 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 89.41 | |
| PRK02615 | 347 | thiamine-phosphate pyrophosphorylase; Provisional | 89.3 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 88.98 | |
| PRK06512 | 221 | thiamine-phosphate pyrophosphorylase; Provisional | 88.91 | |
| PRK12376 | 236 | putative translaldolase; Provisional | 88.88 | |
| PRK13813 | 215 | orotidine 5'-phosphate decarboxylase; Provisional | 87.79 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 87.35 | |
| PTZ00170 | 228 | D-ribulose-5-phosphate 3-epimerase; Provisional | 86.9 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 86.57 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 86.39 | |
| PF01791 | 236 | DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 | 86.19 | |
| COG0274 | 228 | DeoC Deoxyribose-phosphate aldolase [Nucleotide tr | 85.64 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 85.19 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 85.11 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 85.11 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 85.0 | |
| PRK12655 | 220 | fructose-6-phosphate aldolase; Reviewed | 84.54 | |
| TIGR00875 | 213 | fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ | 84.09 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 83.78 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 83.69 | |
| PRK12653 | 220 | fructose-6-phosphate aldolase; Reviewed | 83.6 | |
| PRK01362 | 214 | putative translaldolase; Provisional | 82.97 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 82.69 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 82.55 | |
| PF02662 | 124 | FlpD: Methyl-viologen-reducing hydrogenase, delta | 82.4 | |
| PLN02898 | 502 | HMP-P kinase/thiamin-monophosphate pyrophosphoryla | 82.09 | |
| PRK12656 | 222 | fructose-6-phosphate aldolase; Reviewed | 81.29 | |
| PRK08745 | 223 | ribulose-phosphate 3-epimerase; Provisional | 81.23 | |
| PF04898 | 287 | Glu_syn_central: Glutamate synthase central domain | 80.22 |
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.86 E-value=5.9e-22 Score=156.13 Aligned_cols=75 Identities=39% Similarity=0.537 Sum_probs=71.9
Q ss_pred CeEEEcCCCCChHHHHHHHHhCcchHhhhHHHHHHHhccCHHHHHHHHHHHHHHHhHHHHhcccccHHHhhHHHH
Q psy7649 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSLVHKILPEAVADKVHNAYSIFFLEL 75 (100)
Q Consensus 1 i~liasGGIr~g~Di~KAlALGAd~v~ig~~~L~al~~~g~~gv~~~i~~l~~el~~~m~l~g~~n~~~l~~~e~ 75 (100)
++|++|||||+|.||+||||||||+|++|||||++++..|++||.+.++.+++||+..|+++|++|+.++...++
T Consensus 274 ~~vi~dGGiR~G~Dv~KAlALGA~~v~igrp~L~~l~~~g~~GV~~~le~~~~El~~~M~L~G~~~i~el~~~~l 348 (360)
T COG1304 274 IEVIADGGIRSGLDVAKALALGADAVGIGRPFLYGLAAGGEAGVERVLEIIRKELKIAMALTGAKNIEELKRVPL 348 (360)
T ss_pred eEEEecCCCCCHHHHHHHHHhCCchhhhhHHHHHHHHhccHHHHHHHHHHHHHHHHHHHHhcCCCcHHHhccCce
Confidence 479999999999999999999999999999999999999999999999999999999999999999999987654
|
|
| >KOG0538|consensus | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] | Back alignment and domain information |
|---|
| >COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11750 gltB glutamate synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 | Back alignment and domain information |
|---|
| >KOG0399|consensus | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD | Back alignment and domain information |
|---|
| >TIGR02814 pfaD_fam PfaD family protein | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >KOG1436|consensus | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >PLN02334 ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >PRK07226 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >TIGR01163 rpe ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK08883 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05581 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >TIGR00126 deoC deoxyribose-phosphate aldolase | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK11750 gltB glutamate synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family | Back alignment and domain information |
|---|
| >TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >KOG2335|consensus | Back alignment and domain information |
|---|
| >PLN02460 indole-3-glycerol-phosphate synthase | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >KOG1606|consensus | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK03903 transaldolase; Provisional | Back alignment and domain information |
|---|
| >cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK02615 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK12376 putative translaldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13813 orotidine 5'-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism | Back alignment and domain information |
|---|
| >COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK12655 fructose-6-phosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK12653 fructose-6-phosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK01362 putative translaldolase; Provisional | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PF02662 FlpD: Methyl-viologen-reducing hydrogenase, delta subunit; InterPro: IPR003813 Methyl-viologen-reducing hydrogenase (MVH) is one of the enzymes involved in methanogenesis and coded in the mth-flp-mvh-mrt cluster of methane genes in Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) [] | Back alignment and domain information |
|---|
| >PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK12656 fructose-6-phosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK08745 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PF04898 Glu_syn_central: Glutamate synthase central domain; InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 100 | ||||
| 1tb3_A | 352 | Crystal Structure Analysis Of Recombinant Rat Kidne | 3e-12 | ||
| 3sgz_A | 352 | High Resolution Crystal Structure Of Rat Long Chain | 3e-12 | ||
| 2w0u_A | 370 | Crystal Structure Of Human Glycolate Oxidase In Com | 3e-12 | ||
| 2nzl_A | 392 | Crystal Structure Of Human Hydroxyacid Oxidase 1 Le | 3e-12 | ||
| 2rdt_A | 387 | Crystal Structure Of Human Glycolate Oxidase (Go) I | 5e-12 | ||
| 1gyl_A | 369 | Involvement Of Tyr24 And Trp108 In Substrate Bindin | 1e-09 | ||
| 1gox_A | 370 | Refined Structure Of Spinach Glycolate Oxidase At 2 | 1e-09 | ||
| 1al7_A | 359 | Three-Dimensional Structures Of Glycolate Oxidase W | 1e-09 | ||
| 2cdh_0 | 226 | Architecture Of The Thermomyces Lanuginosus Fungal | 1e-09 | ||
| 2oz0_A | 511 | Mechanistic And Structural Studies Of H373q Flavocy | 1e-07 | ||
| 1kbj_A | 412 | Crystallographic Study Of The Recombinant Flavin-Bi | 1e-07 | ||
| 1qcw_A | 410 | Flavocytochrome B2, Arg289lys Mutant Length = 410 | 1e-07 | ||
| 1ldc_A | 511 | X-Ray Structure Of Two Complexes Of The Y143f Flavo | 1e-07 | ||
| 1fcb_A | 511 | Molecular Structure Of Flavocytochrome B2 At 2.4 An | 1e-07 | ||
| 1sze_A | 511 | L230a Mutant Flavocytochrome B2 With Benzoylformate | 1e-07 | ||
| 1szf_A | 511 | A198g:l230a Mutant Flavocytochrome B2 With Pyruvate | 1e-07 | ||
| 1ltd_A | 506 | The 2.6 Angstroms Refined Structure Of The Escheric | 1e-07 | ||
| 2a7n_A | 380 | Crystal Structure Of The G81a Mutant Of The Active | 3e-07 | ||
| 1huv_A | 380 | Crystal Structure Of A Soluble Mutant Of The Membra | 3e-07 |
| >pdb|1TB3|A Chain A, Crystal Structure Analysis Of Recombinant Rat Kidney Long- Chain Hydroxy Acid Oxidase Length = 352 | Back alignment and structure |
|
| >pdb|3SGZ|A Chain A, High Resolution Crystal Structure Of Rat Long Chain Hydroxy Acid Oxidase In Complex With The Inhibitor 4-Carboxy-5-[(4-Chiorophenyl) Sulfanyl]-1, 2, 3-Thiadiazole. Length = 352 | Back alignment and structure |
| >pdb|2W0U|A Chain A, Crystal Structure Of Human Glycolate Oxidase In Complex With The Inhibitor 5-[(4-Chlorophenyl)sulfanyl]- 1,2,3-Thiadiazole-4-Carboxylate. Length = 370 | Back alignment and structure |
| >pdb|2NZL|A Chain A, Crystal Structure Of Human Hydroxyacid Oxidase 1 Length = 392 | Back alignment and structure |
| >pdb|2RDT|A Chain A, Crystal Structure Of Human Glycolate Oxidase (Go) In Complex With Cdst Length = 387 | Back alignment and structure |
| >pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase Length = 369 | Back alignment and structure |
| >pdb|1GOX|A Chain A, Refined Structure Of Spinach Glycolate Oxidase At 2 Angstroms Resolution Length = 370 | Back alignment and structure |
| >pdb|1AL7|A Chain A, Three-Dimensional Structures Of Glycolate Oxidase With Bound Active- Site Inhibitors Length = 359 | Back alignment and structure |
| >pdb|2CDH|0 Chain 0, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 226 | Back alignment and structure |
| >pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 | Back alignment and structure |
| >pdb|1KBJ|A Chain A, Crystallographic Study Of The Recombinant Flavin-Binding Domain Of Baker's Yeast Flavocytochrome B2: Comparison With The Intact Wild- Type Enzyme Length = 412 | Back alignment and structure |
| >pdb|1QCW|A Chain A, Flavocytochrome B2, Arg289lys Mutant Length = 410 | Back alignment and structure |
| >pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 | Back alignment and structure |
| >pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 | Back alignment and structure |
| >pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 | Back alignment and structure |
| >pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 | Back alignment and structure |
| >pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 | Back alignment and structure |
| >pdb|2A7N|A Chain A, Crystal Structure Of The G81a Mutant Of The Active Chimera Of (S)- Mandelate Dehydrogenase Length = 380 | Back alignment and structure |
| >pdb|1HUV|A Chain A, Crystal Structure Of A Soluble Mutant Of The Membrane-Associated (S)- Mandelate Dehydrogenase From Pseudomonas Putida At 2.15a Resolution Length = 380 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 100 | |||
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 1e-23 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 5e-23 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 7e-23 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 8e-23 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 9e-23 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 6e-22 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 8e-17 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 4e-16 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 7e-13 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 8e-12 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 9e-04 |
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Length = 352 | Back alignment and structure |
|---|
Score = 91.0 bits (227), Expect = 1e-23
Identities = 29/51 (56%), Positives = 37/51 (72%)
Query: 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSL 51
+EVY+DGG+R GTDV KA+ LGA+ +F+GR LWGLA G +G VL L
Sbjct: 273 IEVYMDGGVRTGTDVLKALALGARCIFLGRPILWGLACKGEDGVKEVLDIL 323
|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Length = 368 | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Length = 392 | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Length = 370 | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Length = 380 | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Length = 365 | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349 | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Length = 368 | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332 | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Length = 361 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 99.75 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 99.74 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 99.7 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 99.68 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 99.66 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 99.65 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 99.64 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 99.6 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 99.59 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 99.57 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 99.55 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 99.51 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.49 | |
| 1ofd_A | 1520 | Ferredoxin-dependent glutamate synthase 2; oxidore | 99.45 | |
| 1ea0_A | 1479 | Glutamate synthase [NADPH] large chain; oxidoreduc | 99.44 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.38 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 99.36 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 99.34 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.32 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.3 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.28 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.26 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.05 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.03 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 98.94 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.92 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 98.9 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.88 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.83 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 98.74 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 98.71 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 98.69 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 98.69 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 98.67 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 98.65 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 98.65 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 98.65 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 98.52 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 98.52 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 98.43 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 98.38 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 98.35 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 98.31 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 98.26 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 97.96 | |
| 1rd5_A | 262 | Tryptophan synthase alpha chain, chloroplast; hydr | 97.85 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 97.84 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 97.81 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 97.79 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 97.77 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 97.76 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 97.76 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 97.71 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 97.66 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 97.66 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 97.64 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 97.58 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 97.57 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 97.48 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 97.39 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 97.38 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 97.35 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 97.33 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 97.32 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 97.32 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 97.32 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 97.31 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 97.24 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 97.22 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.22 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 97.2 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 97.18 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 97.17 | |
| 3kts_A | 192 | Glycerol uptake operon antiterminator regulatory; | 97.15 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 97.1 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 97.1 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 97.07 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 97.04 | |
| 3vzx_A | 228 | Heptaprenylglyceryl phosphate synthase; biosynthes | 96.96 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 96.92 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 96.91 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 96.9 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 96.89 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 96.87 | |
| 3tha_A | 252 | Tryptophan synthase alpha chain; structural genomi | 96.8 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 96.78 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 96.78 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 96.76 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 96.75 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 96.72 | |
| 1vkf_A | 188 | Glycerol uptake operon antiterminator-related Pro; | 96.7 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 96.7 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 96.64 | |
| 2yzr_A | 330 | Pyridoxal biosynthesis lyase PDXS; redox protein, | 96.56 | |
| 2czd_A | 208 | Orotidine 5'-phosphate decarboxylase; pyrimidine b | 96.47 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 96.47 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 96.41 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 96.37 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 96.37 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 96.37 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 96.37 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 96.37 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 96.35 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 96.33 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 96.32 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 96.31 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 96.25 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 96.18 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 96.12 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 96.09 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 96.08 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 96.08 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 96.07 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 96.07 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 96.06 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 96.06 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 96.02 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 96.02 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 96.0 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 96.0 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 95.97 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 95.9 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 95.87 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 95.84 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 95.75 | |
| 3w01_A | 235 | Heptaprenylglyceryl phosphate synthase; biosynthes | 95.68 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 95.51 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 95.47 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 95.37 | |
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 95.16 | |
| 2h6r_A | 219 | Triosephosphate isomerase; beta-alpha barrel; 2.30 | 95.08 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 94.7 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 94.67 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 94.57 | |
| 4a29_A | 258 | Engineered retro-aldol enzyme RA95.0; de novo prot | 94.41 | |
| 4gbu_A | 400 | NADPH dehydrogenase 1; alpha/beta barrel, enenone | 94.38 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 94.17 | |
| 3glc_A | 295 | Aldolase LSRF; TIM barrel, lyase, schiff base; HET | 94.08 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 94.06 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 93.97 | |
| 1i4n_A | 251 | Indole-3-glycerol phosphate synthase; thermostable | 93.95 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 93.84 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 93.84 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 93.66 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 93.58 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 93.56 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 93.49 | |
| 3ceu_A | 210 | Thiamine phosphate pyrophosphorylase; TIM barrel-l | 93.48 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 93.11 | |
| 4a3u_A | 358 | NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET | 93.1 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 92.94 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 92.55 | |
| 1w0m_A | 226 | TIM, triosephosphate isomerase; glycolysis, glucon | 92.12 | |
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 91.96 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 91.22 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 90.72 | |
| 2p10_A | 286 | MLL9387 protein; putative phosphonopyruvate hydrol | 90.44 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 90.43 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 89.67 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 89.64 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 89.09 | |
| 1vcv_A | 226 | Probable deoxyribose-phosphate aldolase; DERA, hyp | 88.75 | |
| 1dbt_A | 239 | Orotidine 5'-phosphate decarboxylase; UMP, TIM bar | 87.88 | |
| 1hg3_A | 225 | Triosephosphate isomerase; thermostability, tetram | 87.83 | |
| 2yyu_A | 246 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 87.46 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 87.45 | |
| 1p1x_A | 260 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 87.36 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 87.12 | |
| 2a4a_A | 281 | Deoxyribose-phosphate aldolase; lyase, TIM beta/al | 87.05 | |
| 3nl6_A | 540 | Thiamine biosynthetic bifunctional enzyme; thiamin | 86.47 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 86.42 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 86.24 | |
| 3s1x_A | 223 | Probable transaldolase; alpha-beta barrel, conform | 85.05 | |
| 3ve9_A | 215 | Orotidine-5'-phosphate decarboxylase; TIM barrel f | 84.93 | |
| 1eix_A | 245 | Orotidine 5'-monophosphate decarboxylase; alpha-be | 84.52 | |
| 1to3_A | 304 | Putative aldolase YIHT; beta-alpha barrel, structu | 84.45 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 84.15 | |
| 1vpx_A | 230 | Protein (transaldolase (EC 2.2.1.2)); TM0295, stru | 83.22 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 82.19 | |
| 3c2e_A | 294 | Nicotinate-nucleotide pyrophosphorylase; qprtase, | 82.06 | |
| 3r8r_A | 212 | Transaldolase; pentose phosphate pathway, schiff b | 81.78 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 81.63 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 80.73 |
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
Probab=99.75 E-value=4.5e-18 Score=132.87 Aligned_cols=84 Identities=18% Similarity=0.191 Sum_probs=79.9
Q ss_pred CeEEEcCCCCChHHHHHHHHhCcchHhhhHHHHHHHhccCHHHHHHHHHHHHHHHhHHHHhcccccHHHhhH------HH
Q psy7649 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSLVHKILPEAVADKVHNAYSIFF------LE 74 (100)
Q Consensus 1 i~liasGGIr~g~Di~KAlALGAd~v~ig~~~L~al~~~g~~gv~~~i~~l~~el~~~m~l~g~~n~~~l~~------~e 74 (100)
+|||+||||+||.|++||+++|||+|++||||++++. .|+++|.+.++.+.+||+..|.+.|+.++.++.. .+
T Consensus 268 ipvia~GGI~~~~d~~kal~lGA~~v~ig~~~l~~~~-~G~~~v~~~l~~l~~eL~~~m~~~G~~~i~el~~~~l~~~~~ 346 (368)
T 3vkj_A 268 SFLVGSGGIRSGLDAAKAIALGADIAGMALPVLKSAI-EGKESLEQFFRKIIFELKAAMMLTGSKDVDALKKTSIVILGK 346 (368)
T ss_dssp CEEEEESSCCSHHHHHHHHHHTCSEEEECHHHHHHHH-HCHHHHHHHHHHHHHHHHHHHHHTTCCBHHHHHTCCEEECHH
T ss_pred CcEEEECCCCCHHHHHHHHHcCCCEEEEcHHHHHHHh-cChHHHHHHHHHHHHHHHHHHHHhCCCCHHHhccCCEEechh
Confidence 5899999999999999999999999999999999987 6999999999999999999999999999999875 88
Q ss_pred HHHHHHHcCcC
Q psy7649 75 LNNLVPTLLLG 85 (100)
Q Consensus 75 ~~e~~~~lG~~ 85 (100)
+++|+.++|++
T Consensus 347 l~~~~~~r~~~ 357 (368)
T 3vkj_A 347 LKEWAEYRGIN 357 (368)
T ss_dssp HHHHHHHHTCC
T ss_pred HHHHHHHcCCC
Confidence 99999999986
|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* | Back alignment and structure |
|---|
| >1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A | Back alignment and structure |
|---|
| >2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... | Back alignment and structure |
|---|
| >4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* | Back alignment and structure |
|---|
| >1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A | Back alignment and structure |
|---|
| >4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* | Back alignment and structure |
|---|
| >3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* | Back alignment and structure |
|---|
| >3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A | Back alignment and structure |
|---|
| >1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A | Back alignment and structure |
|---|
| >1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* | Back alignment and structure |
|---|
| >3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 100 | ||||
| d1p4ca_ | 353 | c.1.4.1 (A:) Membrane-associated (S)-mandelate deh | 1e-17 | |
| d1kbia1 | 414 | c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal | 2e-17 | |
| d1tb3a1 | 349 | c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus | 3e-17 | |
| d1goxa_ | 359 | c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia | 3e-16 | |
| d1p0ka_ | 329 | c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera | 6e-11 | |
| d1vcfa1 | 310 | c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i | 2e-10 | |
| d1yxya1 | 230 | c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p | 7e-06 | |
| d1ofda2 | 809 | c.1.4.1 (A:431-1239) Alpha subunit of glutamate sy | 3e-05 | |
| d1y0ea_ | 222 | c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph | 3e-05 | |
| d1ea0a2 | 771 | c.1.4.1 (A:423-1193) Alpha subunit of glutamate sy | 4e-05 |
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 353 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Membrane-associated (S)-mandelate dehydrogenase species: Pseudomonas putida [TaxId: 303]
Score = 73.5 bits (179), Expect = 1e-17
Identities = 24/51 (47%), Positives = 31/51 (60%)
Query: 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSL 51
V +D G R G+D+ KA+ LGA+ V +GRA L+GLA G G VL L
Sbjct: 276 KPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVLTLL 326
|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414 | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 349 | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 359 | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 | Back information, alignment and structure |
|---|
| >d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Length = 809 | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 | Back information, alignment and structure |
|---|
| >d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Length = 771 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 100 | |||
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 99.9 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 99.89 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 99.89 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 99.88 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 99.88 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 99.82 | |
| d1ofda2 | 809 | Alpha subunit of glutamate synthase, central and F | 99.48 | |
| d1ea0a2 | 771 | Alpha subunit of glutamate synthase, central and F | 99.44 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 99.24 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 99.2 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 99.15 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 99.1 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 99.1 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 99.09 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 98.95 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 98.68 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.47 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 98.46 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.42 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 98.26 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 98.23 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 98.01 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 97.65 | |
| d1wv2a_ | 243 | Thiazole biosynthesis protein ThiG {Pseudomonas ae | 97.54 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 97.19 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 97.11 | |
| d1qopa_ | 267 | Trp synthase alpha-subunit {Salmonella typhimurium | 97.01 | |
| d1znna1 | 254 | Pyridoxal biosynthesis lyase PdxS {Bacillus stearo | 96.9 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 96.88 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 96.62 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 96.53 | |
| d1geqa_ | 248 | Trp synthase alpha-subunit {Archaeon Pyrococcus fu | 96.47 | |
| d1rd5a_ | 261 | Trp synthase alpha-subunit {Maize (Zea mays) [TaxI | 96.43 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.26 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 96.25 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 96.01 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.91 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.84 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.52 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 95.47 | |
| d1oyaa_ | 399 | Old yellow enzyme (OYE) {Lager yeast (Saccharomyce | 95.32 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.29 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 95.29 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 95.21 | |
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 95.14 | |
| d1gwja_ | 374 | Morphinone reductase {Pseudomonas putida [TaxId: 3 | 95.13 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 95.08 | |
| d1viza_ | 229 | PcrB protein homolog YerE {Bacillus subtilis [TaxI | 94.88 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 94.71 | |
| d1ujpa_ | 271 | Trp synthase alpha-subunit {Thermus thermophilus [ | 94.47 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 94.43 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 94.38 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 94.38 | |
| d2f6ua1 | 231 | (S)-3-O-geranylgeranylglyceryl phosphate synthase | 94.25 | |
| d1q6oa_ | 213 | 3-keto-L-gulonate 6-phosphate decarboxylase {Esche | 93.51 | |
| d1icpa_ | 364 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 93.48 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 93.26 | |
| d1n7ka_ | 234 | Deoxyribose-phosphate aldolase DeoC {Archaeon Aero | 92.94 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 92.75 | |
| d2flia1 | 217 | D-ribulose-5-phosphate 3-epimerase {Streptococcus | 92.1 | |
| d2tpsa_ | 226 | Thiamin phosphate synthase {Bacillus subtilis [Tax | 92.01 | |
| d1mzha_ | 225 | Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli | 91.21 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 90.79 | |
| d1ub3a_ | 211 | Deoxyribose-phosphate aldolase DeoC {Thermus therm | 90.49 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 90.41 | |
| d1o0ya_ | 251 | Deoxyribose-phosphate aldolase DeoC {Thermotoga ma | 90.1 | |
| d1tqxa_ | 221 | D-ribulose-5-phosphate 3-epimerase {Plasmodium fal | 89.69 | |
| d2czda1 | 206 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 89.41 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 89.08 | |
| d1l6wa_ | 220 | Decameric fructose-6-phosphate aldolase/transaldol | 88.06 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 87.79 | |
| d1vpxa_ | 218 | Decameric fructose-6-phosphate aldolase/transaldol | 87.04 | |
| d1p1xa_ | 250 | Deoxyribose-phosphate aldolase DeoC {Escherichia c | 86.45 | |
| d1h1ya_ | 220 | D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa | 85.12 | |
| d1eixa_ | 231 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 84.69 | |
| d2a4aa1 | 256 | Fructose-1,6-bisphosphate aldolase {Plasmodium yoe | 83.82 | |
| d1dbta_ | 237 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 82.53 |
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: FMN-linked oxidoreductases family: FMN-linked oxidoreductases domain: Isopentenyl-diphosphate delta-isomerase species: Bacillus subtilis [TaxId: 1423]
Probab=99.90 E-value=2.4e-24 Score=161.15 Aligned_cols=86 Identities=20% Similarity=0.181 Sum_probs=83.0
Q ss_pred CeEEEcCCCCChHHHHHHHHhCcchHhhhHHHHHHHhccCHHHHHHHHHHHHHHHhHHHHhcccccHHHhhH------HH
Q psy7649 1 MEVYLDGGIRYGTDVFKAIGLGAKYVFVGRAALWGLAHSGSNGAARVLQSLVHKILPEAVADKVHNAYSIFF------LE 74 (100)
Q Consensus 1 i~liasGGIr~g~Di~KAlALGAd~v~ig~~~L~al~~~g~~gv~~~i~~l~~el~~~m~l~g~~n~~~l~~------~e 74 (100)
+|||+|||||+|.||+||||||||+|++||++|+++++.|++||.++++.|++||+..|.+.|++|+.++.. .+
T Consensus 232 v~viadGGIr~g~Dv~KAlalGAdaV~iGr~~l~al~~~G~~gv~~~l~~l~~el~~~m~~~G~~~i~el~~~~lv~~~~ 311 (329)
T d1p0ka_ 232 STMIASGGLQDALDVAKAIALGASCTGMAGHFLKALTDSGEEGLLEEIQLILEELKLIMTVLGARTIADLQKAPLVIKGE 311 (329)
T ss_dssp SEEEEESSCCSHHHHHHHHHTTCSEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCBHHHHTTCCEEECHH
T ss_pred ceEEEcCCcccHHHHHHHHHcCCCchhccHHHHHHhccCCHHHHHHHHHHHHHHHHHHHHHhCCCCHHHhCcCCEEeccc
Confidence 589999999999999999999999999999999999999999999999999999999999999999999976 69
Q ss_pred HHHHHHHcCcCC
Q psy7649 75 LNNLVPTLLLGS 86 (100)
Q Consensus 75 ~~e~~~~lG~~s 86 (100)
+++|+.++|++.
T Consensus 312 ~~~~~~~~~~~~ 323 (329)
T d1p0ka_ 312 THHWLTERGVNT 323 (329)
T ss_dssp HHHHHHHTTCCS
T ss_pred HHHHHHHcCCCh
Confidence 999999999984
|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|