Psyllid ID: psy7790

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------
SSNESDDEHYVPYVSVKERKKQKLIQLGRLAQERHEEKKKLVLSDDEDNNKDSTDEENDESKVWGRMSNISLLDQHSELKKMAEAKKESAKEKQLKEEEKILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTEAKIKKREHGV
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccEEcccccccccccHHHcccccEEEcccHHHHHHHHHccEEEEcccccccccccEEEEcccHHHHHHHHHccccccccccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccccEEEEEcccccccccccEEEEEEEEcHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEcccccccccccc
ccccccccccccEEcccHHHHHHHHHHHHHHHHHccccccHHHHHHccHHcccccEEEEccccccccccHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccccccccccccccEEEEEEcHHHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHHHccHHcEEEEEEccccHHHHHHHHHHHcccEEEEEEEEcEEcccHcEEEEEEEEccHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHcccccEEEEEHHHHccccccccEEEEEEcccccHHHccc
ssnesddehyvpyvsvkerKKQKLIQLGRLAQERHEEKKKLVlsddednnkdstdeendeskvwgrmsnislLDQHSELKKMAEAKKESAKEKQLKEEEKILRSVAETKALMGVAELAkgiqyndpiktswraprcilslpdqVHDIIRRNLRilvegddvppaccsfrlmkLPESLVRALEakgikkptpiqvqgipaalseDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSalvkpitinvgragkimpsmnvVQEVEYVKQEAKIVYLLEClqkteppvliFAEKKQDVDAIHEYLLLKGVEAvaihggkdqeertRSVESFRKGQKDVMVATDvaskgldfeEIKHVINTEAKIKKREHGV
ssnesddehyvpyvsvkerkkqkliqlgrlaqerheekkklvlsddednnkdstdeendeskvwgrmSNISLLDQHSELKKMAEAKkesakekqlkeeeKILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEakgikkptpiqvqgipAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEavaihggkdqeertrsvesfrkgqkdvmvatdvaskgldfeeikhvinteakikkrehgv
SSNESDDEHYVPYVSVKERKKQKLIQLGRLAQERHEEKKKLVLSDDEDNNKDSTDEENDESKVWGRMSNISLLDQHSelkkmaeakkesakekqlkeeekilRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTEAKIKKREHGV
********************************************************************************************************VAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHG**********************VATDVASKGLDFEEIKHVI*************
****SDD*HYVPYVSVKER*********************************************************************************ILRSVAETKALMGVAELAKGIQYNDP**TSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTEAKIKKREHGV
*********YVPYVSVKERKKQKLIQLGRLAQERHEEKKKL*********************VWGRMSNISLLDQHSELK****************EEEKILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHG***************KGQKDVMVATDVASKGLDFEEIKHVINTEAK********
*******EHYVPYVSVKERKKQKLIQLGRLAQERHEEKKKLVLSDDEDNNKDSTDEENDESKVWGRMSNISLLDQHSELKKMAEAKKESAKEKQLKEEEKILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTEAKIKK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSNESDDEHYVPYVSVKERKKQKLIQLGRLAQERHEEKKKLVLSDDEDNNKDSTDEENDESKVWGRMSNISLxxxxxxxxxxxxxxxxxxxxxxxxxxxxILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVPPACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTEAKIKKREHGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query367 2.2.26 [Sep-21-2011]
Q9V3C0 619 ATP-dependent RNA helicas yes N/A 0.433 0.256 0.807 3e-72
Q91VN6 622 Probable ATP-dependent RN yes N/A 0.433 0.255 0.788 2e-70
Q9UJV9 622 Probable ATP-dependent RN yes N/A 0.433 0.255 0.788 2e-70
Q9LU46 591 DEAD-box ATP-dependent RN yes N/A 0.446 0.277 0.702 4e-63
Q0E3X4 627 DEAD-box ATP-dependent RN yes N/A 0.446 0.261 0.678 1e-62
Q9SZB4 542 Putative DEAD-box ATP-dep no N/A 0.425 0.287 0.715 2e-61
Q5Z6G5 619 DEAD-box ATP-dependent RN no N/A 0.446 0.264 0.654 2e-58
Q54KG1 671 Probable ATP-dependent RN yes N/A 0.427 0.233 0.685 2e-57
O13370 636 ATP-dependent RNA helicas yes N/A 0.381 0.220 0.452 6e-26
P06634 604 ATP-dependent RNA helicas yes N/A 0.386 0.235 0.427 1e-25
>sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 Back     alignment and function desciption
 Score =  272 bits (695), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 130/161 (80%), Positives = 145/161 (90%), Gaps = 2/161 (1%)

Query: 197 IPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMN 256
           I     EDVRTIFSFF+GQRQTLLFSATMPKKIQNFARSALVKP+TINVGRAG    SMN
Sbjct: 346 IDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPVTINVGRAGA--ASMN 403

Query: 257 VVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKD 316
           V Q+VEYVKQEAK+VYLL+CLQKT PPVLIFAEKKQDVD IHEYLLLKGVEAVAIHGGKD
Sbjct: 404 VTQQVEYVKQEAKVVYLLDCLQKTAPPVLIFAEKKQDVDCIHEYLLLKGVEAVAIHGGKD 463

Query: 317 QEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTE 357
           QEER+R+V+++R G+KDV+VATDVASKGLDF  ++HVIN +
Sbjct: 464 QEERSRAVDAYRVGKKDVLVATDVASKGLDFPNVQHVINYD 504
ATP-dependent RNA helicase. Is essential for the directed and fasciculated early outgrowth of the bolwig nerves, as well as for its navigation at later stages. Is required during post-transcriptional gene expression. Plays a role during morphogenetic process, apoptosis and the establishment of cell polarity.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 Back     alignment and function description
>sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 Back     alignment and function description
>sp|Q9LU46|RH35_ARATH DEAD-box ATP-dependent RNA helicase 35 OS=Arabidopsis thaliana GN=RH35 PE=2 SV=1 Back     alignment and function description
>sp|Q0E3X4|RH35A_ORYSJ DEAD-box ATP-dependent RNA helicase 35A OS=Oryza sativa subsp. japonica GN=Os02g0150100 PE=2 SV=2 Back     alignment and function description
>sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 Back     alignment and function description
>sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 Back     alignment and function description
>sp|Q54KG1|DDX41_DICDI Probable ATP-dependent RNA helicase ddx41 OS=Dictyostelium discoideum GN=ddx41 PE=1 SV=1 Back     alignment and function description
>sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 Back     alignment and function description
>sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
193683780 615 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.258 0.863 2e-74
380024659 621 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.256 0.863 3e-74
328783258 621 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.256 0.863 3e-74
383858565 625 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.254 0.857 3e-74
340725455 625 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.254 0.857 6e-74
350415294 625 PREDICTED: ATP-dependent RNA helicase ab 0.433 0.254 0.857 6e-74
242016149 513 predicted protein [Pediculus humanus cor 0.433 0.309 0.850 2e-73
322784405 626 hypothetical protein SINV_10914 [Solenop 0.433 0.253 0.844 1e-72
307174080 620 ATP-dependent RNA helicase abstrakt [Cam 0.585 0.346 0.625 2e-72
332024917 625 ATP-dependent RNA helicase abstrakt [Acr 0.585 0.344 0.621 2e-72
>gi|193683780|ref|XP_001952119.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 2/161 (1%)

Query: 197 IPAALSEDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMN 256
           I     EDVRTIFSFF+GQRQTLLFSATMPKKIQNFARSALVKPITINVGRAG    SMN
Sbjct: 343 IDMGFEEDVRTIFSFFQGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGA--ASMN 400

Query: 257 VVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKD 316
           V+QEVEYVKQEAK+VYLLECL+KT PPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKD
Sbjct: 401 VIQEVEYVKQEAKVVYLLECLKKTTPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKD 460

Query: 317 QEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVINTE 357
           QEER++SV++FRKGQKDV+VATDVASKGLDFEEI+HVIN +
Sbjct: 461 QEERSKSVDAFRKGQKDVLVATDVASKGLDFEEIQHVINYD 501

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380024659|ref|XP_003696110.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Apis florea] Back     alignment and taxonomy information
>gi|328783258|ref|XP_392069.4| PREDICTED: ATP-dependent RNA helicase abstrakt isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383858565|ref|XP_003704771.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340725455|ref|XP_003401085.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415294|ref|XP_003490595.1| PREDICTED: ATP-dependent RNA helicase abstrakt-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242016149|ref|XP_002428698.1| predicted protein [Pediculus humanus corporis] gi|212513369|gb|EEB15960.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322784405|gb|EFZ11376.1| hypothetical protein SINV_10914 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307174080|gb|EFN64767.1| ATP-dependent RNA helicase abstrakt [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332024917|gb|EGI65105.1| ATP-dependent RNA helicase abstrakt [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query367
WB|WBGene00019245 630 sacy-1 [Caenorhabditis elegans 0.411 0.239 0.679 1.1e-72
UNIPROTKB|F1NAH6607 LOC100859810 "Uncharacterized 0.408 0.247 0.842 6.8e-67
FB|FBgn0015331 619 abs "abstrakt" [Drosophila mel 0.427 0.253 0.817 6.7e-65
ZFIN|ZDB-GENE-030131-1927 473 ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.427 0.331 0.798 3.7e-64
RGD|1311758 622 Ddx41 "DEAD (Asp-Glu-Ala-Asp) 0.408 0.241 0.828 9.7e-64
UNIPROTKB|E2R052 622 DDX41 "Uncharacterized protein 0.408 0.241 0.828 9.7e-64
UNIPROTKB|J9NZF6 649 DDX41 "Uncharacterized protein 0.408 0.231 0.828 9.7e-64
UNIPROTKB|A3KN07 622 DDX41 "Uncharacterized protein 0.408 0.241 0.828 9.7e-64
UNIPROTKB|J3KNN5 640 DDX41 "Probable ATP-dependent 0.408 0.234 0.828 9.7e-64
UNIPROTKB|Q9UJV9 622 DDX41 "Probable ATP-dependent 0.408 0.241 0.828 9.7e-64
WB|WBGene00019245 sacy-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 1.1e-72, Sum P(2) = 1.1e-72
 Identities = 104/153 (67%), Positives = 130/153 (84%)

Query:   203 EDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVE 262
             +++++IF FF+ QRQTLLFSATMP+KIQ FA+SALVKPI +NVGRAG    S+NV+QE+E
Sbjct:   365 DEIKSIFYFFKAQRQTLLFSATMPRKIQFFAKSALVKPIVVNVGRAGAA--SLNVLQELE 422

Query:   263 YVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTR 322
             +V+ E K+V +LECLQKT P VLIFAEKK DVD I+EYLL+KGVE  +IHGGKDQ +R  
Sbjct:   423 FVRSENKLVRVLECLQKTSPKVLIFAEKKVDVDNIYEYLLVKGVEVASIHGGKDQSDRHA 482

Query:   323 SVESFRKGQKDVMVATDVASKGLDFEEIKHVIN 355
              +E+FRK +KDV+VATDVASKGLDF+ I+HVIN
Sbjct:   483 GIEAFRKNEKDVLVATDVASKGLDFQGIEHVIN 515
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0000003 "reproduction" evidence=IMP
GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0002009 "morphogenesis of an epithelium" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0040035 "hermaphrodite genitalia development" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
UNIPROTKB|F1NAH6 LOC100859810 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0015331 abs "abstrakt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1927 ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311758 Ddx41 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 41" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R052 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZF6 DDX41 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A3KN07 DDX41 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNN5 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJV9 DDX41 "Probable ATP-dependent RNA helicase DDX41" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LU46RH35_ARATH3, ., 6, ., 4, ., 1, 30.70230.44680.2774yesN/A
Q54KG1DDX41_DICDI3, ., 6, ., 4, ., 1, 30.68550.42770.2339yesN/A
Q0E3X4RH35A_ORYSJ3, ., 6, ., 4, ., 1, 30.67850.44680.2615yesN/A
Q91VN6DDX41_MOUSE3, ., 6, ., 4, ., 1, 30.78880.43320.2556yesN/A
Q9V3C0DDX41_DROME3, ., 6, ., 4, ., 1, 30.80740.43320.2568yesN/A
Q9UJV9DDX41_HUMAN3, ., 6, ., 4, ., 1, 30.78880.43320.2556yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-39
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 7e-34
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-22
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-20
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-20
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 9e-17
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-16
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-16
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 5e-16
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 4e-13
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 4e-12
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 8e-12
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-10
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-10
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 8e-10
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-07
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-07
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-07
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-06
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 1e-05
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-05
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-04
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 4e-04
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 0.001
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.002
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  144 bits (366), Expect = 6e-39
 Identities = 59/155 (38%), Positives = 87/155 (56%), Gaps = 2/155 (1%)

Query: 203 EDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVE 262
           +D+  I       RQTLLFSATMP  I+  AR  L  P+ I V           + Q   
Sbjct: 193 DDIEKILKALPPDRQTLLFSATMPDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYL 252

Query: 263 YVK-QEAKIVYLLECLQKTEPP-VLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEER 320
            V+ +E K+  LL+ L+  +   V++F   K+ V+ + E L  +G +  A+HG   QEER
Sbjct: 253 EVESEEEKLELLLKLLKDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEER 312

Query: 321 TRSVESFRKGQKDVMVATDVASKGLDFEEIKHVIN 355
            R++E F+ G+  V+VATDVA++GLD  ++ HVIN
Sbjct: 313 DRALEKFKDGELRVLVATDVAARGLDIPDVSHVIN 347

Length = 513
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 367
KOG0341|consensus 610 100.0
KOG0330|consensus476 100.0
KOG0331|consensus519 100.0
KOG0328|consensus400 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0333|consensus673 100.0
KOG0338|consensus 691 100.0
KOG0340|consensus 442 100.0
KOG0343|consensus 758 100.0
KOG0326|consensus459 100.0
KOG0345|consensus 567 100.0
KOG0342|consensus 543 100.0
KOG0347|consensus 731 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335|consensus482 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0336|consensus629 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0348|consensus 708 100.0
KOG0327|consensus397 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0339|consensus 731 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0346|consensus 569 100.0
KOG0334|consensus 997 100.0
KOG0332|consensus477 100.0
KOG4284|consensus 980 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0337|consensus 529 100.0
KOG0344|consensus 593 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.98
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.97
PRK09401 1176 reverse gyrase; Reviewed 99.97
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.97
KOG0350|consensus 620 99.97
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.96
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.96
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.96
KOG0329|consensus387 99.96
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.96
PRK14701 1638 reverse gyrase; Provisional 99.95
PRK13767 876 ATP-dependent helicase; Provisional 99.95
PHA02653 675 RNA helicase NPH-II; Provisional 99.95
PRK10689 1147 transcription-repair coupling factor; Provisional 99.94
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.94
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.94
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.94
PRK02362 737 ski2-like helicase; Provisional 99.93
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.92
PRK00254 720 ski2-like helicase; Provisional 99.92
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.92
KOG0349|consensus 725 99.91
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.91
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.9
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.9
KOG0351|consensus 941 99.9
PRK01172 674 ski2-like helicase; Provisional 99.9
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.88
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.88
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.87
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.87
COG1202 830 Superfamily II helicase, archaea-specific [General 99.86
PHA02558501 uvsW UvsW helicase; Provisional 99.86
KOG0353|consensus 695 99.85
KOG0352|consensus 641 99.84
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.83
COG1205 851 Distinct helicase family with a unique C-terminal 99.82
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.81
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.8
PRK13766 773 Hef nuclease; Provisional 99.77
KOG0354|consensus 746 99.73
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.69
PRK05580 679 primosome assembly protein PriA; Validated 99.68
PRK04914 956 ATP-dependent helicase HepA; Validated 99.68
PRK09694 878 helicase Cas3; Provisional 99.64
COG1204 766 Superfamily II helicase [General function predicti 99.63
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.62
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.61
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.59
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.58
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.58
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.55
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.54
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.53
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.52
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.52
PRK05298 652 excinuclease ABC subunit B; Provisional 99.5
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.48
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.46
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.43
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.38
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.37
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.35
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.35
KOG0952|consensus 1230 99.35
KOG4150|consensus 1034 99.33
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.32
KOG0951|consensus 1674 99.32
smart0049082 HELICc helicase superfamily c-terminal domain. 99.3
KOG0947|consensus 1248 99.29
KOG0922|consensus 674 99.26
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.24
PTZ00110 545 helicase; Provisional 99.14
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.14
KOG2340|consensus698 99.13
KOG0924|consensus 1042 99.12
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.1
KOG0948|consensus 1041 99.09
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.06
KOG0923|consensus 902 99.06
KOG0339|consensus 731 99.04
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.04
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.02
KOG0334|consensus 997 98.99
KOG0950|consensus 1008 98.93
KOG0341|consensus 610 98.91
KOG0920|consensus 924 98.91
KOG0333|consensus 673 98.91
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.85
KOG0347|consensus 731 98.82
KOG0926|consensus 1172 98.81
KOG0336|consensus 629 98.75
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.74
KOG0338|consensus 691 98.72
KOG0331|consensus 519 98.68
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.68
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.68
KOG0330|consensus 476 98.61
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.6
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.56
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.56
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.55
COG1198 730 PriA Primosomal protein N' (replication factor Y) 98.53
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 98.53
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.53
KOG0925|consensus 699 98.49
KOG0340|consensus 442 98.31
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 98.25
KOG0385|consensus 971 98.21
KOG0335|consensus 482 98.18
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.18
KOG0329|consensus 387 98.17
KOG0387|consensus 923 98.13
KOG0390|consensus776 98.09
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.08
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.05
KOG0345|consensus 567 98.04
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.03
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.01
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.01
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.01
KOG0391|consensus 1958 98.0
KOG0384|consensus 1373 97.99
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 97.97
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.95
KOG0953|consensus 700 97.95
KOG0346|consensus 569 97.93
KOG0337|consensus 529 97.92
COG4096 875 HsdR Type I site-specific restriction-modification 97.91
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.88
PTZ00424 401 helicase 45; Provisional 97.75
smart00487201 DEXDc DEAD-like helicases superfamily. 97.71
KOG1123|consensus 776 97.7
KOG0343|consensus 758 97.66
KOG0392|consensus 1549 97.63
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.62
KOG0348|consensus 708 97.59
PRK00254 720 ski2-like helicase; Provisional 97.58
KOG0344|consensus 593 97.57
PRK12326 764 preprotein translocase subunit SecA; Reviewed 97.56
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.54
KOG0388|consensus1185 97.52
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 97.52
KOG0326|consensus 459 97.48
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 97.47
KOG0389|consensus941 97.44
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 97.42
PRK02362 737 ski2-like helicase; Provisional 97.42
PRK14701 1638 reverse gyrase; Provisional 97.41
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.4
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 97.37
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.33
PRK10689 1147 transcription-repair coupling factor; Provisional 97.31
KOG0328|consensus 400 97.2
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.11
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.07
KOG1000|consensus 689 97.05
PRK05580 679 primosome assembly protein PriA; Validated 97.02
KOG4284|consensus 980 97.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.0
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.0
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.87
KOG0342|consensus 543 96.78
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 96.74
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 96.7
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.53
PRK13767 876 ATP-dependent helicase; Provisional 96.5
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.42
PRK14873 665 primosome assembly protein PriA; Provisional 96.41
PRK01172 674 ski2-like helicase; Provisional 96.3
PRK09401 1176 reverse gyrase; Reviewed 96.29
KOG0951|consensus 1674 96.28
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.15
KOG0327|consensus 397 96.11
KOG1015|consensus 1567 96.02
KOG1002|consensus791 95.99
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.87
KOG0386|consensus 1157 95.86
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.65
COG1198 730 PriA Primosomal protein N' (replication factor Y) 95.65
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 95.41
KOG0949|consensus 1330 95.4
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 95.1
COG1201 814 Lhr Lhr-like helicases [General function predictio 94.9
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 94.7
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 94.15
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 94.12
KOG0332|consensus 477 94.0
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 93.87
KOG4439|consensus901 93.8
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 93.62
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 93.51
PF04851184 ResIII: Type III restriction enzyme, res subunit; 93.46
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 93.07
smart00489289 DEXDc3 DEAD-like helicases superfamily. 92.95
smart00488289 DEXDc2 DEAD-like helicases superfamily. 92.95
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 92.84
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 92.66
KOG0350|consensus 620 92.63
PRK13766 773 Hef nuclease; Provisional 92.47
KOG0921|consensus 1282 91.82
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 91.48
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 90.45
COG4889 1518 Predicted helicase [General function prediction on 89.74
COG1205 851 Distinct helicase family with a unique C-terminal 88.2
COG3973747 Superfamily I DNA and RNA helicases [General funct 86.86
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 86.26
KOG1133|consensus821 86.17
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 85.6
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 85.16
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 84.09
COG1202 830 Superfamily II helicase, archaea-specific [General 84.09
KOG0389|consensus 941 84.06
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 83.37
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 83.18
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 82.89
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 82.82
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 82.73
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 82.3
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 82.23
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 81.73
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 81.49
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 81.47
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 81.06
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 80.45
>KOG0341|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.4e-74  Score=514.37  Aligned_cols=351  Identities=64%  Similarity=0.969  Sum_probs=323.0

Q ss_pred             CCCCCCCcccccchHHHHHHHHHHhhHHHhhhhHHHhhhhcccCCCCCCCCCccchhhhccccccCCcccHhhhHHHHHH
Q psy7790           3 NESDDEHYVPYVSVKERKKQKLIQLGRLAQERHEEKKKLVLSDDEDNNKDSTDEENDESKVWGRMSNISLLDQHSELKKM   82 (367)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~   82 (367)
                      .+++||||+|||||++||++...++++...+.....   .+.+++++.+.      +++...+.+.+.|+|++|.++++.
T Consensus        17 ~de~d~dyv~yv~v~err~~~~~k~l~r~~k~~~~~---~q~~~~~~~~~------~~~d~~g~~~n~sLL~qh~elk~~   87 (610)
T KOG0341|consen   17 DDEDDEDYVPYVPVQERRAQVHRKLLQRQVKAPTEE---EQEDSESEREK------KEDDKQGEEANKSLLDQHTELKET   87 (610)
T ss_pred             cccccccceecccHHHHHHHHHHHHHHhhccccchh---hccchhccccc------CcccccchhhhhhHHHHHHHHHhh
Confidence            344577999999999999999999986644322211   12222222221      111223778899999999999999


Q ss_pred             HHhcccChHHHhHHHHHHHHHHhHhcccccccccccCCccccCcccccccCCccccCCCHHHHHHHHhccCeEEecCCCC
Q psy7790          83 AEAKKESAKEKQLKEEEKILRSVAETKALMGVAELAKGIQYNDPIKTSWRAPRCILSLPDQVHDIIRRNLRILVEGDDVP  162 (367)
Q Consensus        83 ~~~~~~~~~~~~~~~Q~~~i~~i~~g~d~~~~a~TgsGKT~~~p~~~~~~~~~~i~~~~~~~~~~~~~~~~i~~~g~~~~  162 (367)
                      +++ ..+.+++|..+++++++++.+|+.++++++.+.|.||..|+.+.|.||..|+.|+.++.+.+|++++|.+.|.++|
T Consensus        88 ~~a-k~sa~Ekql~eEee~me~v~~~k~LmsV~ElakGi~Y~ePi~T~WkPP~hir~mS~e~~e~vRk~~~I~veGd~ip  166 (610)
T KOG0341|consen   88 AEA-KISASEKQLMEEEEIMESVADGKALMSVAELAKGITYEEPIKTAWKPPRHIRKMSEEQRELVRKQLHILVEGDDIP  166 (610)
T ss_pred             hhh-hcchHHHHHHHHHHHHHHHhcCccceeHHHHhCCCcccCcchhccCCcHHHHHhhHHHHHHHHHhheEEeeCCCCC
Confidence            876 6888999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccCCCCHHHHHHHHHcCCCCCChhhhhcccccch----------------------------------------
Q psy7790         163 PACCSFRLMKLPESLVRALEAKGIKKPTPIQVQGIPAALS----------------------------------------  202 (367)
Q Consensus       163 ~~~~~f~~l~~p~~ll~~l~~~g~~~pt~iQ~~~ip~~l~----------------------------------------  202 (367)
                      +|+.+|.+|.+|..+++.|+++|+..|||||.+++|.+|+                                        
T Consensus       167 PPIksF~eMKFP~~~L~~lk~KGI~~PTpIQvQGlPvvLsGRDmIGIAfTGSGKTlvFvLP~imf~LeqE~~lPf~~~EG  246 (610)
T KOG0341|consen  167 PPIKSFKEMKFPKPLLRGLKKKGIVHPTPIQVQGLPVVLSGRDMIGIAFTGSGKTLVFVLPVIMFALEQEMMLPFARGEG  246 (610)
T ss_pred             CchhhhhhccCCHHHHHHHHhcCCCCCCceeecCcceEeecCceeeEEeecCCceEEEeHHHHHHHHHHHhcCccccCCC
Confidence            9999999999999999999999999999999999999998                                        


Q ss_pred             --------------------------------------------------------------------------------
Q psy7790         203 --------------------------------------------------------------------------------  202 (367)
Q Consensus       203 --------------------------------------------------------------------------------  202 (367)
                                                                                                      
T Consensus       247 P~gLiicPSRELArQt~~iie~~~~~L~e~g~P~lRs~LciGG~~v~eql~~v~~GvHivVATPGRL~DmL~KK~~sLd~  326 (610)
T KOG0341|consen  247 PYGLIICPSRELARQTHDIIEQYVAALQEAGYPELRSLLCIGGVPVREQLDVVRRGVHIVVATPGRLMDMLAKKIMSLDA  326 (610)
T ss_pred             CeeEEEcCcHHHHHHHHHHHHHHHHHHHhcCChhhhhhhhhcCccHHHHHHHHhcCeeEEEcCcchHHHHHHHhhccHHH
Confidence                                                                                            


Q ss_pred             ------------------HHHHHHHhhccCCceEEeecCCCcHHHHHHHHHhcCCCEEEEeCCCCccCCCCcceEEEEEe
Q psy7790         203 ------------------EDVRTIFSFFRGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYV  264 (367)
Q Consensus       203 ------------------~~v~~Il~~l~~~~Q~il~SAT~~~~v~~l~~~~l~~~~~i~~~~~~~~~~~~~i~~~~~~~  264 (367)
                                        ++++.|+.+|..+|||++||||||..++.|+++.+..|+.|++++.++  ++.++.|.+.+|
T Consensus       327 CRyL~lDEADRmiDmGFEddir~iF~~FK~QRQTLLFSATMP~KIQ~FAkSALVKPvtvNVGRAGA--AsldViQevEyV  404 (610)
T KOG0341|consen  327 CRYLTLDEADRMIDMGFEDDIRTIFSFFKGQRQTLLFSATMPKKIQNFAKSALVKPVTVNVGRAGA--ASLDVIQEVEYV  404 (610)
T ss_pred             HHHhhhhhHHHHhhccchhhHHHHHHHHhhhhheeeeeccccHHHHHHHHhhcccceEEecccccc--cchhHHHHHHHH
Confidence                              899999999999999999999999999999999999999999999999  999999999999


Q ss_pred             chhhHHHHHHHHHhhcCCCeEEeeccHHHHHHHHHHHHhCCCeEEEEecCCCHHHHHHHHHHHhcCCCcEEEeccccccc
Q psy7790         265 KQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKG  344 (367)
Q Consensus       265 ~~~~k~~~l~~~l~~~~~~~iVF~~s~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~~~~F~~g~~~vLVaTd~~~rG  344 (367)
                      ..++|+.+|+++|+++.+++||||..+.+++.+++||..+|+.++++|||.+|++|..+++.|+.|+.+||||||+++.|
T Consensus       405 kqEaKiVylLeCLQKT~PpVLIFaEkK~DVD~IhEYLLlKGVEavaIHGGKDQedR~~ai~afr~gkKDVLVATDVASKG  484 (610)
T KOG0341|consen  405 KQEAKIVYLLECLQKTSPPVLIFAEKKADVDDIHEYLLLKGVEAVAIHGGKDQEDRHYAIEAFRAGKKDVLVATDVASKG  484 (610)
T ss_pred             HhhhhhhhHHHHhccCCCceEEEeccccChHHHHHHHHHccceeEEeecCcchhHHHHHHHHHhcCCCceEEEecchhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCCCCEEEEcCCCCCcccc
Q psy7790         345 LDFEEIKHVINTEAKIKKREH  365 (367)
Q Consensus       345 lDi~~v~~VI~yd~P~~~~~Y  365 (367)
                      +|||+|+||||||||.++++|
T Consensus       485 LDFp~iqHVINyDMP~eIENY  505 (610)
T KOG0341|consen  485 LDFPDIQHVINYDMPEEIENY  505 (610)
T ss_pred             CCCccchhhccCCChHHHHHH
Confidence            999999999999999999998

>KOG0330|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 7e-46
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-24
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 2e-19
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-15
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-12
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-12
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-12
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-11
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-10
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-10
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-10
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-09
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 6e-09
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 6e-09
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 7e-09
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 7e-09
2hyi_C413 Structure Of The Human Exon Junction Complex With A 7e-09
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 1e-08
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 1e-08
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-08
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 2e-08
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-07
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 6e-07
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 6e-07
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 8e-07
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 9e-07
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-06
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-06
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-06
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 2e-06
1fuu_A394 Yeast Initiation Factor 4a Length = 394 5e-06
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-05
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 2e-05
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 2e-05
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-05
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 3e-05
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 3e-05
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 6e-05
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-04
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 6e-04
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 7e-04
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (458), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 85/102 (83%), Positives = 98/102 (96%)
Query: 254 SMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHG 313
           S++V+QEVEYVK+EAK+VYLLECLQKT PPVLIFAEKK DVDAIHEYLLLKGVEAVAIHG
Sbjct: 27  SLDVIQEVEYVKEEAKMVYLLECLQKTPPPVLIFAEKKADVDAIHEYLLLKGVEAVAIHG 86
Query: 314 GKDQEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVIN 355
           GKDQEERT+++E+FR+G+KDV+VATDVASKGLDF  I+HVIN
Sbjct: 87  GKDQEERTKAIEAFREGKKDVLVATDVASKGLDFPAIQHVIN 128
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query367
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 9e-64
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 2e-12
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-61
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-11
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 3e-52
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 6e-48
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 4e-36
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-06
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-34
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 4e-05
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 6e-34
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-33
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-04
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-33
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-33
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 7e-06
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 8e-33
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-04
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-30
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 8e-06
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 2e-30
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-05
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-30
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 4e-30
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-05
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-29
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-06
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-28
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 1e-05
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-27
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-05
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 2e-23
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-22
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-19
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-19
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 4e-18
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-16
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 4e-16
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 3e-15
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 9e-15
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-13
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-08
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-12
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-09
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 4e-12
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 8e-11
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-10
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-05
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-10
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-07
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-10
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 4e-06
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 6e-10
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-05
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 3e-09
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 4e-06
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 4e-09
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 5e-09
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-08
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 9e-06
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 2e-08
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-05
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-08
3bor_A237 Human initiation factor 4A-II; translation initiat 7e-06
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 8e-08
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-08
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-05
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-07
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-04
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-07
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 5e-07
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 2e-05
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 3e-05
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 3e-04
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 5e-04
1yks_A 440 Genome polyprotein [contains: flavivirin protease 5e-04
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
 Score =  208 bits (531), Expect = 9e-64
 Identities = 59/159 (37%), Positives = 91/159 (57%), Gaps = 8/159 (5%)

Query: 203 EDVRTIFSFF----RGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVV 258
             +R I        +G R T++FSAT PK+IQ  AR  L + I + VGR G    S N+ 
Sbjct: 194 PQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGS--TSENIT 251

Query: 259 QEVEYVKQEAKIVYLLECLQKTEPP--VLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKD 316
           Q+V +V++  K  +LL+ L  T      L+F E K+  D++ ++L  +G    +IHG + 
Sbjct: 252 QKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRS 311

Query: 317 QEERTRSVESFRKGQKDVMVATDVASKGLDFEEIKHVIN 355
           Q +R  ++  FR G+  ++VAT VA++GLD   +KHVIN
Sbjct: 312 QRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVIN 350
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.98
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.97
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.97
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.96
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.95
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.95
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.95
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.94
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.94
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.94
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.93
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.93
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.93
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.93
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.93
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.93
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.93
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.93
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.92
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.92
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.92
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.92
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.91
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.91
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.91
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.91
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.9
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.89
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.89
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.89
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.89
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.88
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.88
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.87
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.87
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.87
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.87
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.86
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.85
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.85
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.85
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.84
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.82
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.72
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.81
3h1t_A590 Type I site-specific restriction-modification syst 99.77
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.76
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.73
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.73
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.72
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.71
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.71
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.7
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.68
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.68
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.67
3bor_A237 Human initiation factor 4A-II; translation initiat 99.67
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.65
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.65
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.64
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.64
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.63
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.63
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.62
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.62
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.57
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.56
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.56
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.36
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.25
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.1
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.09
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.8
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.74
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.67
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.65
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.61
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 98.56
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 98.54
3bor_A237 Human initiation factor 4A-II; translation initiat 98.52
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.51
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 98.42
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.41
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.38
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 98.37
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 98.33
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 98.31
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.29
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 98.27
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.23
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.13
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.12
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.08
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.05
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 97.99
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.98
3b6e_A216 Interferon-induced helicase C domain-containing P; 97.97
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.92
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.91
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.87
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.8
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.77
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.75
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 97.62
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.61
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 97.56
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 97.55
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.48
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 97.44
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 97.41
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 97.24
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.17
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.17
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 97.08
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 96.6
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 96.58
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.55
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.54
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 96.22
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 96.17
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 95.93
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 95.82
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 95.79
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 95.75
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 95.59
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 95.13
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 95.12
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 94.46
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 93.74
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 93.67
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 93.41
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 92.76
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 89.09
3b6e_A216 Interferon-induced helicase C domain-containing P; 87.45
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus p 85.26
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 84.38
4gl2_A 699 Interferon-induced helicase C domain-containing P; 82.67
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 82.01
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 81.92
2l82_A162 Designed protein OR32; structural genomics, northe 80.66
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 80.32
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 80.3
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 80.24
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=7.7e-42  Score=331.32  Aligned_cols=294  Identities=25%  Similarity=0.350  Sum_probs=245.4

Q ss_pred             cccCCcccHhhhHHHHHHHHhcc-cChHHHhHHHHHHHHHHhHhcccccccccccCCcc--ccCcccccc----------
Q psy7790          65 GRMSNISLLDQHSELKKMAEAKK-ESAKEKQLKEEEKILRSVAETKALMGVAELAKGIQ--YNDPIKTSW----------  131 (367)
Q Consensus        65 ~~~~~~~~l~~~~~~~~~~~~~~-~~~~~~~~~~Q~~~i~~i~~g~d~~~~a~TgsGKT--~~~p~~~~~----------  131 (367)
                      .+..+|..+++++.+++++...+ ..|+++    |+++|+.+++|+|++++|+||||||  |..|+...+          
T Consensus        53 ~~~~~f~~~~l~~~l~~~l~~~g~~~pt~i----Q~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~  128 (434)
T 2db3_A           53 QPIQHFTSADLRDIIIDNVNKSGYKIPTPI----QKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELG  128 (434)
T ss_dssp             CCCCCGGGSCCCHHHHHHHHHTTCCSCCHH----HHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCCCTT
T ss_pred             CCcCChhhcCCCHHHHHHHHHcCCCCCCHH----HHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccccccC
Confidence            34568999999999999997666 889999    9999999999999999999999999  778887653          


Q ss_pred             cCCccccCCCHHHHHHHHhc-----------cCeEEecCCCCcccccccc-----CCCCHHHHHHHHHcCCCCCChhhhh
Q psy7790         132 RAPRCILSLPDQVHDIIRRN-----------LRILVEGDDVPPACCSFRL-----MKLPESLVRALEAKGIKKPTPIQVQ  195 (367)
Q Consensus       132 ~~~~~i~~~~~~~~~~~~~~-----------~~i~~~g~~~~~~~~~f~~-----l~~p~~ll~~l~~~g~~~pt~iQ~~  195 (367)
                      .+...+.+++++++.++.+.           ..+.+||.....+...+..     ++||+++++.+....+ ....+..-
T Consensus       129 ~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~-~l~~~~~l  207 (434)
T 2db3_A          129 RPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFI-TFEDTRFV  207 (434)
T ss_dssp             CCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSC-CCTTCCEE
T ss_pred             CccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCc-ccccCCeE
Confidence            23455778888777666542           2334566554333332221     6899999999875432 23333332


Q ss_pred             ccc-------ccchHHHHHHHhhc--cCCceEEeecCCCcHHHHHHHHHhcCCCEEEEeCCCCccCCCCcceEEEEEech
Q psy7790         196 GIP-------AALSEDVRTIFSFF--RGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGKIMPSMNVVQEVEYVKQ  266 (367)
Q Consensus       196 ~ip-------~~l~~~v~~Il~~l--~~~~Q~il~SAT~~~~v~~l~~~~l~~~~~i~~~~~~~~~~~~~i~~~~~~~~~  266 (367)
                      +++       ..+.++++.|+..+  +.++|+++||||+|..+..++..++.++..+.++..+.  ...++.|.+..+..
T Consensus       208 VlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~--~~~~i~~~~~~~~~  285 (434)
T 2db3_A          208 VLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGG--ACSDVKQTIYEVNK  285 (434)
T ss_dssp             EEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTC--CCTTEEEEEEECCG
T ss_pred             EEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccc--cccccceEEEEeCc
Confidence            332       23447888888875  57899999999999999999999999999999887766  67789999999999


Q ss_pred             hhHHHHHHHHHhhcCCCeEEeeccHHHHHHHHHHHHhCCCeEEEEecCCCHHHHHHHHHHHhcCCCcEEEecccccccCC
Q psy7790         267 EAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKDVMVATDVASKGLD  346 (367)
Q Consensus       267 ~~k~~~l~~~l~~~~~~~iVF~~s~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~~~~F~~g~~~vLVaTd~~~rGlD  346 (367)
                      ..|...|.+++.....++||||+|+..|+.++..|...|+.+..+||++++.+|..+++.|++|+.+|||||++++||||
T Consensus       286 ~~k~~~l~~~l~~~~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlD  365 (434)
T 2db3_A          286 YAKRSKLIEILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLD  365 (434)
T ss_dssp             GGHHHHHHHHHHHCCTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCC
T ss_pred             HHHHHHHHHHHHhCCCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCC
Confidence            99999999999988888999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCEEEEcCCCCCcccc
Q psy7790         347 FEEIKHVINTEAKIKKREH  365 (367)
Q Consensus       347 i~~v~~VI~yd~P~~~~~Y  365 (367)
                      +|+|++|||||+|.++++|
T Consensus       366 i~~v~~VI~~d~p~~~~~y  384 (434)
T 2db3_A          366 IKNIKHVINYDMPSKIDDY  384 (434)
T ss_dssp             CTTCCEEEESSCCSSHHHH
T ss_pred             cccCCEEEEECCCCCHHHH
Confidence            9999999999999999887
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 367
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 9e-17
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 5e-13
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-09
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-12
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 4e-09
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-12
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-08
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 7e-12
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-08
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 9e-12
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 1e-08
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-11
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 8e-09
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-11
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-08
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 6e-11
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-10
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 2e-08
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-10
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-08
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-08
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 3e-08
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-07
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 4e-07
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 9e-07
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-06
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 7e-06
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 1e-05
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 2e-05
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 4e-04
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 8e-04
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

 Score = 77.7 bits (191), Expect = 9e-17
 Identities = 20/120 (16%), Positives = 37/120 (30%), Gaps = 14/120 (11%)

Query: 252 MPSMNVVQEVEYVKQEAKIVYLLECLQKTEP-PVLIFAEKKQDVDAIHEYLLLKGVEAVA 310
           +P  N+ +       E         L+  +    LIF   K+  D +   L+  G+ AVA
Sbjct: 6   VPHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVA 65

Query: 311 IHGGKDQEERTRS----------VESFRKGQKDVMVATDVASKG---LDFEEIKHVINTE 357
            + G D      S          + +   G  D ++  +           +    +  T 
Sbjct: 66  YYRGLDVSVIPTSGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTT 125
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query367
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.93
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.93
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.92
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.91
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.91
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.9
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.9
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.89
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.88
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.88
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.88
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.87
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.86
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.83
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.83
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.82
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.81
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 99.78
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.74
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.71
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.69
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.58
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.57
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.55
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.5
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.43
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.26
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.24
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.17
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.09
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.99
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.92
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.92
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.86
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.84
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.81
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.8
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.69
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.46
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 97.93
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 97.9
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.55
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.52
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.38
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.93
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.63
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.07
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.24
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 94.86
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.92
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.67
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 93.16
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 89.48
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 88.21
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.89
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 81.91
d2b2na1 308 Transcription-repair coupling factor, TRCF {Escher 80.88
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=99.93  E-value=3e-26  Score=188.26  Aligned_cols=112  Identities=27%  Similarity=0.389  Sum_probs=108.7

Q ss_pred             CCcceEEEEEechhhHHHHHHHHHhhcCCCeEEeeccHHHHHHHHHHHHhCCCeEEEEecCCCHHHHHHHHHHHhcCCCc
Q psy7790         254 SMNVVQEVEYVKQEAKIVYLLECLQKTEPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQEERTRSVESFRKGQKD  333 (367)
Q Consensus       254 ~~~i~~~~~~~~~~~k~~~l~~~l~~~~~~~iVF~~s~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~~~~F~~g~~~  333 (367)
                      +.+|.|.|+.|+.++|+..|.++|...+.++||||+|++.|+.++..|...|+.+..+||++++.+|..++++|++|+.+
T Consensus         1 n~nI~~~~i~v~~~~K~~~L~~ll~~~~~k~IIF~~s~~~~~~l~~~L~~~g~~~~~~~~~~~~~~r~~~~~~f~~~~~~   80 (155)
T d1hv8a2           1 NANIEQSYVEVNENERFEALCRLLKNKEFYGLVFCKTKRDTKELASMLRDIGFKAGAIHGDLSQSQREKVIRLFKQKKIR   80 (155)
T ss_dssp             SSSSEEEEEECCGGGHHHHHHHHHCSTTCCEEEECSSHHHHHHHHHHHHHTTCCEEEECSSSCHHHHHHHHHHHHTTSSS
T ss_pred             CCCeEEEEEEeChHHHHHHHHHHHccCCCCEEEEECchHHHHHHHhhhcccccccccccccchhhhhhhhhhhhhcccce
Confidence            35899999999999999999999998888999999999999999999999999999999999999999999999999999


Q ss_pred             EEEecccccccCCcCCCCEEEEcCCCCCcccc
Q psy7790         334 VMVATDVASKGLDFEEIKHVINTEAKIKKREH  365 (367)
Q Consensus       334 vLVaTd~~~rGlDi~~v~~VI~yd~P~~~~~Y  365 (367)
                      |||||++++||+|+|+|++|||||+|+|+..|
T Consensus        81 ilv~T~~~~~Gid~~~v~~Vi~~d~p~~~~~y  112 (155)
T d1hv8a2          81 ILIATDVMSRGIDVNDLNCVINYHLPQNPESY  112 (155)
T ss_dssp             EEEECTTHHHHCCCSCCSEEEESSCCSCHHHH
T ss_pred             eeeehhHHhhhhhhccCcEEEEecCCCCHHHH
Confidence            99999999999999999999999999999887
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2na1 c.37.1.19 (A:26-333) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure