Psyllid ID: psy7778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MLANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
ccccccccccEEEEEEEcHHHHHHcccccHHHHHHHHHHHHHccccEEHHHHHHHccccHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccEEcccc
ccHcccccccEEEEEEccHHHHHHHccccHHHHHHHHHHHHHccccEEEHHHHHHccccHHHHHHHHHHHHHccccEEEccccccHHHHccccccEEcccHHHHHHHHHccEHHHcc
mlangfliggnllykvkdpvtneklkdsdnEEKVVYKIIEEAgnkgiwmrdirfksnlmpTQLNKILKQLETKKIIKAVKSVANIEYLtegtvnamvlpsrkkreeRQDRGVLLKLF
mlangfliggnllykvkdpvtneklkdsdneekVVYKIIeeagnkgiwmrdIRFKSNLMPTQLNKILKQLETKKIIKAVKSVanieyltegtvnamvlpsrkkreerqdrgvllklf
MLANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
****GFLIGGNLLYKVKDPV************KVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMV********************
ML*****IGGNLLYKV****************KVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
MLANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
MLANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANIEYLTEGTVNAMVLPSRKKREERQDRGVLLKLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q921X6 316 DNA-directed RNA polymera yes N/A 0.615 0.227 0.694 1e-21
Q9H1D9 316 DNA-directed RNA polymera yes N/A 0.615 0.227 0.694 1e-21
Q2T9S3 316 DNA-directed RNA polymera yes N/A 0.615 0.227 0.694 1e-21
Q9VD25 293 Probable DNA-directed RNA yes N/A 0.632 0.252 0.706 3e-21
P91529 296 Probable DNA-directed RNA yes N/A 0.615 0.243 0.447 2e-09
Q86JM3 293 DNA-directed RNA polymera yes N/A 0.606 0.242 0.366 2e-07
O94553 301 Probable DNA-directed RNA yes N/A 0.461 0.179 0.388 4e-07
P32910 317 DNA-directed RNA polymera yes N/A 0.444 0.164 0.442 7e-06
>sp|Q921X6|RPC6_MOUSE DNA-directed RNA polymerase III subunit RPC6 OS=Mus musculus GN=Polr3f PE=1 SV=1 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 62/72 (86%)

Query: 12  LLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLE 71
           LLY++KD     K+K SDN+EK+VY+IIE+AGNKGIW RDIR+KSNL  T++NKILK LE
Sbjct: 72  LLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINKILKNLE 131

Query: 72  TKKIIKAVKSVA 83
           +KK+IKAVKSVA
Sbjct: 132 SKKLIKAVKSVA 143




DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. May direct RNA Pol III binding to the TFIIIB-DNA complex. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway.
Mus musculus (taxid: 10090)
>sp|Q9H1D9|RPC6_HUMAN DNA-directed RNA polymerase III subunit RPC6 OS=Homo sapiens GN=POLR3F PE=1 SV=1 Back     alignment and function description
>sp|Q2T9S3|RPC6_BOVIN DNA-directed RNA polymerase III subunit RPC6 OS=Bos taurus GN=POLR3F PE=2 SV=1 Back     alignment and function description
>sp|Q9VD25|RPC6_DROME Probable DNA-directed RNA polymerase III subunit RPC6 OS=Drosophila melanogaster GN=CG5380 PE=2 SV=1 Back     alignment and function description
>sp|P91529|RPC6_CAEEL Probable DNA-directed RNA polymerase III subunit RPC6 OS=Caenorhabditis elegans GN=W09C3.4 PE=3 SV=1 Back     alignment and function description
>sp|Q86JM3|RPC6_DICDI DNA-directed RNA polymerase III subunit rpc6 OS=Dictyostelium discoideum GN=polr3f PE=3 SV=1 Back     alignment and function description
>sp|O94553|RPC6_SCHPO Probable DNA-directed RNA polymerase III subunit rpc6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc6 PE=2 SV=1 Back     alignment and function description
>sp|P32910|RPC6_YEAST DNA-directed RNA polymerase III subunit RPC6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC34 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
383863773 310 PREDICTED: DNA-directed RNA polymerase I 0.666 0.251 0.769 4e-26
380025937 311 PREDICTED: LOW QUALITY PROTEIN: DNA-dire 0.666 0.250 0.769 5e-26
66509068 311 PREDICTED: DNA-directed RNA polymerase I 0.666 0.250 0.769 5e-26
156551159 305 PREDICTED: DNA-directed RNA polymerase I 0.666 0.255 0.769 1e-25
350410921 311 PREDICTED: DNA-directed RNA polymerase I 0.666 0.250 0.756 2e-25
340714612 311 PREDICTED: DNA-directed RNA polymerase I 0.666 0.250 0.756 2e-25
307207698 331 DNA-directed RNA polymerase III subunit 0.641 0.226 0.733 2e-23
332372876 305 unknown [Dendroctonus ponderosae] 0.632 0.242 0.770 2e-23
242022647 315 DNA-directed RNA polymerase III subunit 0.666 0.247 0.679 1e-22
291222494 309 PREDICTED: Polr3f protein-like [Saccoglo 0.632 0.239 0.662 6e-22
>gi|383863773|ref|XP_003707354.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC6-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 60/78 (76%), Positives = 67/78 (85%)

Query: 6   FLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNK 65
           F  GG+LLY++KDP   +  K +DNEEK+VY IIEEAGNKGIW+RDIRFKSNLMPTQLNK
Sbjct: 71  FKQGGSLLYRLKDPSKAKVAKGADNEEKIVYTIIEEAGNKGIWIRDIRFKSNLMPTQLNK 130

Query: 66  ILKQLETKKIIKAVKSVA 83
           ILK LETKK IKAVKSVA
Sbjct: 131 ILKSLETKKFIKAVKSVA 148




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380025937|ref|XP_003696719.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III subunit RPC6-like [Apis florea] Back     alignment and taxonomy information
>gi|66509068|ref|XP_624984.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|156551159|ref|XP_001604309.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC6-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350410921|ref|XP_003489178.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714612|ref|XP_003395820.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307207698|gb|EFN85335.1| DNA-directed RNA polymerase III subunit RPC6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332372876|gb|AEE61580.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|242022647|ref|XP_002431750.1| DNA-directed RNA polymerase III subunit F, putative [Pediculus humanus corporis] gi|212517075|gb|EEB19012.1| DNA-directed RNA polymerase III subunit F, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|291222494|ref|XP_002731250.1| PREDICTED: Polr3f protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
FB|FBgn0038951 293 CG5380 [Drosophila melanogaste 0.632 0.252 0.706 3.4e-22
UNIPROTKB|F1MYX7 316 POLR3F "DNA-directed RNA polym 0.615 0.227 0.694 3.4e-22
UNIPROTKB|Q2T9S3 316 POLR3F "DNA-directed RNA polym 0.615 0.227 0.694 3.4e-22
UNIPROTKB|E2RG78 316 POLR3F "Uncharacterized protei 0.615 0.227 0.694 3.4e-22
UNIPROTKB|Q9H1D9 316 POLR3F "DNA-directed RNA polym 0.615 0.227 0.694 3.4e-22
UNIPROTKB|F1SBH4 316 POLR3F "Uncharacterized protei 0.615 0.227 0.694 3.4e-22
MGI|MGI:1924086 316 Polr3f "polymerase (RNA) III ( 0.615 0.227 0.694 3.4e-22
RGD|1306428 371 Polr3f "polymerase (RNA) III ( 0.615 0.194 0.694 3.4e-22
ZFIN|ZDB-GENE-040426-972 314 polr3f "polymerase (RNA) III ( 0.615 0.229 0.694 3.4e-22
UNIPROTKB|E1BU41 314 POLR3F "Uncharacterized protei 0.615 0.229 0.680 5.5e-22
FB|FBgn0038951 CG5380 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 258 (95.9 bits), Expect = 3.4e-22, P = 3.4e-22
 Identities = 53/75 (70%), Positives = 59/75 (78%)

Query:     9 GGNLLYKVKDPVTNEKL-KDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKIL 67
             G  L+Y+ KDP     L KD+DNEEKVVY I+EE GNKGIW+RDIR KSNL   QLNKIL
Sbjct:    56 GEKLVYRAKDPEKKSALPKDADNEEKVVYGIVEEGGNKGIWIRDIRMKSNLNMIQLNKIL 115

Query:    68 KQLETKKIIKAVKSV 82
             K LETKK+IKAVKSV
Sbjct:   116 KNLETKKLIKAVKSV 130




GO:0003899 "DNA-directed RNA polymerase activity" evidence=ISS;NAS
GO:0005666 "DNA-directed RNA polymerase III complex" evidence=ISS
GO:0006383 "transcription from RNA polymerase III promoter" evidence=NAS
GO:0005634 "nucleus" evidence=NAS
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1MYX7 POLR3F "DNA-directed RNA polymerase III subunit RPC6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9S3 POLR3F "DNA-directed RNA polymerase III subunit RPC6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RG78 POLR3F "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H1D9 POLR3F "DNA-directed RNA polymerase III subunit RPC6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBH4 POLR3F "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1924086 Polr3f "polymerase (RNA) III (DNA directed) polypeptide F" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306428 Polr3f "polymerase (RNA) III (DNA directed) polypeptide F" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-972 polr3f "polymerase (RNA) III (DNA directed) polypeptide F" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU41 POLR3F "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2T9S3RPC6_BOVINNo assigned EC number0.69440.61530.2278yesN/A
Q9VD25RPC6_DROMENo assigned EC number0.70660.63240.2525yesN/A
Q921X6RPC6_MOUSENo assigned EC number0.69440.61530.2278yesN/A
Q9H1D9RPC6_HUMANNo assigned EC number0.69440.61530.2278yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
pfam05158 312 pfam05158, RNA_pol_Rpc34, RNA polymerase Rpc34 sub 6e-23
COG5111 301 COG5111, RPC34, DNA-directed RNA polymerase III, s 9e-12
>gnl|CDD|218472 pfam05158, RNA_pol_Rpc34, RNA polymerase Rpc34 subunit Back     alignment and domain information
 Score = 90.1 bits (224), Expect = 6e-23
 Identities = 35/76 (46%), Positives = 47/76 (61%)

Query: 9   GGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILK 68
              L+YK       +K     +EE +VY IIEE+GN+GIW R I+ ++NL  + L K LK
Sbjct: 63  NDGLVYKAVTREEAKKKATLSDEESLVYSIIEESGNEGIWTRTIKNRTNLHQSVLKKCLK 122

Query: 69  QLETKKIIKAVKSVAN 84
            LE+KK IK+VKSV  
Sbjct: 123 SLESKKYIKSVKSVKA 138


Subunit specific to RNA Pol III, the tRNA specific polymerase. The C34 subunit of yeast RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and is therefore participates in Pol III recruitment. Length = 312

>gnl|CDD|227442 COG5111, RPC34, DNA-directed RNA polymerase III, subunit C34 [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 100.0
KOG3233|consensus 297 100.0
COG5111 301 RPC34 DNA-directed RNA polymerase III, subunit C34 99.97
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 98.09
COG2512258 Predicted membrane-associated trancriptional regul 98.03
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 98.0
PF1373055 HTH_36: Helix-turn-helix domain 97.98
PF0418275 B-block_TFIIIC: B-block binding subunit of TFIIIC; 97.95
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 97.83
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 97.75
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 97.69
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 97.62
COG1846126 MarR Transcriptional regulators [Transcription] 97.48
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 97.34
PRK10870176 transcriptional repressor MprA; Provisional 97.29
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 97.26
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 97.07
TIGR00498 199 lexA SOS regulatory protein LexA. LexA acts as a h 97.04
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 97.03
PRK13777185 transcriptional regulator Hpr; Provisional 96.9
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 96.89
PRK03573144 transcriptional regulator SlyA; Provisional 96.88
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 96.87
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 96.65
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 96.64
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 96.55
PRK00215 205 LexA repressor; Validated 96.52
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 96.52
PRK11920153 rirA iron-responsive transcriptional regulator; Re 96.51
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 96.37
COG1959150 Predicted transcriptional regulator [Transcription 96.35
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 96.22
PRK11014141 transcriptional repressor NsrR; Provisional 96.18
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 96.15
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 96.11
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 96.1
COG3355126 Predicted transcriptional regulator [Transcription 95.98
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 95.97
PF0229566 z-alpha: Adenosine deaminase z-alpha domain; Inter 95.75
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 95.68
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 95.59
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 95.56
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 95.54
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 95.52
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 95.5
COG1522154 Lrp Transcriptional regulators [Transcription] 95.32
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 95.3
PF1000792 DUF2250: Uncharacterized protein conserved in arch 95.13
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 95.05
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 94.81
TIGR02702 203 SufR_cyano iron-sulfur cluster biosynthesis transc 94.73
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 94.66
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 94.65
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 94.56
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 94.21
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 93.88
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 93.76
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 93.62
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 93.59
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 93.46
COG1378 247 Predicted transcriptional regulators [Transcriptio 93.44
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 93.37
PRK09391230 fixK transcriptional regulator FixK; Provisional 93.1
PRK12423 202 LexA repressor; Provisional 93.06
PF03965115 Penicillinase_R: Penicillinase repressor; InterPro 92.58
PRK03902142 manganese transport transcriptional regulator; Pro 92.51
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 92.5
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 92.49
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 92.35
PRK09462148 fur ferric uptake regulator; Provisional 92.09
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 92.05
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 91.72
PRK14165 217 winged helix-turn-helix domain-containing protein/ 91.65
PRK11169164 leucine-responsive transcriptional regulator; Prov 91.48
PRK11050152 manganese transport regulator MntR; Provisional 91.36
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 91.34
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 91.18
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 90.86
PRK06474178 hypothetical protein; Provisional 90.61
PRK11161235 fumarate/nitrate reduction transcriptional regulat 90.58
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 90.39
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 89.98
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 89.9
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 89.86
PRK10163 271 DNA-binding transcriptional repressor AllR; Provis 89.39
PRK09954 362 putative kinase; Provisional 89.36
PF05732165 RepL: Firmicute plasmid replication protein (RepL) 89.31
PRK0933486 30S ribosomal protein S25e; Provisional 89.28
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 89.13
TIGR02431 248 pcaR_pcaU beta-ketoadipate pathway transcriptional 88.89
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 88.66
COG1414 246 IclR Transcriptional regulator [Transcription] 88.23
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 88.08
PF0920282 Rio2_N: Rio2, N-terminal; InterPro: IPR015285 This 87.99
PHA00738108 putative HTH transcription regulator 87.9
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 87.81
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 87.6
smart00531147 TFIIE Transcription initiation factor IIE. 87.22
PRK15090 257 DNA-binding transcriptional regulator KdgR; Provis 87.21
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 87.04
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 86.72
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 86.66
PRK11569 274 transcriptional repressor IclR; Provisional 86.36
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 86.26
PRK09834 263 DNA-binding transcriptional activator MhpR; Provis 86.03
PRK10046225 dpiA two-component response regulator DpiA; Provis 85.98
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 85.98
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 85.71
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 85.49
PHA02701183 ORF020 dsRNA-binding PKR inhibitor; Provisional 85.36
COG1725125 Predicted transcriptional regulators [Transcriptio 84.96
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 84.52
COG3888 321 Predicted transcriptional regulator [Transcription 84.18
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 84.0
COG1733120 Predicted transcriptional regulators [Transcriptio 83.8
COG3398240 Uncharacterized protein conserved in archaea [Func 83.57
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 83.54
PF06163127 DUF977: Bacterial protein of unknown function (DUF 82.61
PRK10736374 hypothetical protein; Provisional 82.61
TIGR02325 238 C_P_lyase_phnF phosphonates metabolism transcripti 81.87
PRK09483217 response regulator; Provisional 81.32
PF04492100 Phage_rep_O: Bacteriophage replication protein O ; 81.22
cd0476149 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of 81.18
PRK13509 251 transcriptional repressor UlaR; Provisional 80.78
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 80.46
PHA02943165 hypothetical protein; Provisional 80.39
PRK09764 240 DNA-binding transcriptional repressor MngR; Provis 80.31
PRK06266178 transcription initiation factor E subunit alpha; V 80.24
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
Probab=100.00  E-value=7.8e-38  Score=257.56  Aligned_cols=103  Identities=45%  Similarity=0.662  Sum_probs=65.6

Q ss_pred             ccceecCCeEEEEEeCccccccccCCCHHHHHHHHHHHHhcCCcccHHHHHhhcCCChHHHHHHHHHHhhcCCeeeeccc
Q psy7778           3 ANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSV   82 (117)
Q Consensus         3 ~~~~~~~~~l~yk~~~~e~a~k~~~L~~eE~lVY~~Ie~AGn~GIWtkdIk~ktnL~~~~l~K~LK~LE~k~LIK~VKsV   82 (117)
                      ..+++.+++++|+++++++|+++++|+++|++||++|++|||+|||++|||.+||||+++|+||||+||+|+|||+||||
T Consensus        57 ~~~~~~~~~l~~~~~~~~~a~k~~~l~~~e~lvy~~I~~ag~~GIw~~~i~~~t~l~~~~~~k~lk~Le~k~lIK~vksv  136 (327)
T PF05158_consen   57 LKLLKKGGGLSYKAVSEEEAKKLKGLSDEERLVYQLIEEAGNKGIWTKDIKKKTNLHQTQLTKILKSLESKKLIKSVKSV  136 (327)
T ss_dssp             EEEEE-SSSEEEEE--SSS-----SSSCCHHHHHHHHHHHTTT-EEHHHHHHHCT--HHHHHHHHHHHHHTTSEEEE--S
T ss_pred             EEEEEcCCEEEEEEeCHHHHhhhcCCCHHHHHHHHHHHHhCCCCCcHHHHHHHcCCCHHHHHHHHHHHHhCCCEEEecCc
Confidence            45778889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             c-------------------CCcccccCccccccchhhhhhh
Q psy7778          83 A-------------------NIEYLTEGTVNAMVLPSRKKRE  105 (117)
Q Consensus        83 ~-------------------gg~wYtdg~~D~~fI~~l~~~~  105 (117)
                      +                   ||+||+||+||++||+.|++.-
T Consensus       137 ~~~~rK~Yml~~l~Ps~eiTGG~wy~d~e~D~efi~~l~~~~  178 (327)
T PF05158_consen  137 KNPNRKVYMLYDLEPSEEITGGPWYTDGEFDTEFIDVLREQC  178 (327)
T ss_dssp             S-SS--EEEESSS-----------------------------
T ss_pred             CCCCeEEEEEccCCcCcccCCCCcccCCcccHHHHHHHHHHH
Confidence            7                   9999999999999999998753



The C34 subunit of Saccharomyces cerevisiae RNA Pol III is part of a subcomplex of three subunits which have no counterpart in the other two nuclear RNA polymerases. This subunit interacts with TFIIIB70 and therefore participates in Pol III recruitment [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2DK8_A 2DK5_A 2YU3_A.

>KOG3233|consensus Back     alignment and domain information
>COG5111 RPC34 DNA-directed RNA polymerase III, subunit C34 [Transcription] Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF02295 z-alpha: Adenosine deaminase z-alpha domain; InterPro: IPR000607 Double-stranded RNA-specific adenosine deaminase (3 Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09202 Rio2_N: Rio2, N-terminal; InterPro: IPR015285 This N-terminal domain is found in RIO2 kinases, and is structurally homologous to the winged helix (wHTH) domain Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>COG3888 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG3398 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>PRK10736 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02325 C_P_lyase_phnF phosphonates metabolism transcriptional regulator PhnF Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PF04492 Phage_rep_O: Bacteriophage replication protein O ; InterPro: IPR006497 This entry is represented by the N-terminal domain of Bacteriophage lambda, GpO Back     alignment and domain information
>cd04761 HTH_MerR-SF Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PRK09764 DNA-binding transcriptional repressor MngR; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
2yu3_A95 Solution Structure Of The Domain Swapped Wingedheli 3e-22
2dk5_A91 Solution Structure Of Winged-Helix Domain In Rna Po 7e-20
>pdb|2YU3|A Chain A, Solution Structure Of The Domain Swapped Wingedhelix In Dna- Directed Rna Polymerase Iii 39 Kda Polypeptide Length = 95 Back     alignment and structure

Iteration: 1

Score = 100 bits (248), Expect = 3e-22, Method: Compositional matrix adjust. Identities = 48/72 (66%), Positives = 62/72 (86%) Query: 12 LLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLE 71 LLY++KD K+K SDN+EK+VY+IIE+AGNKGIW RD+R+KSNL T++NKILK LE Sbjct: 19 LLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLE 78 Query: 72 TKKIIKAVKSVA 83 +KK+IKAVKSV+ Sbjct: 79 SKKLIKAVKSVS 90
>pdb|2DK5|A Chain A, Solution Structure Of Winged-Helix Domain In Rna Polymerase Iii 39kda Polypeptide Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 1e-28
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 4e-26
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
 Score = 98.7 bits (246), Expect = 1e-28
 Identities = 48/76 (63%), Positives = 62/76 (81%)

Query: 9  GGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILK 68
             LLY++KD     K+K SDN+EK+VY+IIE+AGNKGIW RD+R+KSNL  T++NKILK
Sbjct: 16 NTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILK 75

Query: 69 QLETKKIIKAVKSVAN 84
           LE+KK+IKAVKSV+ 
Sbjct: 76 NLESKKLIKAVKSVSG 91


>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 99.97
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 99.8
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 97.81
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 97.79
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 97.72
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 97.55
1p6r_A82 Penicillinase repressor; transcription regulation, 97.52
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 97.51
1sfx_A109 Conserved hypothetical protein AF2008; structural 97.48
2frh_A127 SARA, staphylococcal accessory regulator A; winged 97.45
2nnn_A140 Probable transcriptional regulator; structural gen 97.45
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 97.45
3r0a_A123 Putative transcriptional regulator; structural gen 97.44
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 97.42
2vn2_A128 DNAD, chromosome replication initiation protein; D 97.41
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 97.4
3nqo_A189 MARR-family transcriptional regulator; structural 97.39
3ech_A142 MEXR, multidrug resistance operon repressor; winge 97.39
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 97.37
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 97.36
3e6m_A161 MARR family transcriptional regulator; APC88769, s 97.36
1z91_A147 Organic hydroperoxide resistance transcriptional; 97.35
3oop_A143 LIN2960 protein; protein structure initiative, PSI 97.34
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 97.33
3bdd_A142 Regulatory protein MARR; putative multiple antibio 97.31
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 97.31
1qbj_A81 Protein (double-stranded RNA specific adenosine D 97.31
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 97.3
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 97.3
1ku9_A152 Hypothetical protein MJ223; putative transcription 97.3
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 97.29
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 97.28
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 97.28
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 97.27
3cjn_A162 Transcriptional regulator, MARR family; silicibact 97.25
1okr_A123 MECI, methicillin resistance regulatory protein ME 97.24
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 97.24
2eth_A154 Transcriptional regulator, putative, MAR family; M 97.24
2gxg_A146 146AA long hypothetical transcriptional regulator; 97.23
3bja_A139 Transcriptional regulator, MARR family, putative; 97.22
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 97.22
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 97.21
3f3x_A144 Transcriptional regulator, MARR family, putative; 97.21
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 97.2
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 97.2
1s3j_A155 YUSO protein; structural genomics, MARR transcript 97.19
1p4x_A 250 Staphylococcal accessory regulator A homologue; wi 97.19
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 97.18
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 97.18
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 97.17
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 97.14
2nyx_A168 Probable transcriptional regulatory protein, RV14; 97.13
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 97.11
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 97.1
2pex_A153 Transcriptional regulator OHRR; transcription regu 97.08
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 97.05
4aik_A151 Transcriptional regulator SLYA; transcription, tra 97.05
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 97.03
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 97.03
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 97.02
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 97.0
3s2w_A159 Transcriptional regulator, MARR family; structural 96.98
2hr3_A147 Probable transcriptional regulator; MCSG, structur 96.96
1hsj_A487 Fusion protein consisting of staphylococcus access 96.94
2fxa_A207 Protease production regulatory protein HPR; protea 96.9
3boq_A160 Transcriptional regulator, MARR family; MARR famil 96.9
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 96.86
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 96.8
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 96.72
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 96.71
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 96.71
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 96.69
2obp_A96 Putative DNA-binding protein; structural genomics, 96.61
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 96.6
4fx0_A148 Probable transcriptional repressor protein; helix- 96.54
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 96.53
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 96.49
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 96.4
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 96.31
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependen 96.27
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.23
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 96.23
2wte_A244 CSA3; antiviral protein, viral resistance, winged 96.21
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 96.16
2w25_A150 Probable transcriptional regulatory protein; trans 96.12
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 96.1
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 96.04
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 95.97
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 95.95
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 95.9
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 95.85
1y0u_A96 Arsenical resistance operon repressor, putative; s 95.68
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 95.68
2jt1_A77 PEFI protein; solution structure, winged helix-tur 95.65
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 95.65
2qq9_A 226 Diphtheria toxin repressor; regulator, DTXR, helix 95.62
3lwf_A159 LIN1550 protein, putative transcriptional regulato 95.62
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 95.42
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 95.41
1xd7_A145 YWNA; structural genomics, protein structure initi 95.41
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 95.38
1ylf_A149 RRF2 family protein; structural genomics, transcri 95.24
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 95.21
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 95.17
3df8_A111 Possible HXLR family transcriptional factor; APC89 95.07
2h09_A155 Transcriptional regulator MNTR; transcription regu 95.0
3k69_A162 Putative transcription regulator; putative transcr 94.95
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 94.94
3jth_A98 Transcription activator HLYU; transcription factor 94.93
2fe3_A145 Peroxide operon regulator; oxidative stress regula 94.92
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 94.9
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 94.77
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 94.75
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 94.64
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 94.62
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 94.52
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 94.51
1bja_A95 Transcription regulatory protein MOTA; activation 94.34
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 94.31
2w57_A150 Ferric uptake regulation protein; gene regulation, 94.22
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 94.22
3f6o_A118 Probable transcriptional regulator, ARSR family pr 94.21
2pg4_A95 Uncharacterized protein; structural genomics, join 94.19
1z6r_A 406 MLC protein; transcriptional repressor, ROK family 94.09
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 94.07
2kko_A108 Possible transcriptional regulatory protein (possi 94.04
1z05_A 429 Transcriptional regulator, ROK family; structural 94.01
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 93.94
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 93.91
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 93.87
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 93.85
3cta_A 230 Riboflavin kinase; structural genomics, transferas 93.85
3b02_A195 Transcriptional regulator, CRP family; structural 93.76
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 93.74
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 93.36
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 93.3
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 93.15
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 93.12
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 93.11
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 93.06
2p4w_A 202 Transcriptional regulatory protein ARSR family; ar 92.97
1mkm_A 249 ICLR transcriptional regulator; structural genomic 92.97
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 92.69
1jhf_A 202 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 92.67
2hoe_A 380 N-acetylglucosamine kinase; TM1224, structural gen 92.56
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 92.46
2xrn_A 241 HTH-type transcriptional regulator TTGV; DNA-bindi 92.27
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 92.25
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 92.06
1ft9_A222 Carbon monoxide oxidation system transcription reg 91.9
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 91.82
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 91.78
3f6v_A151 Possible transcriptional regulator, ARSR family pr 91.67
1yyv_A131 Putative transcriptional regulator; reductive meth 91.66
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 91.57
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 91.46
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 91.4
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 91.32
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 91.25
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 91.22
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 91.15
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 91.13
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 91.07
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 91.02
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 90.97
3l7w_A108 Putative uncharacterized protein SMU.1704; PADR, t 90.97
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 90.95
3by6_A126 Predicted transcriptional regulator; structural ge 90.91
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 90.89
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 90.71
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 90.48
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 90.4
2p8t_A 200 Hypothetical protein PH0730; pyrococcus horikoshii 90.4
2pi2_A270 Replication protein A 32 kDa subunit; FULL-length 90.38
3lmm_A583 Uncharacterized protein; multi-domained alpha-beta 90.02
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 89.93
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 89.4
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 89.4
3mq0_A 275 Transcriptional repressor of the blcabc operon; he 88.99
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 88.99
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 88.78
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 88.6
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 88.01
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 88.01
3maj_A382 DNA processing chain A; MCSG, PSI-2, structural ge 87.96
2g7u_A 257 Transcriptional regulator; ICLR family, structural 87.67
3c57_A95 Two component transcriptional regulatory protein; 87.28
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 87.26
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 86.94
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 86.79
2xzm_8143 RPS25E,; ribosome, translation; 3.93A {Tetrahymena 86.72
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 86.7
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 86.27
2o0y_A 260 Transcriptional regulator; ICLR-family, structural 85.79
3u5c_Z108 RP45, S31, YS23, 40S ribosomal protein S25-A; tran 84.95
3edp_A 236 LIN2111 protein; APC88337, listeria innocua CLIP11 84.91
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 84.84
4ets_A162 Ferric uptake regulation protein; metal binding pr 84.79
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 84.45
3r4k_A 260 Transcriptional regulator, ICLR family; DNA/RNA-bi 84.41
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 84.3
2qlz_A 232 Transcription factor PF0095; 2.50A {Pyrococcus fur 84.16
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 84.09
4g6q_A182 Putative uncharacterized protein; structural genom 83.62
2o0m_A 345 Transcriptional regulator, SORC family; structural 83.41
1xma_A145 Predicted transcriptional regulator; southea colla 83.41
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, st 83.3
4esb_A115 Transcriptional regulator, PADR family; DNA bindin 83.29
3iz6_V108 40S ribosomal protein S25 (S25E); eukaryotic ribos 83.2
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 82.76
3hhh_A116 Transcriptional regulator, PADR family; PF03551, s 82.56
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 82.15
2esh_A118 Conserved hypothetical protein TM0937; APC5794, st 81.81
3ic7_A126 Putative transcriptional regulator; helix-turn-hel 81.55
4esf_A117 PADR-like transcriptional regulator; PADR family, 81.51
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 80.98
3qph_A 342 TRMB, A global transcription regulator; transcript 80.81
1hw1_A 239 FADR, fatty acid metabolism regulator protein; hel 80.55
3ri2_A123 Transcriptional regulator, PADR-like family; PSI-b 80.5
3eet_A 272 Putative GNTR-family transcriptional regulator; st 80.48
1stz_A 338 Heat-inducible transcription repressor HRCA homol; 80.43
2wv0_A 243 YVOA, HTH-type transcriptional repressor YVOA; DNA 80.28
3bwg_A 239 Uncharacterized HTH-type transcriptional regulato; 80.05
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.97  E-value=7.6e-31  Score=183.64  Aligned_cols=83  Identities=58%  Similarity=0.861  Sum_probs=79.9

Q ss_pred             ccceecCCeEEEEEeCccccccccCCCHHHHHHHHHHHHhcCCcccHHHHHhhcCCChHHHHHHHHHHhhcCCeeeeccc
Q psy7778           3 ANGFLIGGNLLYKVKDPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSV   82 (117)
Q Consensus         3 ~~~~~~~~~l~yk~~~~e~a~k~~~L~~eE~lVY~~Ie~AGn~GIWtkdIk~ktnL~~~~l~K~LK~LE~k~LIK~VKsV   82 (117)
                      ..+|+.+++++|+++++++|.++++||++|++||++|++|||+|||++||+.++|||+++|+||||.||+++|||+|+||
T Consensus        10 ~~l~k~~~~l~~~~~~~~~a~k~~~Lt~~E~lVy~~I~~aGn~GIw~kdL~~~tnL~~~~vtkiLK~LE~k~lIK~Vksv   89 (95)
T 2yu3_A           10 LDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSV   89 (95)
T ss_dssp             CCCCCCCCCCEEEECCSSSCCCCCSCSHHHHHHHHHHHHHTTSCEEHHHHHHHHTCCHHHHHHHHHHHHHHTSEEEECCS
T ss_pred             EEEEEcCCEEEEEEeCHHHHhhhcCCCHHHHHHHHHHHHhCCCCCCHHHHHHHhCCCHHHHHHHHHHHHhCCCEEEecCc
Confidence            35788899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCC
Q psy7778          83 ANI   85 (117)
Q Consensus        83 ~gg   85 (117)
                      ++.
T Consensus        90 ~~~   92 (95)
T 2yu3_A           90 SGP   92 (95)
T ss_dssp             CSS
T ss_pred             cCC
Confidence            864



>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>1jhf_A LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.2 b.87.1.1 PDB: 1jhh_A 3jso_A* 3jsp_A* 3k3r_E* 1jhc_A 1jhe_A 1lea_A 1leb_A Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>3l7w_A Putative uncharacterized protein SMU.1704; PADR, transcriptional factor, transcription; HET: MSE; 2.20A {Streptococcus mutans} SCOP: a.4.5.0 Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxan replication, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>3lmm_A Uncharacterized protein; multi-domained alpha-beta protein, structural genomics, PSI- 2, protein structure initiative; 3.00A {Corynebacterium diphtheriae} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2xzm_8 RPS25E,; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_8 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>3u5c_Z RP45, S31, YS23, 40S ribosomal protein S25-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_V 3o30_Q 3o2z_Q 3u5g_Z Back     alignment and structure
>3edp_A LIN2111 protein; APC88337, listeria innocua CLIP11262, structural GE PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.09A {Listeria innocua} Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>1xma_A Predicted transcriptional regulator; southea collaboratory for structural genomics, secsg, protein struc initiative, PSI; 2.30A {Clostridium thermocellum} SCOP: a.4.5.61 Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>4esb_A Transcriptional regulator, PADR family; DNA binding protein, HTH fold; 2.50A {Bacillus cereus} Back     alignment and structure
>3iz6_V 40S ribosomal protein S25 (S25E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>3hhh_A Transcriptional regulator, PADR family; PF03551, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.70A {Enterococcus faecalis} SCOP: a.4.5.0 Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2esh_A Conserved hypothetical protein TM0937; APC5794, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.4.5.61 Back     alignment and structure
>3ic7_A Putative transcriptional regulator; helix-turn-helix, structural genomics, PSI-2, protein struct initiative; 2.82A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qph_A TRMB, A global transcription regulator; transcriptional regulator; HET: SUC; 2.99A {Pyrococcus furiosus} Back     alignment and structure
>1hw1_A FADR, fatty acid metabolism regulator protein; helix-turn-helix, helix bundle, transcription; 1.50A {Escherichia coli} SCOP: a.4.5.6 a.78.1.1 PDB: 1hw2_A 1e2x_A 1h9g_A* 1h9t_A Back     alignment and structure
>3eet_A Putative GNTR-family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.97A {Streptomyces avermitilis} Back     alignment and structure
>1stz_A Heat-inducible transcription repressor HRCA homol; circe element, structural genomics, BSGC structure FUN NIH, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.51 d.110.2.3 Back     alignment and structure
>2wv0_A YVOA, HTH-type transcriptional repressor YVOA; DNA-binding, transcription regulation, transcriptional regulator, GNTR/HUTC family; 2.40A {Bacillus subtilis} Back     alignment and structure
>3bwg_A Uncharacterized HTH-type transcriptional regulato; APC85486, YYDK, transcriptional regulator, structural genomi 2; 2.09A {Bacillus subtilis subsp} SCOP: a.4.5.6 d.190.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
d2dk5a178 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III 2e-24
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: RPO3F domain-like
domain: DNA-directed RNA polymerase III subunit RPC6, RPO3F
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 86.7 bits (215), Expect = 2e-24
 Identities = 45/67 (67%), Positives = 56/67 (83%)

Query: 18 DPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIK 77
          D     K+K SDN+EK+VY+IIE+AGNKGIW RD+R+KSNL  T++NKILK LE+KK+IK
Sbjct: 1  DSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIK 60

Query: 78 AVKSVAN 84
          AVKSVA 
Sbjct: 61 AVKSVAA 67


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d2dk5a178 DNA-directed RNA polymerase III subunit RPC6, RPO3 99.96
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 97.75
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 97.66
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 97.66
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 97.63
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 97.62
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 97.57
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 97.54
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 97.52
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 97.41
d1z91a1137 Organic hydroperoxide resistance transcriptional r 97.33
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 97.31
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 97.3
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 97.26
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 97.24
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 97.24
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 97.23
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 97.15
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 97.14
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 97.12
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 97.1
d1xd7a_127 Hypothetical protein ywnA {Bacillus subtilis [TaxI 97.09
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 97.03
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 96.99
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 96.93
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 96.89
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 96.82
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.72
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 96.56
d1okra_120 Methicillin resistance regulatory protein MecI {St 96.32
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 95.8
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 95.77
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 95.75
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 95.71
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 95.64
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 95.6
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 95.59
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 95.44
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 95.04
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.83
d1mkma175 Transcriptional regulator IclR, N-terminal domain 94.82
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 94.66
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 94.57
d2g9wa1122 Hypothetical protein Rv1846c {Mycobacterium tuberc 94.43
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 94.01
d1i5za169 Catabolite gene activator protein (CAP), C-termina 93.13
d1xmka173 Z-alpha domain of dsRNA-specific adenosine deamina 93.03
d1zyba173 Probable transcription regulator BT4300, C-termina 92.73
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 92.39
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 92.22
d1w5sa1110 CDC6-like protein APE0152, C-terminal domain {Aero 91.79
d1p6ra_82 Penicillinase repressor BlaI {Bacillus licheniform 91.57
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 91.36
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 91.2
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 91.13
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 90.67
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 90.58
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 90.44
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 90.41
d1zara189 Rio2 serine protein kinase N-terminal domain {Arch 90.11
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 90.07
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 89.45
d1hw1a174 Fatty acid responsive transcription factor FadR, N 89.41
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginos 88.89
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 88.35
d1fnna1112 CDC6, C-terminal domain {Archaeon Pyrobaculum aero 88.29
d1v4ra1100 Transcriptional repressor TraR, N-terminal domain 88.18
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 87.26
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 86.59
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 85.51
d2hzta195 Putative transcriptional regulator YtcD {Bacillus 85.42
d2fswa1102 Hypothetical protein PG0823 {Porphyromonas gingiva 84.62
d1yyva1114 Putative transcriptional regulator YtfH {Salmonell 83.33
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 80.71
d1yioa170 Response regulatory protein StyR, C-terminal domai 80.08
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: RPO3F domain-like
domain: DNA-directed RNA polymerase III subunit RPC6, RPO3F
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=9.8e-31  Score=176.54  Aligned_cols=68  Identities=66%  Similarity=0.964  Sum_probs=65.6

Q ss_pred             CccccccccCCCHHHHHHHHHHHHhcCCcccHHHHHhhcCCChHHHHHHHHHHhhcCCeeeeccccCC
Q psy7778          18 DPVTNEKLKDSDNEEKVVYKIIEEAGNKGIWMRDIRFKSNLMPTQLNKILKQLETKKIIKAVKSVANI   85 (117)
Q Consensus        18 ~~e~a~k~~~L~~eE~lVY~~Ie~AGn~GIWtkdIk~ktnL~~~~l~K~LK~LE~k~LIK~VKsV~gg   85 (117)
                      ++++|+++++|+++|++||++|++|||+|||++|||.+||||+++|+||||+||+++|||+|+||++.
T Consensus         1 d~~~a~k~~~l~~~E~lVY~~I~~ag~~GIW~~dir~ktnL~~~~l~K~LK~Lesk~lIK~VksV~~~   68 (78)
T d2dk5a1           1 DSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVKSVAAS   68 (78)
T ss_dssp             CCCCCCCCCCSCSSHHHHHHHHHHHCTTCEEHHHHHHHTTCCHHHHHHHHHHHHHTTSEEEECCSSCS
T ss_pred             CHHHHHHHhCCCHHHHHHHHHHHHccccceeHHHHHHHcCCCHHHHHHHHHHHHhcCCceeecccCCC
Confidence            56889999999999999999999999999999999999999999999999999999999999999854



>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w5sa1 a.4.5.11 (A:300-409) CDC6-like protein APE0152, C-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zara1 a.4.5.56 (A:2-90) Rio2 serine protein kinase N-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna1 a.4.5.11 (A:277-388) CDC6, C-terminal domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1v4ra1 a.4.5.6 (A:1-100) Transcriptional repressor TraR, N-terminal domain {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure