Psyllid ID: psy764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNKT
ccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccccHHHHHccccEEEEEccccHHHHHHHccccccccccccccEEEEcccccHHHHHHHHHHHHHcccccccccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcc
cccHHHHHHHHHcccEEEEEEccHHHHHHHHHccccEcccHHHHHHcccEEEEEccccccHHEEEcccccHHHccccccEEEEcccccHHHHHHHHHHHHHcccEEEEccccccHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcc
MISTLKLFFLQFQGHdvivydkntdaSQTLAKEGANMALSLSTLASGAEFIISMLpasqdvldaydgsdgilkhakpgvividsstvdpqvpqtLSNLAREKQitfldapvsggtkAAQEATLTFMvggdkssleKAKPILKcmgrnivhcgdsgngqVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINtssgrcwssevynpvpgvlsnvpasnnynggfkISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMdkgcqdkdFSYIYEFLKNKT
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFldapvsggtKAAQEATLTFmvggdksslEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANrctaqtdlSKLATSIYKRlmdkgcqdkDFSYIYEFLKNKT
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNKT
***TLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTV**************KQITFLDAPV********EATLTFMVGG****LEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFL****
**STLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNK*
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNKT
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNKT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
P31937336 3-hydroxyisobutyrate dehy yes N/A 0.965 0.821 0.474 7e-74
Q5R5E7336 3-hydroxyisobutyrate dehy yes N/A 0.965 0.821 0.474 9e-74
Q99L13335 3-hydroxyisobutyrate dehy yes N/A 0.965 0.823 0.467 4e-73
Q2HJD7336 3-hydroxyisobutyrate dehy yes N/A 0.965 0.821 0.467 1e-72
P29266335 3-hydroxyisobutyrate dehy yes N/A 0.954 0.814 0.461 6e-72
Q54CX6321 Probable 3-hydroxyisobuty yes N/A 0.944 0.841 0.488 9e-70
Q9V8M5324 Probable 3-hydroxyisobuty yes N/A 0.937 0.827 0.452 1e-66
Q9XTI0299 Probable 3-hydroxyisobuty yes N/A 0.951 0.909 0.456 1e-65
Q9SUC0347 Probable 3-hydroxyisobuty yes N/A 0.944 0.778 0.433 6e-63
P28811298 3-hydroxyisobutyrate dehy yes N/A 0.951 0.912 0.445 2e-58
>sp|P31937|3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=HIBADH PE=1 SV=2 Back     alignment and function desciption
 Score =  277 bits (708), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 185/276 (67%)

Query: 10  LQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSD 69
           L   G+ +I+YD   DA +     G  +  S + +A  A+ II+MLP S + ++AY G++
Sbjct: 58  LMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGAN 117

Query: 70  GILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGG 129
           GILK  K G ++IDSST+DP V + L+    +    F+DAPVSGG  AA+   LTFMVGG
Sbjct: 118 GILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGG 177

Query: 130 DKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNA 189
            +     A+ +L CMG N+V+CG  G GQ AK+CNNMLL ++M+G AEAMNLG++LG++ 
Sbjct: 178 VEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDP 237

Query: 190 KLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCT 249
           KLL+ ++N SSGRCWSS+ YNPVPGV+  VP++NNY GGF  +L+AKD+ LA+D A    
Sbjct: 238 KLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTK 297

Query: 250 AQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNK 285
           +   L  LA  IY+ +  KG   KDFS +++FL+ +
Sbjct: 298 SPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREE 333

Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 1
>sp|Q5R5E7|3HIDH_PONAB 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Pongo abelii GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|Q99L13|3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Hibadh PE=2 SV=1 Back     alignment and function description
>sp|Q2HJD7|3HIDH_BOVIN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=HIBADH PE=2 SV=1 Back     alignment and function description
>sp|P29266|3HIDH_RAT 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Hibadh PE=1 SV=3 Back     alignment and function description
>sp|Q54CX6|3HIDH_DICDI Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=hibA PE=3 SV=1 Back     alignment and function description
>sp|Q9V8M5|3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster GN=CG15093 PE=2 SV=2 Back     alignment and function description
>sp|Q9XTI0|3HIDH_CAEEL Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=B0250.5 PE=3 SV=1 Back     alignment and function description
>sp|Q9SUC0|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=At4g20930 PE=2 SV=3 Back     alignment and function description
>sp|P28811|MMSB_PSEAE 3-hydroxyisobutyrate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mmsB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
380023660311 PREDICTED: 3-hydroxyisobutyrate dehydrog 0.947 0.871 0.535 4e-82
307205358295 3-hydroxyisobutyrate dehydrogenase, mito 0.958 0.928 0.521 2e-80
307186775285 3-hydroxyisobutyrate dehydrogenase, mito 0.954 0.957 0.512 2e-78
350407062318 PREDICTED: 3-hydroxyisobutyrate dehydrog 0.951 0.855 0.507 5e-77
340709790318 PREDICTED: 3-hydroxyisobutyrate dehydrog 0.951 0.855 0.503 9e-77
321471614332 hypothetical protein DAPPUDRAFT_302347 [ 0.947 0.816 0.509 3e-76
242004397310 3-hydroxyisobutyrate dehydrogenase, puta 0.947 0.874 0.509 5e-76
198428837322 PREDICTED: similar to 3-hydroxyisobutyra 0.940 0.835 0.505 2e-75
383859099316 PREDICTED: 3-hydroxyisobutyrate dehydrog 0.954 0.863 0.494 4e-75
442748465338 Hypothetical protein [Ixodes ricinus] 0.947 0.801 0.487 6e-74
>gi|380023660|ref|XP_003695633.1| PREDICTED: 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
 Score =  310 bits (795), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 145/271 (53%), Positives = 197/271 (72%)

Query: 13  QGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGIL 72
           +G+ +IV+D N  A   L   GA+ A S + +A   E ++SMLP++Q VLD Y+  +G+L
Sbjct: 40  KGYKLIVFDVNESAMSNLTDIGADRASSPAEMAKDVEVVVSMLPSNQHVLDVYNLKNGLL 99

Query: 73  KHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKS 132
             AK   I+IDSST+DP V QTL+  A++  + FLD+PVSGG  AA+  TLTFMVGG K 
Sbjct: 100 SSAKRNSILIDSSTIDPFVSQTLAKEAKKLNLNFLDSPVSGGINAAKNGTLTFMVGGSKE 159

Query: 133 SLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLL 192
           + E  K +L CMG  I+HCGD G GQ AKLCNNMLLG++M+G AEA NLG KLG+++K+L
Sbjct: 160 NFELVKTLLNCMGSRIIHCGDVGMGQAAKLCNNMLLGISMIGTAEAFNLGQKLGLDSKIL 219

Query: 193 SDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQT 252
           +D+IN+SSG+CWSSE+YNPVPG+L NVP+S NY GGF ++L+AKD+ LA+ +A +  A  
Sbjct: 220 TDIINSSSGKCWSSELYNPVPGILKNVPSSKNYEGGFGVTLMAKDLGLAQSVATKVEATI 279

Query: 253 DLSKLATSIYKRLMDKGCQDKDFSYIYEFLK 283
            L  LA  IY+ ++ +G   KDFSY+Y+FLK
Sbjct: 280 PLGSLAHQIYRAIIVRGFAKKDFSYVYQFLK 310

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307205358|gb|EFN83706.1| 3-hydroxyisobutyrate dehydrogenase, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307186775|gb|EFN72210.1| 3-hydroxyisobutyrate dehydrogenase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350407062|ref|XP_003487971.1| PREDICTED: 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709790|ref|XP_003393484.1| PREDICTED: 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|321471614|gb|EFX82586.1| hypothetical protein DAPPUDRAFT_302347 [Daphnia pulex] Back     alignment and taxonomy information
>gi|242004397|ref|XP_002423077.1| 3-hydroxyisobutyrate dehydrogenase, putative [Pediculus humanus corporis] gi|212506008|gb|EEB10339.1| 3-hydroxyisobutyrate dehydrogenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198428837|ref|XP_002130423.1| PREDICTED: similar to 3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor (HIBADH) [Ciona intestinalis] Back     alignment and taxonomy information
>gi|383859099|ref|XP_003705035.1| PREDICTED: 3-hydroxyisobutyrate dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|442748465|gb|JAA66392.1| Hypothetical protein [Ixodes ricinus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
DICTYBASE|DDB_G0292566321 hibA "3-hydroxyisobutyrate deh 0.951 0.847 0.490 1.3e-68
UNIPROTKB|P31937336 HIBADH "3-hydroxyisobutyrate d 0.965 0.821 0.474 9.2e-68
UNIPROTKB|Q5R5E7336 HIBADH "3-hydroxyisobutyrate d 0.965 0.821 0.474 9.2e-68
MGI|MGI:1889802335 Hibadh "3-hydroxyisobutyrate d 0.965 0.823 0.467 3.1e-67
UNIPROTKB|F1PYB6336 HIBADH "Uncharacterized protei 0.965 0.821 0.471 4e-67
UNIPROTKB|Q2HJD7336 HIBADH "3-hydroxyisobutyrate d 0.965 0.821 0.467 6.5e-67
UNIPROTKB|Q5ZLI9333 HIBADH "Uncharacterized protei 0.951 0.816 0.470 2.2e-66
RGD|708399335 Hibadh "3-hydroxyisobutyrate d 0.951 0.811 0.463 2.2e-66
ZFIN|ZDB-GENE-040801-264328 hibadha "3-hydroxyisobutyrate 0.951 0.829 0.455 4.1e-65
ZFIN|ZDB-GENE-040426-1582329 hibadhb "3-hydroxyisobutyrate 0.951 0.826 0.459 1.1e-64
DICTYBASE|DDB_G0292566 hibA "3-hydroxyisobutyrate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 696 (250.1 bits), Expect = 1.3e-68, P = 1.3e-68
 Identities = 134/273 (49%), Positives = 186/273 (68%)

Query:    13 QGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGIL 72
             +GH++IV+D + D    L ++GA +A S + +A  A+ I++MLPAS  V + Y G +GI 
Sbjct:    44 KGHNLIVFDMSKDNMNRLKEKGAKIANSPAEVAKEADVIVTMLPASAHVKNVYCGENGIF 103

Query:    73 KHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKS 132
             +  +PG +++DSST+DP   + ++++A++ Q T LD PVSGGT  A+  TLTFMVGG + 
Sbjct:   104 QTVRPGTLLLDSSTIDPATAREVASIAKKHQSTMLDCPVSGGTGGAEAGTLTFMVGGSEQ 163

Query:   133 SLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLL 192
                 AK  L+CMG+NIVHCGD G GQVAK+CNN++LG++M+ V+EAMNLGVK GM+ K L
Sbjct:   164 DFNTAKTYLECMGKNIVHCGDVGTGQVAKVCNNLVLGISMIAVSEAMNLGVKQGMDPKKL 223

Query:   193 SDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQT 252
             + + NTSS RCW+SE+YNP PGV+   PAS  Y GGF  +L+ KD+ LA D A       
Sbjct:   224 AGIFNTSSARCWTSELYNPCPGVIETSPASRGYTGGFGSALMTKDLGLAVDSAKSIGEPL 283

Query:   253 DLSKLATSIYKRLMDKGCQDKDFSYIYEFL-KN 284
              L   A  +Y  L+ KG   KDFS +Y+FL KN
Sbjct:   284 LLGNSAHQLYTLLVAKGDGQKDFSVVYDFLNKN 316
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0008442 "3-hydroxyisobutyrate dehydrogenase activity" evidence=IEA
GO:0006098 "pentose-phosphate shunt" evidence=IEA
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0044351 "macropinocytosis" evidence=RCA
UNIPROTKB|P31937 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5E7 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1889802 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYB6 HIBADH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJD7 HIBADH "3-hydroxyisobutyrate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLI9 HIBADH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|708399 Hibadh "3-hydroxyisobutyrate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-264 hibadha "3-hydroxyisobutyrate dehydrogenase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1582 hibadhb "3-hydroxyisobutyrate dehydrogenase b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0ABQ3GARR_ECOL61, ., 1, ., 1, ., 6, 00.33080.91600.8911yesN/A
P28811MMSB_PSEAE1, ., 1, ., 1, ., 3, 10.44520.95100.9127yesN/A
Q9V8M53HIDH_DROME1, ., 1, ., 1, ., 3, 10.45250.93700.8271yesN/A
Q5R5E73HIDH_PONAB1, ., 1, ., 1, ., 3, 10.47460.96500.8214yesN/A
P63935MMSB_MYCTU1, ., 1, ., 1, ., 3, 10.38600.93700.9115yesN/A
P63936MMSB_MYCBO1, ., 1, ., 1, ., 3, 10.38600.93700.9115yesN/A
Q9SUC03HIDH_ARATH1, ., 1, ., 1, ., 3, 10.43300.94400.7780yesN/A
Q54CX63HIDH_DICDI1, ., 1, ., 1, ., 3, 10.48880.94400.8411yesN/A
P292663HIDH_RAT1, ., 1, ., 1, ., 3, 10.46150.95450.8149yesN/A
Q9XTI03HIDH_CAEEL1, ., 1, ., 1, ., 3, 10.45620.95100.9096yesN/A
P319373HIDH_HUMAN1, ., 1, ., 1, ., 3, 10.47460.96500.8214yesN/A
O34948YKWC_BACSU1, ., 1, ., -, ., -0.34320.91250.9062yesN/A
Q99L133HIDH_MOUSE1, ., 1, ., 1, ., 3, 10.46730.96500.8238yesN/A
Q2HJD73HIDH_BOVIN1, ., 1, ., 1, ., 3, 10.46730.96500.8214yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 1e-108
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 8e-91
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 8e-54
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 6e-53
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 3e-47
PRK15461296 PRK15461, PRK15461, NADH-dependent gamma-hydroxybu 1e-37
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 1e-25
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 4e-24
PLN02858 1378 PLN02858, PLN02858, fructose-bisphosphate aldolase 2e-20
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 2e-19
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 2e-19
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 4e-16
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 1e-15
PTZ00142 470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 3e-04
COG0362 473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 0.003
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information 
 Score =  316 bits (811), Expect = e-108
 Identities = 137/270 (50%), Positives = 173/270 (64%)

Query: 14  GHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILK 73
           GH V V+D   DA +     GA  A S +  A GA+ +I+MLPA Q V+  Y G +GIL 
Sbjct: 19  GHPVRVFDLFPDAVEEAVAAGAQAAASPAEAAEGADRVITMLPAGQHVISVYSGDEGILP 78

Query: 74  HAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSS 133
               G ++ID ST+DP   + L+ LA      F+DAPVSGG   A+  TLTFMVGG    
Sbjct: 79  KVAKGSLLIDCSTIDPDSARKLAELAAAHGAVFMDAPVSGGVGGARAGTLTFMVGGVAEE 138

Query: 134 LEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLS 193
              A+P+L  MGRNIVHCGD G GQ AK+CNNMLLG++M+G AEAM LG KLG++ K+L 
Sbjct: 139 FAAAEPVLGPMGRNIVHCGDHGAGQAAKICNNMLLGISMIGTAEAMALGEKLGLDPKVLF 198

Query: 194 DVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTD 253
           ++ NTSSGRCWSS+ YNPVPGV+   PASN Y GGF  +L+ KD+ LA+D A    A T 
Sbjct: 199 EIANTSSGRCWSSDTYNPVPGVMPQAPASNGYQGGFGTALMLKDLGLAQDAAKSAGAPTP 258

Query: 254 LSKLATSIYKRLMDKGCQDKDFSYIYEFLK 283
           L  LA  +Y    DKG   KDFS + + L+
Sbjct: 259 LGALARQLYSLFDDKGHGGKDFSSVIQLLR 288

3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway. In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators. 3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterized 3-hydroxyisobutyrate dehydrogenase from rat liver with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31). This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate. HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase above trusted (pfam03446) [Energy metabolism, Amino acids and amines]. Length = 288
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|185358 PRK15461, PRK15461, NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|215463 PLN02858, PLN02858, fructose-bisphosphate aldolase Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
KOG0409|consensus327 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 100.0
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 100.0
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 100.0
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 100.0
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.97
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.97
PRK15182 425 Vi polysaccharide biosynthesis protein TviB; Provi 99.97
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.97
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.96
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.96
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.95
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.94
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.94
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 99.93
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.92
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.91
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.9
PLN02688266 pyrroline-5-carboxylate reductase 99.89
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.89
PLN02353 473 probable UDP-glucose 6-dehydrogenase 99.89
KOG2653|consensus 487 99.89
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.88
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.85
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.83
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.81
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.81
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.8
PRK08507275 prephenate dehydrogenase; Validated 99.79
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.79
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.77
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.77
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.77
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.76
PRK08655 437 prephenate dehydrogenase; Provisional 99.75
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.75
PRK07417279 arogenate dehydrogenase; Reviewed 99.73
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.72
PRK07680273 late competence protein ComER; Validated 99.72
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.72
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.71
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.71
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.69
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.65
PRK06545359 prephenate dehydrogenase; Validated 99.64
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.62
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 99.61
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.59
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.59
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.58
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.58
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.56
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.54
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.48
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.48
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.46
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.45
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.44
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.43
PLN02712667 arogenate dehydrogenase 99.42
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.39
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.37
PLN02256304 arogenate dehydrogenase 99.36
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.36
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.34
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.31
KOG2666|consensus 481 99.3
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.29
PRK05479330 ketol-acid reductoisomerase; Provisional 99.27
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.26
PRK08818370 prephenate dehydrogenase; Provisional 99.23
PLN02712 667 arogenate dehydrogenase 99.21
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.18
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.14
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.11
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.07
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.07
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.0
KOG3124|consensus267 98.93
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.93
PRK07574385 formate dehydrogenase; Provisional 98.87
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.87
PLN03139386 formate dehydrogenase; Provisional 98.82
PRK05708305 2-dehydropantoate 2-reductase; Provisional 98.81
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 98.8
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 98.74
PRK06436303 glycerate dehydrogenase; Provisional 98.72
PRK13243333 glyoxylate reductase; Reviewed 98.72
PRK12480330 D-lactate dehydrogenase; Provisional 98.7
PRK13403335 ketol-acid reductoisomerase; Provisional 98.66
PRK08605332 D-lactate dehydrogenase; Validated 98.62
PRK11730715 fadB multifunctional fatty acid oxidation complex 98.61
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 98.59
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.56
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 98.54
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.54
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.53
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.53
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.53
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.51
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.5
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.47
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.45
PRK06141314 ornithine cyclodeaminase; Validated 98.42
PRK06444197 prephenate dehydrogenase; Provisional 98.39
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.38
KOG2711|consensus372 98.36
KOG2380|consensus 480 98.34
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.33
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.25
PLN02928347 oxidoreductase family protein 98.25
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.2
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.19
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.19
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.17
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.15
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.14
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.1
KOG2304|consensus298 98.05
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.01
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.0
KOG2305|consensus313 97.98
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.98
PRK06487317 glycerate dehydrogenase; Provisional 97.89
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.85
PRK06932314 glycerate dehydrogenase; Provisional 97.84
PLN02306386 hydroxypyruvate reductase 97.78
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 97.76
COG5495289 Uncharacterized conserved protein [Function unknow 97.75
KOG0069|consensus336 97.74
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 97.73
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 97.7
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.62
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.58
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.52
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 97.46
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.45
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.44
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.43
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.42
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.42
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 97.42
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.35
PF00393 291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 97.33
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.31
PTZ00075476 Adenosylhomocysteinase; Provisional 97.31
PRK06407301 ornithine cyclodeaminase; Provisional 97.26
PRK06823315 ornithine cyclodeaminase; Validated 97.14
PLN02494477 adenosylhomocysteinase 97.13
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.12
PRK07340304 ornithine cyclodeaminase; Validated 97.08
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.08
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.07
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.03
PRK08618325 ornithine cyclodeaminase; Validated 96.98
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 96.96
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 96.95
PF07479149 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate 96.91
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 96.89
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 96.86
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.86
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 96.83
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.82
PLN00203519 glutamyl-tRNA reductase 96.8
PRK04148134 hypothetical protein; Provisional 96.8
PRK06046326 alanine dehydrogenase; Validated 96.79
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.77
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 96.76
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.75
PRK05225 487 ketol-acid reductoisomerase; Validated 96.75
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.72
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.68
PRK10669558 putative cation:proton antiport protein; Provision 96.55
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.51
PRK07589346 ornithine cyclodeaminase; Validated 96.51
PRK00048257 dihydrodipicolinate reductase; Provisional 96.49
PRK08291330 ectoine utilization protein EutC; Validated 96.47
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.44
PRK06199379 ornithine cyclodeaminase; Validated 96.41
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 96.35
PRK03659601 glutathione-regulated potassium-efflux system prot 96.31
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.3
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.3
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.25
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.21
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 96.21
PRK03562621 glutathione-regulated potassium-efflux system prot 96.21
PF05222136 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal 96.2
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.2
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.18
COG0673342 MviM Predicted dehydrogenases and related proteins 96.17
KOG3007|consensus333 96.05
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.05
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 96.03
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 95.98
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.95
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.88
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.88
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.88
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.87
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.86
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.86
COG4074343 Mth H2-forming N5,N10-methylenetetrahydromethanopt 95.86
PRK13940414 glutamyl-tRNA reductase; Provisional 95.8
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.77
PRK09287459 6-phosphogluconate dehydrogenase; Validated 95.76
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.74
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.72
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.71
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.7
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 95.69
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.67
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.64
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 95.64
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.6
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.56
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.54
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 95.53
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.51
TIGR00036266 dapB dihydrodipicolinate reductase. 95.48
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.48
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.46
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.45
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
KOG2741|consensus351 95.37
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 95.36
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.31
PRK09496 453 trkA potassium transporter peripheral membrane com 95.28
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.27
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 95.22
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 95.19
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 95.16
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.11
KOG0068|consensus406 95.09
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.06
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 94.95
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.93
PRK06223307 malate dehydrogenase; Reviewed 94.93
PRK13303265 L-aspartate dehydrogenase; Provisional 94.84
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 94.84
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.77
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.76
PF10728132 DUF2520: Domain of unknown function (DUF2520); Int 94.76
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 94.71
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 94.66
PLN02353473 probable UDP-glucose 6-dehydrogenase 94.63
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 94.59
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.58
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 94.57
CHL00194317 ycf39 Ycf39; Provisional 94.48
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.43
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 94.4
PRK13301267 putative L-aspartate dehydrogenase; Provisional 94.28
PLN03209 576 translocon at the inner envelope of chloroplast su 94.27
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 94.26
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 94.11
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 94.05
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 94.03
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 94.03
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 94.02
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.01
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 93.98
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 93.95
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.89
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 93.81
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.81
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 93.76
PRK14982340 acyl-ACP reductase; Provisional 93.75
PRK09496453 trkA potassium transporter peripheral membrane com 93.73
PRK12550272 shikimate 5-dehydrogenase; Reviewed 93.68
PRK10206344 putative oxidoreductase; Provisional 93.57
PTZ00117319 malate dehydrogenase; Provisional 93.57
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 93.53
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 93.03
PRK06718202 precorrin-2 dehydrogenase; Reviewed 93.01
KOG1502|consensus327 92.99
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 92.96
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 92.9
COG0300265 DltE Short-chain dehydrogenases of various substra 92.88
KOG1200|consensus256 92.72
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 92.69
PRK06182273 short chain dehydrogenase; Validated 92.62
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 92.5
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 92.43
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.37
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.3
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 92.2
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 92.13
PRK06349 426 homoserine dehydrogenase; Provisional 92.0
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 91.96
PLN02383344 aspartate semialdehyde dehydrogenase 91.94
PRK11579346 putative oxidoreductase; Provisional 91.71
PRK06180277 short chain dehydrogenase; Provisional 91.68
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 91.51
PRK05693274 short chain dehydrogenase; Provisional 91.51
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 91.45
cd01483143 E1_enzyme_family Superfamily of activating enzymes 91.28
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.16
COG2910211 Putative NADH-flavin reductase [General function p 91.14
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.76
PRK06139330 short chain dehydrogenase; Provisional 90.69
PRK08265261 short chain dehydrogenase; Provisional 90.65
PRK12828239 short chain dehydrogenase; Provisional 90.64
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 90.59
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 90.58
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.49
PRK08213259 gluconate 5-dehydrogenase; Provisional 90.47
PRK07890258 short chain dehydrogenase; Provisional 90.44
KOG1014|consensus312 90.43
PRK05568142 flavodoxin; Provisional 90.43
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 90.29
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.23
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 90.18
PRK07825273 short chain dehydrogenase; Provisional 90.17
PRK05866293 short chain dehydrogenase; Provisional 90.13
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 90.1
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 89.97
PRK07024257 short chain dehydrogenase; Provisional 89.96
PRK05867253 short chain dehydrogenase; Provisional 89.95
PRK07067257 sorbitol dehydrogenase; Provisional 89.88
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.86
PRK07109334 short chain dehydrogenase; Provisional 89.84
PRK06124256 gluconate 5-dehydrogenase; Provisional 89.84
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 89.73
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 89.68
PRK08862227 short chain dehydrogenase; Provisional 89.58
PRK07814263 short chain dehydrogenase; Provisional 89.56
PRK07478254 short chain dehydrogenase; Provisional 89.53
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.51
PRK08300302 acetaldehyde dehydrogenase; Validated 89.49
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 89.49
PRK10538248 malonic semialdehyde reductase; Provisional 89.45
PRK07074257 short chain dehydrogenase; Provisional 89.43
PRK07454241 short chain dehydrogenase; Provisional 89.42
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 89.39
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 89.39
PRK05993277 short chain dehydrogenase; Provisional 89.31
PRK00683 418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.26
PRK08643256 acetoin reductase; Validated 89.07
PRK06270341 homoserine dehydrogenase; Provisional 88.99
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 88.97
PRK05872296 short chain dehydrogenase; Provisional 88.96
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.93
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 88.91
PTZ00082321 L-lactate dehydrogenase; Provisional 88.88
PRK12829264 short chain dehydrogenase; Provisional 88.84
PRK06196315 oxidoreductase; Provisional 88.81
PRK07523255 gluconate 5-dehydrogenase; Provisional 88.6
PRK08340259 glucose-1-dehydrogenase; Provisional 88.51
PRK08267260 short chain dehydrogenase; Provisional 88.48
PTZ00187317 succinyl-CoA synthetase alpha subunit; Provisional 88.43
PRK05876275 short chain dehydrogenase; Provisional 88.42
PRK07063260 short chain dehydrogenase; Provisional 88.37
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 88.36
PRK06179270 short chain dehydrogenase; Provisional 88.36
TIGR02415254 23BDH acetoin reductases. One member of this famil 88.3
PRK06482276 short chain dehydrogenase; Provisional 88.22
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 88.17
PRK01045298 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate redu 88.15
PRK07062265 short chain dehydrogenase; Provisional 88.15
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 88.12
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.08
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 87.94
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.93
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 87.91
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 87.77
PRK12939250 short chain dehydrogenase; Provisional 87.74
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 87.73
PRK07326237 short chain dehydrogenase; Provisional 87.71
PRK06720169 hypothetical protein; Provisional 87.7
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 87.64
PRK09186256 flagellin modification protein A; Provisional 87.54
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 87.52
PRK05569141 flavodoxin; Provisional 87.4
PRK08309177 short chain dehydrogenase; Provisional 87.37
PRK06101240 short chain dehydrogenase; Provisional 87.32
PRK06057255 short chain dehydrogenase; Provisional 87.3
PRK06138252 short chain dehydrogenase; Provisional 87.22
PRK08085254 gluconate 5-dehydrogenase; Provisional 87.22
PRK08589272 short chain dehydrogenase; Validated 87.15
PRK06719157 precorrin-2 dehydrogenase; Validated 87.13
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.09
PRK12360281 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 87.06
PRK07035252 short chain dehydrogenase; Provisional 87.03
PRK08263275 short chain dehydrogenase; Provisional 86.96
PRK06194287 hypothetical protein; Provisional 86.83
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.78
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.54
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 86.53
PRK07774250 short chain dehydrogenase; Provisional 86.46
PLN00016378 RNA-binding protein; Provisional 86.39
PRK07677252 short chain dehydrogenase; Provisional 86.37
PF10100429 DUF2338: Uncharacterized protein conserved in bact 86.29
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 86.24
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.23
PLN02253280 xanthoxin dehydrogenase 86.14
PRK08277278 D-mannonate oxidoreductase; Provisional 86.11
PRK06172253 short chain dehydrogenase; Provisional 86.08
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 86.02
PRK07856252 short chain dehydrogenase; Provisional 86.02
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 86.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 85.95
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 85.93
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 85.93
PLN02650351 dihydroflavonol-4-reductase 85.82
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 85.81
PRK08177225 short chain dehydrogenase; Provisional 85.76
PRK06949258 short chain dehydrogenase; Provisional 85.72
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 85.69
TIGR01081 448 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl 85.68
PLN02780320 ketoreductase/ oxidoreductase 85.42
COG0761294 lytB 4-Hydroxy-3-methylbut-2-enyl diphosphate redu 85.35
PRK06500249 short chain dehydrogenase; Provisional 85.08
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 85.04
PRK05875276 short chain dehydrogenase; Provisional 84.98
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 84.97
PRK10569191 NAD(P)H-dependent FMN reductase; Provisional 84.89
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 84.78
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 84.66
PRK05854313 short chain dehydrogenase; Provisional 84.64
PRK06398258 aldose dehydrogenase; Validated 84.63
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 84.59
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 84.51
PRK08251248 short chain dehydrogenase; Provisional 84.29
PRK05884223 short chain dehydrogenase; Provisional 84.28
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 84.24
PRK09880343 L-idonate 5-dehydrogenase; Provisional 84.15
PRK05717255 oxidoreductase; Validated 84.1
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 84.09
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 84.03
PRK06914280 short chain dehydrogenase; Provisional 83.95
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energ 83.94
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 83.93
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 83.91
PRK07097265 gluconate 5-dehydrogenase; Provisional 83.88
PRK09242257 tropinone reductase; Provisional 83.83
PRK07832272 short chain dehydrogenase; Provisional 83.82
TIGR00216280 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyroph 83.75
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 83.68
PRK07060245 short chain dehydrogenase; Provisional 83.65
PRK06484520 short chain dehydrogenase; Validated 83.65
PLN02686367 cinnamoyl-CoA reductase 83.61
KOG4230|consensus 935 83.42
PRK05855582 short chain dehydrogenase; Validated 83.4
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 83.4
PRK07453322 protochlorophyllide oxidoreductase; Validated 83.36
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 83.21
PRK08339263 short chain dehydrogenase; Provisional 83.2
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 83.2
PRK05086312 malate dehydrogenase; Provisional 83.18
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 83.15
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 82.92
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 82.86
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.82
PLN02427386 UDP-apiose/xylose synthase 82.82
PRK06197306 short chain dehydrogenase; Provisional 82.76
PRK06841255 short chain dehydrogenase; Provisional 82.76
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 82.71
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 82.65
PRK06703151 flavodoxin; Provisional 82.61
PRK08017256 oxidoreductase; Provisional 82.58
PRK06756148 flavodoxin; Provisional 82.57
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 82.54
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 82.51
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 82.48
PRK09072263 short chain dehydrogenase; Provisional 82.41
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.24
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 82.19
PRK10537393 voltage-gated potassium channel; Provisional 82.17
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 82.13
PRK12743256 oxidoreductase; Provisional 82.1
PRK06181263 short chain dehydrogenase; Provisional 81.96
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 81.95
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 81.81
PRK06114254 short chain dehydrogenase; Provisional 81.66
PRK05650270 short chain dehydrogenase; Provisional 81.56
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 81.53
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 81.47
PRK07831262 short chain dehydrogenase; Provisional 81.3
PRK06483236 dihydromonapterin reductase; Provisional 81.29
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 81.23
PRK09291257 short chain dehydrogenase; Provisional 81.21
PLN02214342 cinnamoyl-CoA reductase 81.07
PF14748107 P5CR_dimer: Pyrroline-5-carboxylate reductase dime 81.03
PF08546125 ApbA_C: Ketopantoate reductase PanE/ApbA C termina 81.03
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.88
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-65  Score=431.12  Aligned_cols=276  Identities=38%  Similarity=0.625  Sum_probs=266.4

Q ss_pred             CccHHHHHHHHhCCCcEEEEcCCchH-HHHHHHcCCcccCCHHHHhhcCcEEEEecCChhHHHHHhcCCccccccCCCCC
Q psy764            1 MISTLKLFFLQFQGHDVIVYDKNTDA-SQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGV   79 (286)
Q Consensus         1 ~~G~~lA~~L~~~G~~V~~~dr~~~~-~~~l~~~g~~~~~s~~e~~~~adivi~~v~~~~~~~~v~~~~~~l~~~l~~g~   79 (286)
                      .||.+||.||.++||+|++|||++++ .+.+.+.|+..+.++.|+++++|+||+|||+++++++|+++++|+.+.+++|+
T Consensus        10 ~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a~s~~eaa~~aDvVitmv~~~~~V~~V~~g~~g~~~~~~~G~   89 (286)
T COG2084          10 IMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADVVITMLPDDAAVRAVLFGENGLLEGLKPGA   89 (286)
T ss_pred             hhhHHHHHHHHHCCCEEEEEeCChhhhhHHHHHcCCcccCCHHHHHHhCCEEEEecCCHHHHHHHHhCccchhhcCCCCC
Confidence            39999999999999999999999999 66666779999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCchHHHHHHHHHHhcCCceEeccCCCCHHhhhcCceEEEecCCHhhHHHHHHHHHHhcCCeEecCCcchHHH
Q psy764           80 IVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQV  159 (286)
Q Consensus        80 ivid~st~~p~~~~~~~~~~~~~g~~~~~~pv~g~~~~a~~g~l~~~~gg~~~~~~~~~~ll~~~g~~v~~~g~~g~a~~  159 (286)
                      +||||||++|..++++++.++++|..|+|+||+|++..+.+|++++|+||+++.|++++|+|+.++++++|+|+.|+|+.
T Consensus        90 i~IDmSTisp~~a~~~a~~~~~~G~~~lDAPVsGg~~~A~~GtLtimvGG~~~~f~r~~pvl~~~g~~i~~~G~~G~G~~  169 (286)
T COG2084          90 IVIDMSTISPETARELAAALAAKGLEFLDAPVSGGVPGAAAGTLTIMVGGDAEAFERAKPVLEAMGKNIVHVGPVGAGQA  169 (286)
T ss_pred             EEEECCCCCHHHHHHHHHHHHhcCCcEEecCccCCchhhhhCceEEEeCCCHHHHHHHHHHHHHhcCceEEECCCCchHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHccCCCcccccccCCCCCccccCCCCCCCCCCccchhHHHHHH
Q psy764          160 AKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMK  239 (286)
Q Consensus       160 ~Kl~~n~~~~~~~~~~~Ea~~l~~~~Gl~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~kd~~  239 (286)
                      +|++||++..+++.+++|++.+++++|+|++.++++++.++++||.++++.+       ++.+++|+|+|.++++.||++
T Consensus       170 ~Kl~nn~l~~~~~~a~aEAl~la~k~Gld~~~~~~vi~~~~~~s~~~e~~~~-------~m~~~~~~p~F~v~~~~KDl~  242 (286)
T COG2084         170 AKLANNILLAGNIAALAEALALAEKAGLDPDVVLEVISGGAAGSWILENYGP-------RMLEGDFSPGFAVDLMLKDLG  242 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHhccccCChHHHhhcc-------hhhcCCCCcchhHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999988764       345899999999999999999


Q ss_pred             HHHHHHhhcCCCchHHHHHHHHHHHHHHcCCCCCchhHHHHHHh
Q psy764          240 LAEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLK  283 (286)
Q Consensus       240 ~~~~~a~~~g~~~p~~~~~~~~~~~a~~~g~g~~d~~~~~~~~~  283 (286)
                      ++.+++++.|+++|++..+.++|+.+.+.|+|++|++++++.++
T Consensus       243 la~~~A~~~g~~lP~~~~~~~ly~~~~~~G~g~~D~sal~~~l~  286 (286)
T COG2084         243 LALDAAKELGAPLPLTALAAELYAKAAAAGGGEEDFSALIKLLE  286 (286)
T ss_pred             HHHHHHHhcCCCCcHHHHHHHHHHHHHhcCCCccChHHHHHHhC
Confidence            99999999999999999999999999999999999999999875

>KOG0409|consensus Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2666|consensus Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>KOG3124|consensus Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>KOG2711|consensus Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PF07479 NAD_Gly3P_dh_C: NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; InterPro: IPR006109 NAD-dependent glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PF05222 AlaDh_PNT_N: Alanine dehydrogenase/PNT, N-terminal domain; InterPro: IPR007886 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>KOG3007|consensus Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4074 Mth H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF10728 DUF2520: Domain of unknown function (DUF2520); InterPro: IPR018931 This presumed domain is found C-terminal to a Rossmann-like domain suggesting that these proteins are oxidoreductases Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK05568 flavodoxin; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK01045 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Reviewed Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK05569 flavodoxin; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12360 4-hydroxy-3-methylbut-2-enyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>COG0761 lytB 4-Hydroxy-3-methylbut-2-enyl diphosphate reductase IspH [Lipid metabolism] Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK10569 NAD(P)H-dependent FMN reductase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00216 ispH_lytB (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming) Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06703 flavodoxin; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06756 flavodoxin; Provisional Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PF14748 P5CR_dimer: Pyrroline-5-carboxylate reductase dimerisation; PDB: 2RCY_D 3TRI_A 2IZZ_B 2GR9_B 2GRA_B 2GER_C 1YQG_A 2AG8_A 3GT0_A 2AMF_E Back     alignment and domain information
>PF08546 ApbA_C: Ketopantoate reductase PanE/ApbA C terminal; InterPro: IPR013752 This is the C-terminal domain of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, 1 Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2i9p_A319 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 7e-75
2gf2_A296 Crystal Structure Of Human Hydroxyisobutyrate Dehyd 7e-75
3q3c_A299 Crystal Structure Of A Serine Dehydrogenase From Ps 1e-51
3obb_A300 Crystal Structure Of A Possible 3-Hydroxyisobutyrat 1e-51
3cky_A301 Structural And Kinetic Properties Of A Beta-Hydroxy 8e-38
1vpd_A299 X-Ray Crystal Structure Of Tartronate Semialdehyde 2e-31
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 2e-29
2cvz_A289 Structure Of Hydroxyisobutyrate Dehydrogenase From 5e-29
3pef_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 4e-27
3pdu_A287 Crystal Structure Of Gamma-Hydroxybutyrate Dehydrog 2e-26
2uyy_A316 Structure Of The Cytokine-Like Nuclear Factor N-Pac 4e-21
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 3e-20
1yb4_A295 Crystal Structure Of The Tartronic Semialdehyde Red 6e-20
4dll_A320 Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Re 5e-19
3qha_A296 Crystal Structure Of A Putative Oxidoreductase From 1e-14
3g0o_A303 Crystal Structure Of 3-Hydroxyisobutyrate Dehydroge 4e-13
4e21_A358 The Crystal Structure Of 6-Phosphogluconate Dehydro 2e-08
4gbj_A297 Crystal Structure Of Nad-Binding 6-Phosphogluconate 2e-07
2w90_A 471 Geobacillus Stearothermophilus 6-Phosphogluconate D 2e-05
2w8z_A 470 Geobacillus Stearothermophilus 6-Phosphogluconate D 2e-05
>pdb|2I9P|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Complexed With Nad+ Length = 319 Back     alignment and structure 
Iteration: 1

 Score =  276 bits (707), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 185/276 (67%)
Query: 10  LQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSD 69
           L   G+ +I+YD   DA +     G  +  S + +A  A+ II+MLP S + ++AY G++
Sbjct: 41  LMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGAN 100
Query: 70  GILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGG 129
           GILK  K G ++IDSST+DP V + L+    +    F+DAPVSGG  AA+   LTFMVGG
Sbjct: 101 GILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGG 160
Query: 130 DKSSLEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNA 189
            +     A+ +L CMG N+V+CG  G GQ AK+CNNMLL ++M+G AEAMNLG++LG++ 
Sbjct: 161 VEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDP 220
Query: 190 KLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCT 249
           KLL+ ++N SSGRCWSS+ YNPVPGV+  VP++NNY GGF  +L+AKD+ LA+D A    
Sbjct: 221 KLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTK 280
Query: 250 AQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNK 285
           +   L  LA  IY+ +  KG   KDFS +++FL+ +
Sbjct: 281 SPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREE 316
>pdb|2GF2|A Chain A, Crystal Structure Of Human Hydroxyisobutyrate Dehydrogenase Length = 296 Back     alignment and structure
>pdb|3Q3C|A Chain A, Crystal Structure Of A Serine Dehydrogenase From Pseudomonas Aeruginosa Pao1 In Complex With Nad Length = 299 Back     alignment and structure
>pdb|3OBB|A Chain A, Crystal Structure Of A Possible 3-Hydroxyisobutyrate Dehydrogenase From Pseudomonas Aeruginosa Pao1 Length = 300 Back     alignment and structure
>pdb|3CKY|A Chain A, Structural And Kinetic Properties Of A Beta-Hydroxyacid Dehydrogenase Involved In Nicotinate Fermentation Length = 301 Back     alignment and structure
>pdb|1VPD|A Chain A, X-Ray Crystal Structure Of Tartronate Semialdehyde Reductase [salmonella Typhimurium Lt2] Length = 299 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|2CVZ|A Chain A, Structure Of Hydroxyisobutyrate Dehydrogenase From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure
>pdb|3PEF|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Metallireducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|3PDU|A Chain A, Crystal Structure Of Gamma-Hydroxybutyrate Dehydrogenase From Geobacter Sulfurreducens In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|2UYY|A Chain A, Structure Of The Cytokine-Like Nuclear Factor N-Pac Length = 316 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|1YB4|A Chain A, Crystal Structure Of The Tartronic Semialdehyde Reductase From Salmonella Typhimurium Lt2 Length = 295 Back     alignment and structure
>pdb|4DLL|A Chain A, Crystal Structure Of A 2-Hydroxy-3-Oxopropionate Reductase From Polaromonas Sp. Js666 Length = 320 Back     alignment and structure
>pdb|3QHA|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Mycobacterium Avium 104 Length = 296 Back     alignment and structure
>pdb|3G0O|A Chain A, Crystal Structure Of 3-Hydroxyisobutyrate Dehydrogenase (Ygbj) From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|4E21|A Chain A, The Crystal Structure Of 6-Phosphogluconate Dehydrogenase From Geobacter Metallireducens Length = 358 Back     alignment and structure
>pdb|4GBJ|A Chain A, Crystal Structure Of Nad-Binding 6-Phosphogluconate Dehydrogenase From Dyadobacter Fermentans Length = 297 Back     alignment and structure
>pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 471 Back     alignment and structure
>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 1e-134
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 1e-131
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 1e-119
3qha_A296 Putative oxidoreductase; seattle structural genomi 1e-110
1vpd_A299 Tartronate semialdehyde reductase; structural geno 1e-106
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 1e-103
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 1e-102
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 1e-101
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 1e-101
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 1e-94
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 5e-94
1yb4_A295 Tartronic semialdehyde reductase; structural genom 5e-93
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 5e-84
3l6d_A306 Putative oxidoreductase; structural genomics, prot 8e-73
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 5e-52
4ezb_A317 Uncharacterized conserved protein; structural geno 7e-49
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 5e-41
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 1e-13
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 1e-13
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 5e-09
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 2e-05
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 4e-05
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 1e-04
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 2e-04
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 4e-04
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 6e-04
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 7e-04
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
 Score =  380 bits (977), Expect = e-134
 Identities = 130/272 (47%), Positives = 184/272 (67%)

Query: 14  GHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILK 73
           G+ +I+YD   DA +     G  +  S + +A  A+ II+MLP S + ++AY G++GILK
Sbjct: 23  GYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILK 82

Query: 74  HAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSS 133
             K G ++IDSST+DP V + L+    +    F+DAPVSGG  AA+   LTFMVGG +  
Sbjct: 83  KVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDE 142

Query: 134 LEKAKPILKCMGRNIVHCGDSGNGQVAKLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLS 193
              A+ +L CMG N+V+CG  G GQ AK+CNNMLL ++M+G AEAMNLG++LG++ KLL+
Sbjct: 143 FAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLA 202

Query: 194 DVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKLAEDLANRCTAQTD 253
            ++N SSGRCWSS+ YNPVPGV+  VP++NNY GGF  +L+AKD+ LA+D A    +   
Sbjct: 203 KILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL 262

Query: 254 LSKLATSIYKRLMDKGCQDKDFSYIYEFLKNK 285
           L  LA  IY+ +  KG   KDFS +++FL+ +
Sbjct: 263 LGSLAHQIYRMMCAKGYSKKDFSSVFQFLREE 294
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Length = 286 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Length = 201 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Length = 209 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 100.0
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 100.0
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 100.0
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 100.0
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 100.0
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 100.0
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 100.0
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.98
2q3e_A 467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.97
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.97
2o3j_A 481 UDP-glucose 6-dehydrogenase; structural genomics, 99.97
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.96
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.96
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.95
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.93
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.91
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.91
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.91
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.91
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.9
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.9
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.9
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.89
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.87
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.87
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.87
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.85
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.84
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.84
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.84
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.83
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.83
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.83
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.82
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.78
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.77
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.75
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.74
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.74
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.73
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.72
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.7
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.7
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.7
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.69
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.68
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 99.68
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.5
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.66
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.64
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.62
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.61
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.59
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.58
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.58
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.56
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.54
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.51
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.51
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.45
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.43
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.33
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.24
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.21
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.16
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.11
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.05
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 99.04
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.03
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.03
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.02
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.02
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 98.99
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 98.98
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 98.97
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 98.97
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 98.96
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 98.96
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 98.95
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 98.95
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 98.94
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 98.94
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 98.94
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.94
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 98.93
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 98.93
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 98.92
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 98.91
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 98.91
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 98.9
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 98.87
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.86
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 98.85
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 98.84
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 98.8
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 98.8
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 98.79
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 98.78
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 98.75
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 98.75
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.68
2duw_A145 Putative COA-binding protein; ligand binding prote 98.68
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.67
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.67
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 98.65
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.65
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.64
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.6
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.46
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.39
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.31
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.3
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.29
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.29
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.26
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.25
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.21
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.14
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.1
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.08
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.06
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.05
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.04
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.03
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.01
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.95
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.95
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 97.92
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.92
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.9
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.89
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.89
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.88
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.88
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.88
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 97.88
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 97.86
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.85
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.85
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.85
2d59_A144 Hypothetical protein PH1109; COA binding, structur 97.84
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.83
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.82
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.81
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.79
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.77
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.75
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.75
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.74
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 97.7
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 97.68
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.65
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.63
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.63
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.62
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.61
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.61
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.58
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.58
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.57
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.55
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.5
1ydw_A362 AX110P-like protein; structural genomics, protein 97.49
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 97.48
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.44
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.44
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.44
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.41
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.41
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 97.39
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 97.38
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.34
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.33
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.32
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 97.32
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.31
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.29
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.28
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.27
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.26
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.26
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.22
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.2
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.19
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.19
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.18
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.16
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.11
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.09
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.07
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.07
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.07
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.07
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.04
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.01
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.01
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.0
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 96.97
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 96.92
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 96.89
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.86
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.86
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 96.85
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.84
3ulk_A 491 Ketol-acid reductoisomerase; branched-chain amino 96.83
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 96.82
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.75
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 96.73
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 96.71
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.7
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 96.59
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 96.56
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 96.53
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.48
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.47
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.47
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 96.47
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.45
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.45
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.44
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 96.43
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.42
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.38
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 96.35
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.34
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 96.34
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 96.34
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 96.31
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.3
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 96.28
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.26
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 96.16
3oqb_A383 Oxidoreductase; structural genomics, protein struc 96.15
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 96.13
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.09
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.09
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.09
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.07
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 96.04
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 96.02
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.01
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.01
4had_A350 Probable oxidoreductase protein; structural genomi 96.0
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 95.99
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 95.99
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 95.86
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.78
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.77
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 95.73
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.71
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.62
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 95.6
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.55
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 95.52
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.47
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.45
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 95.32
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 95.3
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.27
1lnq_A336 MTHK channels, potassium channel related protein; 95.26
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 95.19
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 95.17
4h3v_A390 Oxidoreductase domain protein; structural genomics 95.11
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.03
3tl2_A315 Malate dehydrogenase; center for structural genomi 95.02
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 94.99
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.98
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 94.96
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 94.91
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 94.89
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 94.76
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 94.74
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 94.71
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 94.71
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 94.7
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 94.64
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 94.39
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 94.38
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 94.29
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 94.29
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 94.26
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 94.2
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 94.03
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 93.99
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 93.87
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 93.86
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.76
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 93.72
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 93.66
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 93.59
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 93.55
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 93.5
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 93.49
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 93.47
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.43
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 93.43
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 93.42
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 93.37
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 93.33
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 93.33
4g65_A 461 TRK system potassium uptake protein TRKA; structur 93.32
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.28
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 93.24
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 93.19
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 93.16
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 93.12
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 93.12
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 93.12
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 93.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 92.99
4dqx_A277 Probable oxidoreductase protein; structural genomi 92.92
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 92.88
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 92.85
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 92.81
3imf_A257 Short chain dehydrogenase; structural genomics, in 92.79
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 92.76
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 92.76
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 92.76
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 92.75
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 92.75
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 92.72
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 92.71
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 92.68
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 92.62
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 92.6
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 92.51
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 92.49
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 92.47
3ius_A286 Uncharacterized conserved protein; APC63810, silic 92.44
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 92.42
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 92.42
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 92.41
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 92.38
4eso_A255 Putative oxidoreductase; NADP, structural genomics 92.37
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 92.34
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 92.3
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.28
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 92.27
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.23
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.2
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 92.18
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.16
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 92.12
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 92.12
2csu_A 457 457AA long hypothetical protein; structural genomi 92.11
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 92.11
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 92.1
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 92.1
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 92.08
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 92.05
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 91.99
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 91.99
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 91.95
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 91.93
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 91.92
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.85
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 91.84
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 91.84
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 91.8
1nff_A260 Putative oxidoreductase RV2002; directed evolution 91.77
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 91.76
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 91.71
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 91.67
3tjr_A301 Short chain dehydrogenase; structural genomics, se 91.63
3cxt_A291 Dehydrogenase with different specificities; rossma 91.58
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 91.55
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 91.53
2wm3_A299 NMRA-like family domain containing protein 1; unkn 91.5
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 91.5
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 91.49
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 91.48
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 91.48
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 91.46
1xq6_A253 Unknown protein; structural genomics, protein stru 91.37
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 91.37
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 91.36
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 91.35
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 91.32
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 91.29
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 91.28
3rih_A293 Short chain dehydrogenase or reductase; structural 91.27
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 91.25
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 91.24
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 91.24
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 91.24
3gem_A260 Short chain dehydrogenase; structural genomics, AP 91.23
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 91.22
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 91.2
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 91.13
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 91.13
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 91.13
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 91.05
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 90.89
3tox_A280 Short chain dehydrogenase; structural genomics, PS 90.87
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 90.84
1xkq_A280 Short-chain reductase family member (5D234); parra 90.8
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 90.77
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 90.74
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 90.73
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 90.71
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 90.62
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 90.48
3e03_A274 Short chain dehydrogenase; structural genomics, PS 90.45
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 90.44
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 90.36
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 90.36
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 90.35
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 90.35
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 90.29
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 90.29
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 90.26
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 90.25
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 90.24
1xhl_A297 Short-chain dehydrogenase/reductase family member 90.19
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 90.18
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 90.16
5nul_A138 Flavodoxin; electron transport, flavoprotein, FMN; 90.12
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 90.1
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 90.09
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 90.08
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 90.05
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 89.94
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 89.93
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 89.92
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 89.91
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 89.86
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 89.77
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 89.73
1xq1_A266 Putative tropinone reducatse; structural genomics, 89.7
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 89.68
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 89.67
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 89.67
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 89.66
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 89.62
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 89.59
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 89.55
3tsc_A277 Putative oxidoreductase; structural genomics, seat 89.54
1spx_A278 Short-chain reductase family member (5L265); paral 89.5
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 89.49
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 89.44
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 89.4
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 89.4
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 89.39
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 89.38
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 89.38
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 89.31
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.27
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 89.25
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 89.24
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 89.18
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 89.15
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 89.14
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 89.13
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 89.11
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 89.1
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 89.1
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 89.05
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 89.05
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 89.05
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 89.02
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 89.01
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 89.01
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 88.99
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 88.94
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 88.92
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 88.92
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 88.82
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 88.78
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 88.77
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 88.72
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 88.7
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 88.58
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 88.57
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 88.54
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 88.5
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 88.49
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 88.46
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
Probab=100.00  E-value=3e-64  Score=436.47  Aligned_cols=285  Identities=45%  Similarity=0.733  Sum_probs=276.1

Q ss_pred             CccHHHHHHHHhCCCcEEEEcCCchHHHHHHHcCCcccCCHHHHhhcCcEEEEecCChhHHHHHhcCCccccccCCCCCE
Q psy764            1 MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVI   80 (286)
Q Consensus         1 ~~G~~lA~~L~~~G~~V~~~dr~~~~~~~l~~~g~~~~~s~~e~~~~adivi~~v~~~~~~~~v~~~~~~l~~~l~~g~i   80 (286)
                      .||.+||+||+++||+|++|||++++++++.+.|++.++|++|++++||+||+|||+++++++|+.+.+|+.+.+++|++
T Consensus        13 ~MG~~mA~~L~~~G~~v~v~dr~~~~~~~l~~~Ga~~a~s~~e~~~~~dvv~~~l~~~~~v~~V~~~~~g~~~~~~~g~i   92 (300)
T 3obb_A           13 HMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDGLLAHIAPGTL   92 (300)
T ss_dssp             TTHHHHHHHHHHTTCEEEEECSSHHHHHHHHHTTCEECSSHHHHHTTCSEEEECCSCHHHHHHHHHSSSSSTTSCCC-CE
T ss_pred             HHHHHHHHHHHhCCCeEEEEcCCHHHHHHHHHcCCEEcCCHHHHHhcCCceeecCCchHHHHHHHhchhhhhhcCCCCCE
Confidence            49999999999999999999999999999999999999999999999999999999999999999998999999999999


Q ss_pred             EEEcCCCCchHHHHHHHHHHhcCCceEeccCCCCHHhhhcCceEEEecCCHhhHHHHHHHHHHhcCCeEecCCcchHHHH
Q psy764           81 VIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCGDSGNGQVA  160 (286)
Q Consensus        81 vid~st~~p~~~~~~~~~~~~~g~~~~~~pv~g~~~~a~~g~l~~~~gg~~~~~~~~~~ll~~~g~~v~~~g~~g~a~~~  160 (286)
                      |||+||++|.+++++++++.++|+.|+|+||+|++..++.|++++|+||+++.+++++|+|+.++++++|+|+.|+|+.+
T Consensus        93 iId~sT~~p~~~~~~a~~~~~~G~~~lDaPVsGg~~~A~~G~L~imvGG~~~~~~~~~p~l~~~g~~i~~~G~~G~g~~~  172 (300)
T 3obb_A           93 VLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVA  172 (300)
T ss_dssp             EEECSCCCHHHHHHHHHHHHTTTCEEEECCEESCHHHHHHTCEEEEEESCHHHHHHHHHHHHHHEEEEEEEESTTHHHHH
T ss_pred             EEECCCCCHHHHHHHHHHHHHcCCEEEecCCCCCHHHHHhCCEEEEEeCCHHHHHHHHHHHHHhCCCEEEeCCccHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHccCCCcccccccCCCCCccccCCCCCCCCCCccchhHHHHHHH
Q psy764          161 KLCNNMLLGVTMMGVAEAMNLGVKLGMNAKLLSDVINTSSGRCWSSEVYNPVPGVLSNVPASNNYNGGFKISLLAKDMKL  240 (286)
Q Consensus       161 Kl~~n~~~~~~~~~~~Ea~~l~~~~Gl~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~kd~~~  240 (286)
                      |+++|++.+.++.+++|++.++++.|+|++.++++++.+++.||.++.+.|.+......+..++|.++|+++++.||+++
T Consensus       173 Kl~~N~l~~~~~~a~aEa~~la~~~Gld~~~~~~vl~~~~~~s~~~~~~~p~~~~~~~~~~~~~~~~~f~~~l~~KDl~l  252 (300)
T 3obb_A          173 KVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGL  252 (300)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHTSTTCCHHHHHCCCSTTTSTTSGGGGTTCSSSBHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHhCcccchHHHhhccccchhhhccccccCCccchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999888887777667778899999999999999999


Q ss_pred             HHHHHhhcCCCchHHHHHHHHHHHHHHcCCCCCchhHHHHHHhhc
Q psy764          241 AEDLANRCTAQTDLSKLATSIYKRLMDKGCQDKDFSYIYEFLKNK  285 (286)
Q Consensus       241 ~~~~a~~~g~~~p~~~~~~~~~~~a~~~g~g~~d~~~~~~~~~~~  285 (286)
                      +.+++++.|+++|+.+.++++|+++.++|+|++|+++|++++++.
T Consensus       253 ~~~~A~~~g~~~p~~~~a~~~~~~a~~~G~g~~D~sal~~~~e~~  297 (300)
T 3obb_A          253 AQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPT  297 (300)
T ss_dssp             HHHHHHHHTCCCHHHHHHHHHHHHHHHTTCTTSBGGGGHHHHCTT
T ss_pred             HHHHHHHcCCCChHHHHHHHHHHHHHhCCCCCcCHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999875
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>5nul_A Flavodoxin; electron transport, flavoprotein, FMN; HET: FMN; 1.60A {Clostridium beijerinckii} SCOP: c.23.5.1 PDB: 2flv_A* 2fvx_A* 1fld_A* 3nll_A* 1fvx_A* 1fla_A* 4nll_A* 5nll_A* 2fox_A* 5ull_A* 2fdx_A* 2fax_A* 6nul_A* 1fln_A* 4nul_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 9e-34
d3cuma1134 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydroge 4e-32
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 9e-31
d1vpda1133 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydroge 4e-25
d2cvza1132 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydroge 2e-24
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 6e-19
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 3e-17
d2b0ja2242 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopt 1e-15
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 2e-15
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 7e-11
d2pv7a2152 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA { 2e-09
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 4e-09
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 6e-08
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 1e-04
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]

 Score =  118 bits (297), Expect = 9e-34
 Identities = 53/143 (37%), Positives = 84/143 (58%)

Query: 10  LQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSD 69
           L   G+ ++V D+N +A   +   GA  A +   +A   + II+MLP S  V +   G +
Sbjct: 19  LLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGEN 78

Query: 70  GILKHAKPGVIVIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGG 129
           GI++ AKPG ++ID S++ P   + +S+  + K +  LDAPVSGG   A + TL+ MVGG
Sbjct: 79  GIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDAPVSGGEPKAIDGTLSVMVGG 138

Query: 130 DKSSLEKAKPILKCMGRNIVHCG 152
           DK+  +K   ++K M  ++VH G
Sbjct: 139 DKAIFDKYYDLMKAMAGSVVHTG 161
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 133 Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 132 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Length = 242 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Length = 152 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 100.0
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 100.0
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.96
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.95
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.95
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.94
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.93
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.93
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.87
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.78
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.77
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.7
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.69
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.61
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.59
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.47
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.38
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.33
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.21
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.12
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 98.92
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 98.79
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 98.7
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 98.67
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 98.55
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.41
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.39
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.33
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.33
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 98.32
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.3
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.18
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.11
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.08
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.06
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 97.95
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 97.94
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.81
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 97.62
d2pgda1 297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 97.52
d1n1ea1160 Glycerol-3-phosphate dehydrogenase {Trypanosome (L 97.52
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.48
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 97.45
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.25
d1txga1155 Glycerol-3-phosphate dehydrogenase {Archaeoglobus 97.04
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.04
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.02
d1pgja1 300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 97.0
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 97.0
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.95
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.9
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.82
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 96.8
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 96.71
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 96.71
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.7
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.62
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.56
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 96.52
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.45
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.32
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.26
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.08
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.99
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.91
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.86
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.78
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 95.68
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.57
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.54
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.5
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.48
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.35
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.32
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 95.31
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.19
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.17
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.16
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 95.07
d1l7da2194 Nicotinamide nucleotide transhydrogenase dI compon 95.04
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.04
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 94.99
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.94
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 94.91
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 94.91
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.89
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 94.81
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 94.71
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.65
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.64
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.59
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.55
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 94.49
d1pjca2193 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.48
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.47
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.42
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.27
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.21
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.2
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.17
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 94.13
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.12
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 94.09
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 93.87
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.65
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.54
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 93.49
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.37
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 93.14
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.14
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.13
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 92.98
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 92.86
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 92.84
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 92.81
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 92.76
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 92.74
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 92.71
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 92.69
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 92.68
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.63
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 92.61
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 92.52
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.49
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 92.48
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.4
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.3
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.29
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 92.26
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 92.25
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.07
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.87
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 91.81
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 91.71
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.68
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.66
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.54
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.49
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.22
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 91.21
d1yqga1111 Pyrroline-5-carboxylate reductase ProC {Neisseria 91.03
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 90.94
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.93
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 90.8
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 90.63
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.4
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 90.14
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.12
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 90.1
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 89.58
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.58
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 89.56
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 89.34
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 89.28
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 89.2
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 89.08
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.08
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 88.88
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 88.76
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 88.73
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 88.65
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.46
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 88.39
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 88.28
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.21
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 88.11
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 88.04
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 87.86
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 87.8
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 87.56
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 87.34
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 87.21
d2ahra1104 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.16
d5nula_138 Flavodoxin {Clostridium beijerinckii [TaxId: 1520] 87.15
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 86.97
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 86.69
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 86.36
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.26
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 85.65
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 84.94
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 84.92
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 84.89
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 84.71
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.3
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 84.07
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 84.03
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 83.8
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.39
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 83.1
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 82.51
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 82.01
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 81.62
d1bg6a1172 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 81.51
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 81.42
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 81.41
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 80.76
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 80.47
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 80.22
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: 6-phosphogluconate dehydrogenase-like, N-terminal domain
domain: Hydroxyisobutyrate dehydrogenase
species: Salmonella typhimurium [TaxId: 90371]

Probab=100.00  E-value=3.7e-34  Score=224.61  Aligned_cols=152  Identities=35%  Similarity=0.564  Sum_probs=147.3

Q ss_pred             CccHHHHHHHHhCCCcEEEEcCCchHHHHHHHcCCcccCCHHHHhhcCcEEEEecCChhHHHHHhcCCccccccCCCCCE
Q psy764            1 MISTLKLFFLQFQGHDVIVYDKNTDASQTLAKEGANMALSLSTLASGAEFIISMLPASQDVLDAYDGSDGILKHAKPGVI   80 (286)
Q Consensus         1 ~~G~~lA~~L~~~G~~V~~~dr~~~~~~~l~~~g~~~~~s~~e~~~~adivi~~v~~~~~~~~v~~~~~~l~~~l~~g~i   80 (286)
                      .||.++|++|+++||+|++|||++++.+.+.+.+...+.++.|+++++|+||+|||++.++++|+.+.+++.+.+.+|++
T Consensus        10 ~MG~~~A~~L~~~G~~V~~~d~~~~~~~~~~~~~~~~~~~~~e~~~~~d~ii~~v~~~~~v~~v~~~~~~~~~~~~~g~i   89 (161)
T d1vpda2          10 IMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGIIEGAKPGTV   89 (161)
T ss_dssp             TTHHHHHHHHHHTTCEEEEECSCHHHHHHHHHTTCEECSSHHHHHHHCSEEEECCSSHHHHHHHHHSTTCHHHHCCTTCE
T ss_pred             HHHHHHHHHHHHCCCeEEEEeCCcchhHHHHHhhhhhcccHHHHHhCCCeEEEEcCCHHHHHHHHhCCcchhhccCCCCE
Confidence            49999999999999999999999999999999999999999999999999999999999999999887789999999999


Q ss_pred             EEEcCCCCchHHHHHHHHHHhcCCceEeccCCCCHHhhhcCceEEEecCCHhhHHHHHHHHHHhcCCeEecC
Q psy764           81 VIDSSTVDPQVPQTLSNLAREKQITFLDAPVSGGTKAAQEATLTFMVGGDKSSLEKAKPILKCMGRNIVHCG  152 (286)
Q Consensus        81 vid~st~~p~~~~~~~~~~~~~g~~~~~~pv~g~~~~a~~g~l~~~~gg~~~~~~~~~~ll~~~g~~v~~~g  152 (286)
                      |||+||++|.+++++++.+.+++++|+|+|++|++..+..|++++|+||+++.+++++++|+.++.+++|+|
T Consensus        90 iid~sT~~p~~~~~~~~~~~~~g~~~vdapv~gg~~~a~~g~l~~~~gG~~~~~~~~~~il~~~~~~i~~~G  161 (161)
T d1vpda2          90 LIDMSSIAPLASREISDALKAKGVEMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG  161 (161)
T ss_dssp             EEECSCCCHHHHHHHHHHHHTTTCEEEECCEESHHHHHHHTCEEEEEESCHHHHHHHHHHHHTTEEEEEEEE
T ss_pred             EEECCCCCHHHHHHHHHHHHHcCCceecccccCChhHHhcCCeEEEEcCCHHHHHHHHHHHHHhcCceEECC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999986
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1n1ea1 a.100.1.6 (A:198-357) Glycerol-3-phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txga1 a.100.1.6 (A:181-335) Glycerol-3-phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7da2 c.23.12.2 (A:1-143,A:327-377) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1yqga1 a.100.1.10 (A:153-263) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ahra1 a.100.1.10 (A:153-256) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d5nula_ c.23.5.1 (A:) Flavodoxin {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1bg6a1 a.100.1.5 (A:188-359) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure