Psyllid ID: psy7827


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MVGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
ccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHcccccccEEEEEEc
cccHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHcccHccccccccccccccccEcccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccHHcccEEEEEEc
MVGYKIFMVPTDYIveidsiksprviDAMIHidrghfcahndsrKYMLAARDIgygsiidnpVQHAEVLELLKdklvpgakvldvgsgsgylTTCFAHMvgkngsvvgvEHIPEIVNhasnvttlhypklnKRIKFICEY
MVGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVnhasnvttlhypklnkRIKFICEY
MVGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
**GYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFIC**
*****IFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
MVGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
*VGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGYKIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKLNKRIKFICEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
Q27873225 Protein-L-isoaspartate O- yes N/A 0.821 0.511 0.453 6e-21
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.821 0.504 0.458 9e-21
Q92047228 Protein-L-isoaspartate(D- yes N/A 0.821 0.504 0.466 9e-20
Q43209230 Protein-L-isoaspartate O- N/A N/A 0.742 0.452 0.476 1e-19
P15246227 Protein-L-isoaspartate(D- yes N/A 0.821 0.506 0.433 1e-19
P23506227 Protein-L-isoaspartate(D- no N/A 0.678 0.418 0.489 2e-19
P80895227 Protein-L-isoaspartate(D- yes N/A 0.821 0.506 0.433 2e-19
P22062227 Protein-L-isoaspartate(D- yes N/A 0.678 0.418 0.489 2e-19
P22061227 Protein-L-isoaspartate(D- no N/A 0.821 0.506 0.433 3e-19
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.821 0.506 0.433 3e-19
>sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 70/119 (58%), Gaps = 4/119 (3%)

Query: 22  SPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAK 81
           S R  DAM  +DRG F        Y  A + IGY + +  P  HA  L+ L++ LV GAK
Sbjct: 25  SQRAYDAMKSVDRGDFAPR---APYEDAPQRIGYNATVSAPHMHAAALDYLQNHLVAGAK 81

Query: 82  VLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVN-HASNVTTLHYPKLNKRIKFICE 139
            LDVGSGSGYLT C A MVG+NG+VVG+EH+P++V     N+   H  +L +    I E
Sbjct: 82  ALDVGSGSGYLTVCMAMMVGRNGTVVGIEHMPQLVELSEKNIRKHHSEQLERGNVIIIE 140




Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function description
>sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 Back     alignment and function description
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function description
>sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
326919840 248 PREDICTED: protein-L-isoaspartate(D-aspa 0.821 0.463 0.508 8e-23
427781597232 Putative protein-l-isoaspartated-asparta 0.821 0.495 0.483 2e-22
357618961225 L-isoaspartyl protein carboxyl methyltra 0.821 0.511 0.483 4e-22
224050699 245 PREDICTED: protein-L-isoaspartate(D-aspa 0.828 0.473 0.487 5e-22
213982893169 uncharacterized protein LOC100216173 [Xe 0.821 0.680 0.508 3e-21
114052539 249 L-isoaspartyl protein carboxyl methyltra 0.821 0.461 0.475 3e-21
241566262 277 protein-L-isoaspartate(D-aspartate) O-me 0.814 0.411 0.479 5e-21
327280168 247 PREDICTED: protein-L-isoaspartate(D-aspa 0.821 0.465 0.483 6e-21
327280170 244 PREDICTED: protein-L-isoaspartate(D-aspa 0.821 0.471 0.483 6e-21
260830152230 hypothetical protein BRAFLDRAFT_284774 [ 0.821 0.5 0.475 8e-21
>gi|326919840|ref|XP_003206185.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Meleagris gallopavo] gi|363734030|ref|XP_420939.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase [Gallus gallus] Back     alignment and taxonomy information
 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 74/120 (61%), Gaps = 5/120 (4%)

Query: 20  IKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPG 79
           IKS RV D ++  DRGH+  +     YM + + IGY + I  P  HA  LELLKD+LV G
Sbjct: 43  IKSQRVFDVLLATDRGHYIKYF---PYMDSPQSIGYKATISAPHMHAHALELLKDQLVEG 99

Query: 80  AKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKL--NKRIKFI 137
           AK LDVGSGSGYLT CFA MVG  G  VGVEHI E+VN +        P L  + R+K +
Sbjct: 100 AKALDVGSGSGYLTACFARMVGPTGKAVGVEHIKELVNESIRNVKEDDPTLLSSGRVKLV 159




Source: Meleagris gallopavo

Species: Meleagris gallopavo

Genus: Meleagris

Family: Phasianidae

Order: Galliformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota

>gi|427781597|gb|JAA56250.1| Putative protein-l-isoaspartated-aspartate o-methyltransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|357618961|gb|EHJ71745.1| L-isoaspartyl protein carboxyl methyltransferase [Danaus plexippus] Back     alignment and taxonomy information
>gi|224050699|ref|XP_002195928.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|213982893|ref|NP_001135614.1| uncharacterized protein LOC100216173 [Xenopus (Silurana) tropicalis] gi|197246545|gb|AAI68437.1| Unknown (protein for MGC:135713) [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|114052539|ref|NP_001040252.1| L-isoaspartyl protein carboxyl methyltransferase [Bombyx mori] gi|87248521|gb|ABD36313.1| L-isoaspartyl protein carboxyl methyltransferase [Bombyx mori] Back     alignment and taxonomy information
>gi|241566262|ref|XP_002402129.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] gi|215499989|gb|EEC09483.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|327280168|ref|XP_003224825.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like isoform 1 [Anolis carolinensis] Back     alignment and taxonomy information
>gi|327280170|ref|XP_003224826.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like isoform 2 [Anolis carolinensis] Back     alignment and taxonomy information
>gi|260830152|ref|XP_002610025.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] gi|229295388|gb|EEN66035.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.821 0.504 0.508 4.2e-24
UNIPROTKB|F1N9Y6150 PCMT1 "Protein-L-isoaspartate 0.821 0.766 0.458 6.3e-21
UNIPROTKB|Q5F3N1228 PCMT1 "Protein-L-isoaspartate( 0.821 0.504 0.458 6.3e-21
WB|WBGene00003954225 pcm-1 [Caenorhabditis elegans 0.821 0.511 0.453 1e-20
ZFIN|ZDB-GENE-990415-134266 pcmt "l-isoaspartyl protein ca 0.814 0.428 0.479 2.7e-20
UNIPROTKB|E2R3G3286 PCMT1 "Protein-L-isoaspartate 0.707 0.346 0.480 5.7e-20
MGI|MGI:97502227 Pcmt1 "protein-L-isoaspartate 0.714 0.440 0.480 5.7e-20
ZFIN|ZDB-GENE-040426-1738249 pcmtl "l-isoaspartyl protein c 0.821 0.461 0.441 5.7e-20
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.707 0.434 0.480 7.2e-20
UNIPROTKB|P15246227 PCMT1 "Protein-L-isoaspartate( 0.707 0.436 0.480 7.2e-20
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 4.2e-24, P = 4.2e-24
 Identities = 61/120 (50%), Positives = 74/120 (61%)

Query:    20 IKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPG 79
             IKS RV D ++  DRGH+  +     YM + + IGY + I  P  HA  LELLKD+LV G
Sbjct:    23 IKSQRVFDVLLATDRGHYIKYFP---YMDSPQSIGYKATISAPHMHAHALELLKDQLVEG 79

Query:    80 AKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKL--NKRIKFI 137
             AK LDVGSGSGYLT CFA MVG  G  VGVEHI E+VN +        P L  + R+K +
Sbjct:    80 AKALDVGSGSGYLTACFARMVGPTGKAVGVEHIKELVNESIRNVKEDDPTLLSSGRVKLV 139




GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
UNIPROTKB|F1N9Y6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3N1 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00003954 pcm-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-134 pcmt "l-isoaspartyl protein carboxyl methyltransferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3G3 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97502 Pcmt1 "protein-L-isoaspartate (D-aspartate) O-methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1738 pcmtl "l-isoaspartyl protein carboxyl methyltransferase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P15246 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!
4th Layer2.1.1.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 2e-35
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 9e-30
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 1e-20
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 5e-15
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 2e-12
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 2e-08
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 2e-06
PRK11873 272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 9e-06
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 1e-05
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 3e-05
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 3e-05
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 6e-05
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 7e-05
PRK00216 239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 1e-04
PRK08317 241 PRK08317, PRK08317, hypothetical protein; Provisio 1e-04
PRK14968 188 PRK14968, PRK14968, putative methyltransferase; Pr 2e-04
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 4e-04
TIGR04188 363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 0.001
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  120 bits (304), Expect = 2e-35
 Identities = 53/110 (48%), Positives = 66/110 (60%), Gaps = 4/110 (3%)

Query: 20  IKSPRVIDAMIHIDRGHFC-AHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVP 78
           I S +V +AM+ +DR  F      S  Y      IGYG  I  P  HA +LELL+  L P
Sbjct: 16  IASDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHAMMLELLE--LKP 73

Query: 79  GAKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHA-SNVTTLHY 127
           G +VL++GSGSGYLT CFA MVG+ G VV +EHIPE+V  A  N+  L  
Sbjct: 74  GMRVLEIGSGSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEKLGL 123


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.92
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.9
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.9
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.9
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.89
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.83
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 99.81
KOG1661|consensus237 99.7
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.46
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.41
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 99.4
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.39
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.35
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.32
PRK07402196 precorrin-6B methylase; Provisional 99.32
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.31
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 99.3
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.29
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.27
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.27
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.25
PLN02233 261 ubiquinone biosynthesis methyltransferase 99.23
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.21
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.21
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.2
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.19
TIGR00740 239 methyltransferase, putative. A simple BLAST search 99.19
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.18
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.14
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.14
PLN02781 234 Probable caffeoyl-CoA O-methyltransferase 99.14
PLN02244 340 tocopherol O-methyltransferase 99.14
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.12
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.11
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.11
TIGR03438 301 probable methyltransferase. This model represents 99.11
PRK11207 197 tellurite resistance protein TehB; Provisional 99.11
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.11
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 99.1
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.1
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.1
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.1
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.09
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 99.07
PLN02476278 O-methyltransferase 99.07
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 99.07
TIGR00091 194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.07
KOG2904|consensus 328 99.07
COG4123 248 Predicted O-methyltransferase [General function pr 99.07
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.06
COG2519 256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.06
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.05
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.05
COG2890 280 HemK Methylase of polypeptide chain release factor 99.05
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.02
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.02
PRK05785 226 hypothetical protein; Provisional 99.02
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.01
COG4122219 Predicted O-methyltransferase [General function pr 99.01
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.01
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.01
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 99.0
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.0
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 99.0
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 99.0
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.0
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.99
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.99
PRK04266226 fibrillarin; Provisional 98.98
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.98
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.98
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.97
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.97
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.97
KOG1541|consensus 270 98.97
PLN02585 315 magnesium protoporphyrin IX methyltransferase 98.97
KOG1270|consensus 282 98.95
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.95
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.95
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.94
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.94
PRK14902 444 16S rRNA methyltransferase B; Provisional 98.94
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.93
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 98.93
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.93
PRK12335 287 tellurite resistance protein TehB; Provisional 98.93
PRK14904 445 16S rRNA methyltransferase B; Provisional 98.92
PLN02589 247 caffeoyl-CoA O-methyltransferase 98.91
PRK08317 241 hypothetical protein; Provisional 98.91
PLN02672 1082 methionine S-methyltransferase 98.91
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.91
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.91
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 98.9
KOG1271|consensus 227 98.9
PRK14901 434 16S rRNA methyltransferase B; Provisional 98.9
PRK14903 431 16S rRNA methyltransferase B; Provisional 98.9
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.88
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.88
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 98.88
PRK06202 232 hypothetical protein; Provisional 98.87
PRK14967 223 putative methyltransferase; Provisional 98.87
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.87
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.86
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.85
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.85
PRK10258 251 biotin biosynthesis protein BioC; Provisional 98.85
PLN02336 475 phosphoethanolamine N-methyltransferase 98.84
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 98.84
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.84
KOG0820|consensus 315 98.84
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.83
PRK14968 188 putative methyltransferase; Provisional 98.83
PRK04457 262 spermidine synthase; Provisional 98.83
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 98.82
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 98.82
PRK10901 427 16S rRNA methyltransferase B; Provisional 98.81
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.8
TIGR00452 314 methyltransferase, putative. Known examples to dat 98.8
PRK06922 677 hypothetical protein; Provisional 98.8
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.79
KOG1540|consensus 296 98.79
COG4976 287 Predicted methyltransferase (contains TPR repeat) 98.78
KOG3420|consensus185 98.78
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.78
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 98.77
KOG2915|consensus 314 98.77
KOG2187|consensus534 98.75
PTZ00146293 fibrillarin; Provisional 98.74
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 98.74
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.74
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.73
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.73
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.72
PLN03075 296 nicotianamine synthase; Provisional 98.7
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.7
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.69
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.68
PF09445 163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.65
PLN02490 340 MPBQ/MSBQ methyltransferase 98.64
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 98.64
PRK15128 396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.62
KOG1499|consensus 346 98.62
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.62
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 98.61
PF02390 195 Methyltransf_4: Putative methyltransferase ; Inter 98.6
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.59
PRK13255 218 thiopurine S-methyltransferase; Reviewed 98.59
PLN02336 475 phosphoethanolamine N-methyltransferase 98.58
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.57
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.57
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.56
TIGR00438188 rrmJ cell division protein FtsJ. 98.55
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.54
PHA03411 279 putative methyltransferase; Provisional 98.53
PHA03412 241 putative methyltransferase; Provisional 98.52
PRK04148134 hypothetical protein; Provisional 98.52
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.49
PRK00811 283 spermidine synthase; Provisional 98.46
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.46
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.45
PF13679141 Methyltransf_32: Methyltransferase domain 98.45
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.45
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.45
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 98.4
KOG1663|consensus 237 98.4
KOG3191|consensus 209 98.38
PF05724 218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.36
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 98.35
PRK13256 226 thiopurine S-methyltransferase; Reviewed 98.32
KOG1500|consensus 517 98.31
KOG3010|consensus 261 98.3
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 98.29
PLN02366 308 spermidine synthase 98.27
KOG2899|consensus 288 98.26
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.26
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.25
COG2520341 Predicted methyltransferase [General function pred 98.2
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 98.18
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.18
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.14
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.14
KOG2730|consensus 263 98.13
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.1
PRK01581 374 speE spermidine synthase; Validated 98.08
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.08
PRK03612 521 spermidine synthase; Provisional 98.07
COG1092 393 Predicted SAM-dependent methyltransferases [Genera 98.04
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 98.01
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.01
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.0
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.98
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.96
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 97.94
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.93
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.92
COG1041347 Predicted DNA modification methylase [DNA replicat 97.9
PF10672 286 Methyltrans_SAM: S-adenosylmethionine-dependent me 97.89
KOG4300|consensus 252 97.87
PF04816 205 DUF633: Family of unknown function (DUF633) ; Inte 97.87
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.81
COG4076 252 Predicted RNA methylase [General function predicti 97.81
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.79
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.77
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.77
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 97.73
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.72
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.67
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.66
PLN02823 336 spermine synthase 97.6
KOG2361|consensus 264 97.59
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.56
PF06080 204 DUF938: Protein of unknown function (DUF938); Inte 97.52
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.49
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.49
KOG4589|consensus 232 97.47
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.42
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.42
COG2384 226 Predicted SAM-dependent methyltransferase [General 97.41
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.4
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.38
KOG1501|consensus 636 97.37
PRK11524284 putative methyltransferase; Provisional 97.36
COG3897218 Predicted methyltransferase [General function pred 97.35
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 97.34
PHA01634156 hypothetical protein 97.32
PRK10742250 putative methyltransferase; Provisional 97.31
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 97.27
KOG1975|consensus 389 97.23
PRK13699227 putative methylase; Provisional 97.16
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.13
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.06
PF12147 311 Methyltransf_20: Putative methyltransferase; Inter 97.04
PF11599 246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 97.04
PF01564 246 Spermine_synth: Spermine/spermidine synthase; Inte 96.79
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 96.77
KOG3115|consensus 249 96.68
COG0286 489 HsdM Type I restriction-modification system methyl 96.53
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 96.46
COG1189 245 Predicted rRNA methylase [Translation, ribosomal s 96.41
KOG4058|consensus199 96.21
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 96.17
COG2521287 Predicted archaeal methyltransferase [General func 96.17
COG1352 268 CheR Methylase of chemotaxis methyl-accepting prot 96.17
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.09
KOG1122|consensus 460 96.03
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.98
PRK10611 287 chemotaxis methyltransferase CheR; Provisional 95.97
KOG1227|consensus351 95.93
KOG2651|consensus 476 95.92
COG3129 292 Predicted SAM-dependent methyltransferase [General 95.88
PF04989 206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 95.66
KOG2078|consensus 495 95.63
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 95.62
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 95.59
PRK00536 262 speE spermidine synthase; Provisional 95.55
PF04672 267 Methyltransf_19: S-adenosyl methyltransferase; Int 95.53
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 95.49
PF05050 167 Methyltransf_21: Methyltransferase FkbM domain; In 95.45
KOG3987|consensus 288 95.38
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 95.1
KOG2940|consensus 325 94.95
PF05891 218 Methyltransf_PK: AdoMet dependent proline di-methy 94.86
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 94.83
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 94.56
KOG1596|consensus317 94.51
PF05206 259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 94.46
KOG1098|consensus 780 94.17
COG1565 370 Uncharacterized conserved protein [Function unknow 93.85
COG4301 321 Uncharacterized conserved protein [Function unknow 93.51
KOG0024|consensus 354 93.45
KOG2920|consensus 282 92.83
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 92.81
COG0863302 DNA modification methylase [DNA replication, recom 92.77
COG4798 238 Predicted methyltransferase [General function pred 92.73
PF07942 270 N2227: N2227-like protein; InterPro: IPR012901 Thi 92.69
KOG2360|consensus 413 92.62
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 92.59
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 92.15
PF11899 380 DUF3419: Protein of unknown function (DUF3419); In 91.61
COG4262 508 Predicted spermidine synthase with an N-terminal m 91.34
KOG2912|consensus 419 90.79
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 90.5
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 90.15
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 89.57
KOG0821|consensus 326 89.45
KOG1269|consensus 364 89.18
KOG2198|consensus 375 88.97
KOG1709|consensus 271 88.85
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 88.78
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 88.78
KOG3178|consensus 342 88.71
PF05575 286 V_cholerae_RfbT: Vibrio cholerae RfbT protein; Int 88.42
KOG2782|consensus 303 88.2
PF01861 243 DUF43: Protein of unknown function DUF43; InterPro 88.12
COG3510 237 CmcI Cephalosporin hydroxylase [Defense mechanisms 87.69
KOG1331|consensus 293 87.37
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 87.23
PLN02668 386 indole-3-acetate carboxyl methyltransferase 86.06
PF01234 256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 85.99
KOG2352|consensus 482 85.38
PF07279 218 DUF1442: Protein of unknown function (DUF1442); In 85.34
KOG3924|consensus 419 85.0
COG5379 414 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3 84.95
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 84.85
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 84.84
KOG2793|consensus 248 84.83
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 84.48
PF02086 260 MethyltransfD12: D12 class N6 adenine-specific DNA 84.12
PF03721 185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 83.68
PRK10458 467 DNA cytosine methylase; Provisional 83.37
KOG3045|consensus325 83.13
KOG0022|consensus 375 82.92
TIGR00497 501 hsdM type I restriction system adenine methylase ( 82.32
KOG2671|consensus 421 81.73
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
Probab=99.92  E-value=1.1e-24  Score=155.60  Aligned_cols=127  Identities=33%  Similarity=0.557  Sum_probs=108.5

Q ss_pred             cccccccchhhhcCCCCCHHHHHHHHhCCCCCCCCCC-CCccccccccccCCCCcccchHHHHHHHHHHhcccCCCCEEE
Q psy7827           5 KIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHN-DSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVL   83 (140)
Q Consensus         5 ~~~m~~~~~l~~~~~~~~~~~~~a~~~~~r~~f~~~~-~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vL   83 (140)
                      ++.|||  +|++.+.+.++++.+||+++||+.|.|.. ...+|.|.+++.+++++++.|.++..+++.+.  ++++++||
T Consensus         2 ~~~lv~--~l~~~g~v~~~~v~~A~~~VpR~~Fvp~~~~~~aY~d~~l~i~~~~~is~P~~~a~~l~~L~--l~pg~~VL   77 (209)
T PF01135_consen    2 NKALVD--NLIRPGDVTDPRVLDAFRAVPREDFVPPAFRDLAYEDRPLPIGCGQTISAPSMVARMLEALD--LKPGDRVL   77 (209)
T ss_dssp             HHHHHH--HHHHTTSS-SHHHHHHHHHS-GGGCSSCGGGGGTTSSS-EEEETTEEE--HHHHHHHHHHTT--C-TT-EEE
T ss_pred             HHHHHH--HHHHcCCCCCHHHHHHHHhCCHHHhCchhhhcCCCCCCCeeecceeechHHHHHHHHHHHHh--cCCCCEEE
Confidence            567996  78878878999999999999999999984 57899999999999999999999999999999  99999999


Q ss_pred             EEcCCCChHHHHHHHHhCCCCeEEEEcCCHHHHHHH-hchhhcCCCCCCCcEEEeec
Q psy7827          84 DVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHA-SNVTTLHYPKLNKRIKFICE  139 (140)
Q Consensus        84 DiGcG~G~~~~~la~~~~~~~~v~gvD~s~~~i~~a-~~~~~~~~~~~~~~i~~~~g  139 (140)
                      |||||+|+.+..++..+++.+.|++||+++.+.+.| +++...+..    +|.+++|
T Consensus        78 eIGtGsGY~aAlla~lvg~~g~Vv~vE~~~~l~~~A~~~l~~~~~~----nv~~~~g  130 (209)
T PF01135_consen   78 EIGTGSGYQAALLAHLVGPVGRVVSVERDPELAERARRNLARLGID----NVEVVVG  130 (209)
T ss_dssp             EES-TTSHHHHHHHHHHSTTEEEEEEESBHHHHHHHHHHHHHHTTH----SEEEEES
T ss_pred             EecCCCcHHHHHHHHhcCccceEEEECccHHHHHHHHHHHHHhccC----ceeEEEc
Confidence            999999999999999998888899999999999999 999998874    6777664



1.1.77 from EC) (PCMT) [] (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyses the transfer of a methyl group from S-adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerisation of normal L-aspartyl and L-asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process; PDB: 3LBF_A 1DL5_B 1JG3_B 1JG2_A 1JG1_A 1JG4_A 2YXE_A 2PBF_B 1VBF_C 1R18_A ....

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG1227|consensus Back     alignment and domain information
>KOG2651|consensus Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG2078|consensus Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>KOG1098|consensus Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>KOG2920|consensus Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>KOG2360|consensus Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG2912|consensus Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0821|consensus Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>PF05575 V_cholerae_RfbT: Vibrio cholerae RfbT protein; InterPro: IPR008890 This family consists of several RfbT proteins from Vibrio cholerae Back     alignment and domain information
>KOG2782|consensus Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>KOG3924|consensus Back     alignment and domain information
>COG5379 BtaA S-adenosylmethionine:diacylglycerol 3-amino-3-carboxypropyl transferase [Lipid metabolism] Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG2793|consensus Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 3e-20
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 2e-16
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 4e-12
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 3e-10
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 5e-07
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 94.0 bits (232), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 5/120 (4%) Query: 20 IKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPG 79 IK+ +V + M+ DR H+ N YM + + IG+ + I P HA LELL D+L G Sbjct: 22 IKTDKVFEVMLATDRSHYAKCN---PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEG 78 Query: 80 AKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYPKL--NKRIKFI 137 AK LDVGSGSG LT CFA MVG G V+G++HI E+V+ + N P L + R++ + Sbjct: 79 AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLV 138
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 6e-37
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 7e-35
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 5e-32
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 1e-30
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 1e-27
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 1e-25
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 6e-25
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 5e-23
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 6e-11
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 5e-10
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 8e-10
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-09
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 5e-09
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 6e-09
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 6e-09
2b25_A 336 Hypothetical protein; structural genomics, methyl 4e-08
3ocj_A 305 Putative exported protein; structural genomics, PS 5e-08
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 7e-08
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 8e-08
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-07
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 2e-07
3i9f_A170 Putative type 11 methyltransferase; structural gen 7e-07
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 8e-07
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 9e-07
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 1e-06
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 2e-06
3f4k_A 257 Putative methyltransferase; structural genomics, P 4e-06
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 6e-06
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 7e-06
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 8e-06
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 9e-06
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 1e-05
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 2e-05
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 2e-05
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 2e-05
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 3e-05
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 3e-05
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 3e-05
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 4e-05
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 5e-05
2p7i_A 250 Hypothetical protein; putative methyltransferase, 5e-05
1xxl_A 239 YCGJ protein; structural genomics, protein structu 5e-05
3ege_A 261 Putative methyltransferase from antibiotic biosyn 6e-05
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 6e-05
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 6e-05
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 6e-05
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 8e-05
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 9e-05
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 1e-04
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 1e-04
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 1e-04
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 2e-04
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 2e-04
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 2e-04
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 2e-04
3cc8_A 230 Putative methyltransferase; structural genomics, j 2e-04
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 2e-04
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 2e-04
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 2e-04
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 3e-04
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 3e-04
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 3e-04
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 4e-04
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 4e-04
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 4e-04
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 4e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 5e-04
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 5e-04
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 5e-04
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 6e-04
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 6e-04
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 6e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  124 bits (315), Expect = 6e-37
 Identities = 51/121 (42%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 20  IKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPG 79
           IK+ +V + M+  DR H+        YM + + IG+ + I  P  HA  LELL D+L  G
Sbjct: 22  IKTDKVFEVMLATDRSHYA---KCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEG 78

Query: 80  AKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHA-SNVTTLHYPKLN-KRIKFI 137
           AK LDVGSGSG LT CFA MVG  G V+G++HI E+V+ + +NV       L+  R++ +
Sbjct: 79  AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLV 138

Query: 138 C 138
            
Sbjct: 139 V 139


>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B* 3pla_E* Length = 232 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4er3_A* 3sr4_A* Length = 438 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.82
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.81
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.8
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.79
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.77
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.76
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.74
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 99.71
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 99.49
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.37
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.36
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.35
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.35
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 99.34
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.34
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.33
2b25_A 336 Hypothetical protein; structural genomics, methyl 99.33
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 99.32
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.3
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.3
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 99.3
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 99.3
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.29
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 99.29
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 99.28
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.28
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 99.28
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 99.27
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 99.26
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 99.26
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.26
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.26
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 99.24
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.24
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 99.24
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.24
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 99.24
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.23
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.23
2h00_A 254 Methyltransferase 10 domain containing protein; st 99.23
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.22
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.22
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.22
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.22
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.22
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.21
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.21
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.21
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 99.2
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 99.19
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 99.19
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.19
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 99.19
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.18
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.18
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.18
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.18
1pjz_A 203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.18
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.18
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.18
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 99.18
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.18
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 99.17
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 99.17
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.17
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.17
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.17
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 99.16
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.16
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.16
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.16
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 99.16
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 99.15
3f4k_A 257 Putative methyltransferase; structural genomics, P 99.15
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 99.15
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 99.15
2b3t_A 276 Protein methyltransferase HEMK; translation termin 99.15
1xxl_A 239 YCGJ protein; structural genomics, protein structu 99.15
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.14
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.14
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.14
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.14
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.13
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.13
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.13
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.13
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.13
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.13
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.13
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.13
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.12
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 99.12
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 99.12
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.12
3lpm_A 259 Putative methyltransferase; structural genomics, p 99.11
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 99.11
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.11
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.11
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.11
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 99.11
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 99.1
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.1
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.1
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.1
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 99.09
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.09
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.09
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 99.09
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 99.08
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 99.07
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.07
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.07
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.07
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.07
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 99.07
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.07
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.07
3ocj_A 305 Putative exported protein; structural genomics, PS 99.06
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.06
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 99.05
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.05
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.05
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.05
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.05
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 99.05
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 99.04
3k6r_A278 Putative transferase PH0793; structural genomics, 99.04
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.04
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 99.03
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 99.03
3ege_A 261 Putative methyltransferase from antibiotic biosyn 99.02
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.02
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 99.02
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.01
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.01
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.01
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 99.01
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 99.0
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.0
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.0
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.0
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.99
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.99
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.99
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.99
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 98.99
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.98
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 98.98
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 98.98
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.98
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 98.98
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 98.97
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.97
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.97
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 98.97
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.96
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.96
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.96
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.96
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.95
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.95
3lcc_A 235 Putative methyl chloride transferase; halide methy 98.95
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 98.95
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.94
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.94
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.91
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.91
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.91
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 98.91
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 98.91
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 98.9
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.9
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 98.89
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 98.89
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.88
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 98.88
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 98.88
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 98.88
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 98.87
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.87
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.87
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.86
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.86
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.86
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.85
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 98.85
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.85
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.84
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.84
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 98.84
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 98.84
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.83
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.83
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.83
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.83
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.82
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 98.82
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 98.82
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 98.82
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 98.81
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.81
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 98.81
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.81
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 98.8
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.8
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.79
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 98.79
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.78
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.78
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.77
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 98.77
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.77
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 98.76
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.76
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 98.76
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 98.76
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.76
2pt6_A 321 Spermidine synthase; transferase, structural genom 98.76
2qm3_A 373 Predicted methyltransferase; putative methyltransf 98.74
2o07_A 304 Spermidine synthase; structural genomics, structur 98.74
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 98.73
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 98.73
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.73
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 98.73
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 98.73
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 98.73
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 98.72
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 98.72
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.72
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 98.72
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 98.71
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.7
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.69
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 98.69
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 98.68
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.68
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.68
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.68
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.68
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 98.67
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.65
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 98.64
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.63
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.62
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.62
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.62
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.61
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.61
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 98.61
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 98.6
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.59
2zig_A297 TTHA0409, putative modification methylase; methylt 98.55
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.52
3dou_A 191 Ribosomal RNA large subunit methyltransferase J; c 98.52
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.51
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 98.5
3cc8_A 230 Putative methyltransferase; structural genomics, j 98.49
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.46
3cvo_A 202 Methyltransferase-like protein of unknown functio; 98.43
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.42
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 98.38
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 98.33
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 98.3
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 98.3
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.29
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.28
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 98.27
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 98.26
3lkd_A 542 Type I restriction-modification system methyltrans 98.25
3khk_A 544 Type I restriction-modification system methylation 98.24
3sso_A 419 Methyltransferase; macrolide, natural product, ros 98.24
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 98.24
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.19
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 98.17
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.15
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 98.14
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.14
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.13
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.96
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 97.93
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.92
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.92
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 97.9
3ufb_A 530 Type I restriction-modification system methyltran 97.89
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 97.81
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 97.74
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.71
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 97.45
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 97.31
2qy6_A 257 UPF0209 protein YFCK; structural genomics, unknown 97.3
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 97.27
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 97.11
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.0
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 96.96
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 96.81
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 96.74
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 96.73
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 96.28
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 95.94
3c6k_A 381 Spermine synthase; spermidine aminopropyltransfera 95.83
2ld4_A 176 Anamorsin; methyltransferase-like fold, alpha/beta 95.79
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 95.68
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 95.42
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 94.41
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 93.84
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 93.79
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 93.6
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 93.58
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 93.56
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 93.28
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 93.13
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 93.11
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 93.07
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 93.04
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 93.01
2oo3_A 283 Protein involved in catabolism of external DNA; st 92.98
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 92.67
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 92.61
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 92.31
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 91.2
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 90.98
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 90.91
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 90.56
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 90.53
3me5_A 482 Cytosine-specific methyltransferase; structural ge 89.87
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 89.57
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 89.55
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 89.55
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 88.92
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 88.7
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 88.41
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 88.3
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 87.99
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 87.84
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 87.82
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 87.69
4dkj_A 403 Cytosine-specific methyltransferase; CG-specificit 87.62
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 87.6
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 87.41
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 87.4
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 86.81
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 86.53
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.29
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 86.21
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 86.08
3gms_A 340 Putative NADPH:quinone reductase; structural genom 85.9
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 85.62
1rjd_A 334 PPM1P, carboxy methyl transferase for protein phos 85.28
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 85.11
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 84.45
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 84.08
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 84.05
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 83.79
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 83.46
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 83.45
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 82.88
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 82.68
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 82.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 81.94
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 81.64
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 81.58
3ps9_A 676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 80.9
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
Probab=99.82  E-value=1.5e-19  Score=128.70  Aligned_cols=129  Identities=32%  Similarity=0.504  Sum_probs=108.1

Q ss_pred             cccccccchhhhcCCCCCHHHHHHHHhCCCCCCCCCCCCccccccccccCCCCcccchHHHHHHHHHHhcccCCCCEEEE
Q psy7827           5 KIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLD   84 (140)
Q Consensus         5 ~~~m~~~~~l~~~~~~~~~~~~~a~~~~~r~~f~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLD   84 (140)
                      +..|++  +|++.+++.++.+.++|..+||+.|.+..   .|.+.++..+.++.+..+.+...+++.+...+.++.+|||
T Consensus        12 ~~~~~~--~l~~~~~~~~~~v~~~~~~~~r~~f~p~~---~y~d~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~VLd   86 (227)
T 2pbf_A           12 HKSLLE--NLKRRGIIDDDDVYNTMLQVDRGKYIKEI---PYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAID   86 (227)
T ss_dssp             HHHHHH--HHHHTTSCCCHHHHHHHHTSCGGGTCSSS---TTSSSCEEEETTEEECCHHHHHHHHHHHTTTSCTTCEEEE
T ss_pred             HHHHHH--HHHhcCCcCCHHHHHHHHhCCHHHcCCcc---cCCCCccccCCCCccCChHHHHHHHHHHHhhCCCCCEEEE
Confidence            455774  88888878999999999999999999876   8999999999999999999999999988544778899999


Q ss_pred             EcCCCChHHHHHHHHhC----CCCeEEEEcCCHHHHHHH-hchhhcCCCCC-CCcEEEee
Q psy7827          85 VGSGSGYLTTCFAHMVG----KNGSVVGVEHIPEIVNHA-SNVTTLHYPKL-NKRIKFIC  138 (140)
Q Consensus        85 iGcG~G~~~~~la~~~~----~~~~v~gvD~s~~~i~~a-~~~~~~~~~~~-~~~i~~~~  138 (140)
                      +|||+|.++..+++..+    +.++|+++|+++.+++.| +++...+...+ ..++++++
T Consensus        87 iG~G~G~~~~~la~~~~~~~~~~~~v~~vD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~  146 (227)
T 2pbf_A           87 VGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIH  146 (227)
T ss_dssp             ESCTTSHHHHHHHHHTTTTTCTTCEEEEEESCHHHHHHHHHHHHHHCGGGGSSTTEEEEE
T ss_pred             ECCCCCHHHHHHHHHhcccCCCCCEEEEEeCCHHHHHHHHHHHHHcCccccccCCEEEEE
Confidence            99999999999999875    556899999999999999 88887762100 13566654



>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 4e-20
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-15
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 8e-10
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 3e-08
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 9e-08
d1i9ga_ 264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 1e-07
d1yb2a1 250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 6e-07
d1dl5a1213 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methylt 9e-06
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 1e-05
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 2e-05
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 4e-05
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 5e-05
d1o54a_ 266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 4e-04
d1u2za_ 406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 5e-04
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 5e-04
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 6e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 0.001
d1jqea_ 280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.002
d1ri5a_ 252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 0.002
d1p91a_ 268 c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher 0.002
d1y8ca_ 246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.002
d2i6ga1 198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 0.003
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 80.3 bits (197), Expect = 4e-20
 Identities = 49/109 (44%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 20  IKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPG 79
           IK+ +V + M+  DR H+        YM + + IG+ + I  P  HA  LELL D+L  G
Sbjct: 21  IKTDKVFEVMLATDRSHYA---KCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEG 77

Query: 80  AKVLDVGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHASNVTTLHYP 128
           AK LDVGSGSG LT CFA MVG  G V+G++HI E+V+ + N      P
Sbjct: 78  AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDP 126


>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.93
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.91
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.91
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.87
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.81
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.55
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.49
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.48
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.48
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.46
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 99.46
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.46
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.45
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.44
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.39
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.38
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.37
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 99.35
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.34
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.34
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 99.33
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.32
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.32
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.31
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.3
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.29
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 99.24
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.24
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.24
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.23
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 99.22
d2h00a1 250 Methyltransferase 10 domain containing protein MET 99.16
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.15
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.15
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 99.15
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.15
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 99.13
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.13
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.13
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.12
d1m6ya2 192 TM0872, methyltransferase domain {Thermotoga marit 99.12
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.11
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.1
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 99.09
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.08
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.08
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 99.07
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.06
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.04
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.03
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 99.03
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.02
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.01
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.01
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.0
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.99
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.99
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.98
d1susa1 227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.96
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 98.95
d1nv8a_ 271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.95
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 98.9
d2igta1 309 Putative methyltransferase Atu0340 {Agrobacterium 98.88
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.88
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.87
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 98.84
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.84
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 98.78
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.75
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.74
d2b78a2 317 Hypothetical protein SMu776, middle and C-terminal 98.71
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.7
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.65
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 98.65
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.3
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.25
d1wg8a2 182 TM0872, methyltransferase domain {Thermus thermoph 98.24
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.17
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.98
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.98
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.94
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 97.86
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.83
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 97.74
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.73
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.69
d1sqga2 284 Ribosomal RNA small subunit methyltransferase B, R 97.67
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.63
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.45
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 97.43
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.38
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.32
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.3
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 97.3
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.27
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.24
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.2
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.2
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 97.19
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.07
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.06
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.06
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 96.91
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 96.85
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.66
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.18
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.15
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.14
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.56
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.54
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.22
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.89
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 94.81
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 94.6
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 94.42
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.03
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 93.73
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.55
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 93.36
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.89
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 92.69
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.37
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.25
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.92
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 91.59
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 91.55
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 91.51
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 91.03
d1dlja2 196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 90.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 90.67
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.41
d2g5ca2 171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.4
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 89.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 88.99
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 86.2
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 85.49
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 85.32
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 84.85
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 84.09
d2f1ka2 165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 83.82
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 82.14
d1e5qa1 182 Saccharopine reductase {Rice blast fungus (Magnapo 81.96
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 81.45
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 80.84
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 80.8
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 80.48
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 80.35
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=2.2e-26  Score=163.50  Aligned_cols=129  Identities=40%  Similarity=0.667  Sum_probs=114.3

Q ss_pred             cccccccchhhhcCCCCCHHHHHHHHhCCCCCCCCCCCCccccccccccCCCCcccchHHHHHHHHHHhcccCCCCEEEE
Q psy7827           5 KIFMVPTDYIVEIDSIKSPRVIDAMIHIDRGHFCAHNDSRKYMLAARDIGYGSIIDNPVQHAEVLELLKDKLVPGAKVLD   84 (140)
Q Consensus         5 ~~~m~~~~~l~~~~~~~~~~~~~a~~~~~r~~f~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLD   84 (140)
                      +..|||  +|+++++|+++++.+||+.+||+.|.|..   +|.|.++++++++.++.|.+...+++.|...++++++|||
T Consensus         8 ~~~mv~--~l~~~g~i~~~~v~~a~~~vpRe~Fvp~~---aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~VLd   82 (224)
T d1i1na_           8 HSELIH--NLRKNGIIKTDKVFEVMLATDRSHYAKCN---PYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALD   82 (224)
T ss_dssp             HHHHHH--HHHHTTSCCSHHHHHHHHTSCGGGTCSSC---TTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEEEE
T ss_pred             HHHHHH--HHHHcCCCCCHHHHHHHHhCCHHHcCCcc---cCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeEEE
Confidence            456996  88889989999999999999999999865   8999999999999999999999999999544889999999


Q ss_pred             EcCCCChHHHHHHHHhCCCCeEEEEcCCHHHHHHH-hchhhcCCCCC-CCcEEEee
Q psy7827          85 VGSGSGYLTTCFAHMVGKNGSVVGVEHIPEIVNHA-SNVTTLHYPKL-NKRIKFIC  138 (140)
Q Consensus        85 iGcG~G~~~~~la~~~~~~~~v~gvD~s~~~i~~a-~~~~~~~~~~~-~~~i~~~~  138 (140)
                      ||||+|+.+..+++.+++.++|+++|+++++++.| +++.+.++.++ ..++.+++
T Consensus        83 iG~GsGy~ta~la~l~~~~g~V~~ie~~~~l~~~a~~~l~~~~~~~~~~~~~~~~~  138 (224)
T d1i1na_          83 VGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVV  138 (224)
T ss_dssp             ETCTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHHCTHHHHTSSEEEEE
T ss_pred             ecCCCCHHHHHHHHHhCCCceEEEEcCCHHHHHHHHHhccccCcccccccceEEEE
Confidence            99999999999999998889999999999999999 99988776433 34555554



>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure