Psyllid ID: psy7829


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-
MTTKLIEKTTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
ccccccccccccEEEEccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccEEEEccccccccHHHHHHHccccEEEEEEEcccccEEEEEEEEcccccEEEEEEccEEEccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHcccccEEcccEEEEcccccccccEEEEccccccccHHHHHcHHHcccEEEEccccccccHHHHHHHHHHHHHHcccccccccccEEEcEEc
cccEEEEEccccEEEcccccEEEcccccccHHHHHHHcHHHcccccEccccccHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHccHHHcccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHccHHHccEEEEEEccEEccccHHHHHHEEEEEEEEEEEccccccEEEEEEEEcccccEEEEccccEEEEEcccHHHHHcccccccccccccHHHHHcccHHcccccccEEEccccccccccccccccccccccEEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHcccHHHHHcccEEEHHHHHHHHHHHccccccHcEcccccHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHHHHHcHHHHHcccEEEEEEc
mttkliektttnlvyrpgysqvytegdiqneddfcrkdmdefpeghwvipppdnlnhfknegtcQTDLVNHLRDIGKIRTERVAQAFYkvdrgnfaneepyqdvsaslgyagvmnapnQIADAAENLKLHlvdgakvldlgsgsgyqTCVFAHmvgptgkvigvehIPELIEASLRNISKGNKDLLDSGRVRIVEAdaregylpeapydviyyggcvsevpSRVLNQLKkggrilapigpmddfqkltqidrfhdntlqktdLFEVAYDAIMRKALQMDIhkfqmdpvdenlftlmdkdsdELFSERVWElkqdplyttekwipqppgyttpgeittrdkygrlvhgsapdngpsseRSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLvgptghvtgLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLvgptghvtgLEHMMDIAIESIANISTNHIDLIANETIEIIREF
mttkliektttnlvyrpgysqvytegDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYkvdrgnfaneePYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKgnkdlldsgrVRIVEAdaregylpeapYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELkqdplyttekwipqppgyTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
MTTKLIEKTTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
********TTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTT***I************************IAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEII***
********TTTNLVYRPGYS**********************************************DLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDP********************VWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
MTTKLIEKTTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
*TTKLIEKTTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTKLIEKTTTNLVYRPGYSQVYTEGDIQNEDDFCRKDMDEFPEGHWVIPPPDNLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKFQMDPVDENLFTLMDKDSDELFSERVWELKQDPLYTTEKWIPQPPGYTTPGEITTRDKYGRLVHGSAPDNGPSSERSIAHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIPHILDLCYLNLHRGAKVLEIGSGSGYLATLMAHLVGPTGHVTGLEHMMDIAIESIANISTNHIDLIANETIEIIREF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query511 2.2.26 [Sep-21-2011]
Q92047228 Protein-L-isoaspartate(D- yes N/A 0.422 0.947 0.422 7e-46
P15246227 Protein-L-isoaspartate(D- yes N/A 0.422 0.951 0.418 4e-44
P80895227 Protein-L-isoaspartate(D- yes N/A 0.422 0.951 0.418 5e-44
P23506227 Protein-L-isoaspartate(D- yes N/A 0.422 0.951 0.418 7e-44
P22061227 Protein-L-isoaspartate(D- no N/A 0.422 0.951 0.418 2e-43
P22062227 Protein-L-isoaspartate(D- yes N/A 0.422 0.951 0.413 2e-43
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.422 0.951 0.418 2e-43
Q5RA89227 Protein-L-isoaspartate(D- no N/A 0.422 0.951 0.418 2e-43
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.422 0.947 0.395 7e-43
Q27873225 Protein-L-isoaspartate O- yes N/A 0.393 0.893 0.399 4e-40
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 133/220 (60%)

Query: 58  FKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAP 117
           +K+ G    +LVN+LR  G I+++RV +     DR +F+   PY D   S+GY   ++AP
Sbjct: 3   WKSGGASHAELVNNLRKNGIIKSDRVYEVMLATDRSHFSRCNPYMDSPQSIGYQATISAP 62

Query: 118 NQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRN 177
           +  A A E L  HL +GAK LD+GSGSG  +  F+ MVGPTGKVIG++HI EL+E S+ N
Sbjct: 63  HMHAYALELLHDHLYEGAKALDVGSGSGILSVCFSRMVGPTGKVIGIDHIKELVEDSIAN 122

Query: 178 ISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAP 237
           + K +  L+ SGR++++  D R G+  EAPYD I+ G     VP  +L+QLK GGR++ P
Sbjct: 123 VKKDDPSLITSGRIKLIVGDGRMGFTEEAPYDAIHVGAAAPTVPQALLDQLKPGGRLILP 182

Query: 238 IGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQ 277
           +GP    Q L Q D+  D + +   L  V Y  +  K  Q
Sbjct: 183 VGPAGGNQMLEQYDKLEDGSTKMKPLMGVIYVPLTDKDKQ 222




Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins.
Danio rerio (taxid: 7955)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q27873|PIMT_CAEEL Protein-L-isoaspartate O-methyltransferase OS=Caenorhabditis elegans GN=pcm-1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query511
241566262277 protein-L-isoaspartate(D-aspartate) O-me 0.430 0.794 0.445 2e-49
326919840248 PREDICTED: protein-L-isoaspartate(D-aspa 0.442 0.911 0.442 2e-46
224050699245 PREDICTED: protein-L-isoaspartate(D-aspa 0.430 0.897 0.440 4e-46
427781597232 Putative protein-l-isoaspartated-asparta 0.430 0.948 0.427 6e-46
291222791257 PREDICTED: Protein-L-isoaspartate (D-asp 0.430 0.856 0.418 7e-46
410898491249 PREDICTED: protein-L-isoaspartate(D-aspa 0.412 0.847 0.431 3e-45
260830152230 hypothetical protein BRAFLDRAFT_284774 [ 0.430 0.956 0.413 4e-45
226443368249 Protein-L-isoaspartateD-aspartate O-meth 0.430 0.883 0.431 9e-45
322791057436 hypothetical protein SINV_06781 [Solenop 0.702 0.823 0.315 9e-45
318102097249 l-isoaspartate(d-aspartate) o-methyltran 0.409 0.839 0.440 3e-44
>gi|241566262|ref|XP_002402129.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] gi|215499989|gb|EEC09483.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 98/220 (44%), Positives = 140/220 (63%)

Query: 58  FKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAP 117
           +++ G    +LV +L+  G IR+ +V Q   +VDRG++    PY D    +GYA  ++AP
Sbjct: 23  WRSHGKTNLELVRNLKHNGIIRSAKVEQVMSQVDRGHYVKHNPYMDSPQGIGYAVTISAP 82

Query: 118 NQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRN 177
           +  A A E+LK HL +GAK LD+GSGSGY T   A MVG TG+ IG++HIPEL++ S+ N
Sbjct: 83  HMHAQALESLKDHLYEGAKALDVGSGSGYLTVCMALMVGETGRTIGIDHIPELVDQSIAN 142

Query: 178 ISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAP 237
           I KG+  LLDS R+R++  D R GY  EAPYD I+ G    E+P +++ QLK GGR++ P
Sbjct: 143 IHKGHPALLDSKRLRMIVGDGRVGYPEEAPYDAIHVGAAAPELPKQLIEQLKPGGRLICP 202

Query: 238 IGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQ 277
           +GP    Q L Q+D+  D T+++T L  V Y  +  K  Q
Sbjct: 203 VGPAGQSQTLEQVDKLQDGTVKRTSLMGVVYVPLTDKEAQ 242




Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|326919840|ref|XP_003206185.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Meleagris gallopavo] gi|363734030|ref|XP_420939.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase [Gallus gallus] Back     alignment and taxonomy information
>gi|224050699|ref|XP_002195928.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|427781597|gb|JAA56250.1| Putative protein-l-isoaspartated-aspartate o-methyltransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|291222791|ref|XP_002731398.1| PREDICTED: Protein-L-isoaspartate (D-aspartate) O-methyltransferase-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|410898491|ref|XP_003962731.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|260830152|ref|XP_002610025.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] gi|229295388|gb|EEN66035.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|226443368|ref|NP_001140111.1| Protein-L-isoaspartateD-aspartate O-methyltransferase precursor [Salmo salar] gi|221222218|gb|ACM09770.1| Protein-L-isoaspartateD-aspartate O-methyltransferase [Salmo salar] Back     alignment and taxonomy information
>gi|322791057|gb|EFZ15657.1| hypothetical protein SINV_06781 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|318102097|ref|NP_001188104.1| l-isoaspartate(d-aspartate) o-methyltransferase precursor [Ictalurus punctatus] gi|308322677|gb|ADO28476.1| l-isoaspartate(d-aspartate) o-methyltransferase [Ictalurus punctatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query511
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.438 0.982 0.446 1.8e-46
ZFIN|ZDB-GENE-990415-134266 pcmt "l-isoaspartyl protein ca 0.430 0.827 0.422 1.5e-44
ZFIN|ZDB-GENE-040426-1738249 pcmtl "l-isoaspartyl protein c 0.426 0.875 0.412 2.2e-43
UNIPROTKB|P80895227 PCMT1 "Protein-L-isoaspartate( 0.430 0.969 0.418 4.5e-43
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.430 0.964 0.418 4.5e-43
UNIPROTKB|P15246227 PCMT1 "Protein-L-isoaspartate( 0.430 0.969 0.418 4.5e-43
MGI|MGI:97502227 Pcmt1 "protein-L-isoaspartate 0.430 0.969 0.418 5.7e-43
UNIPROTKB|H7BY58286 PCMT1 "Protein-L-isoaspartate 0.430 0.769 0.418 1.2e-42
UNIPROTKB|J3KP72285 PCMT1 "Protein-L-isoaspartate 0.430 0.771 0.418 1.2e-42
UNIPROTKB|P22061227 PCMT1 "Protein-L-isoaspartate( 0.430 0.969 0.418 1.2e-42
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 1.8e-46, P = 1.8e-46
 Identities = 100/224 (44%), Positives = 134/224 (59%)

Query:    60 NEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQ 119
             + G    +LVN+L   G I+++RV       DRG++    PY D   S+GY   ++AP+ 
Sbjct:     5 SSGKTHPELVNNLYKKGIIKSQRVFDVLLATDRGHYIKYFPYMDSPQSIGYKATISAPHM 64

Query:   120 IADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNIS 179
              A A E LK  LV+GAK LD+GSGSGY T  FA MVGPTGK +GVEHI EL+  S+RN+ 
Sbjct:    65 HAHALELLKDQLVEGAKALDVGSGSGYLTACFARMVGPTGKAVGVEHIKELVNESIRNVK 124

Query:   180 KGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIG 239
             + +  LL SGRV++V  D R+GY  EAPYD I+ G     VP  +LN+LK GGR++ P+G
Sbjct:   125 EDDPTLLSSGRVKLVVGDGRQGYPEEAPYDAIHVGAAAPTVPQELLNELKPGGRLILPVG 184

Query:   240 PMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDIHKF 283
             P    Q L Q D+  D  + +T L  V Y  +  K  Q    +F
Sbjct:   185 PEGANQVLMQYDKTSDGQIIETQLMGVIYVPLTDKEKQWPRDEF 228


GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
ZFIN|ZDB-GENE-990415-134 pcmt "l-isoaspartyl protein carboxyl methyltransferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1738 pcmtl "l-isoaspartyl protein carboxyl methyltransferase, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P80895 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P15246 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:97502 Pcmt1 "protein-L-isoaspartate (D-aspartate) O-methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H7BY58 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP72 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22061 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 2e-54
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 8e-43
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 1e-35
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 5e-34
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 5e-26
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 2e-21
TIGR04364394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 9e-21
PRK13943322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 3e-17
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 3e-14
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 1e-13
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 3e-13
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 7e-11
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 3e-10
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 3e-10
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 4e-10
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 5e-10
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 6e-09
TIGR04188363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 1e-08
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 2e-08
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 2e-08
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 5e-08
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 5e-08
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 9e-08
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 9e-08
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 3e-07
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 8e-07
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 1e-06
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 2e-06
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 3e-06
PRK08317 241 PRK08317, PRK08317, hypothetical protein; Provisio 3e-06
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 4e-06
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 5e-06
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 6e-06
TIGR02752231 TIGR02752, MenG_heptapren, demethylmenaquinone met 8e-06
TIGR02752 231 TIGR02752, MenG_heptapren, demethylmenaquinone met 8e-06
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 1e-05
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 1e-05
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 2e-05
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 2e-05
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 3e-05
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 4e-05
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 1e-04
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 1e-04
pfam01209233 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransf 1e-04
pfam01269229 pfam01269, Fibrillarin, Fibrillarin 1e-04
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 2e-04
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 3e-04
PRK00216 239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 3e-04
COG2263198 COG2263, COG2263, Predicted RNA methylase [Transla 5e-04
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 6e-04
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 0.001
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 0.001
PRK11873 272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 0.001
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 0.001
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 0.001
COG2226 238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.001
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.001
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 0.001
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 0.002
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.002
TIGR04188 363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 0.003
TIGR04188 363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 0.003
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 0.003
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 0.004
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 0.004
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 0.004
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  181 bits (462), Expect = 2e-54
 Identities = 81/206 (39%), Positives = 122/206 (59%), Gaps = 12/206 (5%)

Query: 67  DLVNHLRDIGKIRTERVAQAFYKVDRGNFANEE----PYQDVSASLGYAGVMNAPNQIAD 122
            L+ +L++ G I +++VA+A   VDR  F  E      Y+D+  S+GY   ++AP+  A 
Sbjct: 5   ALIENLKNYGVIASDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHAM 64

Query: 123 AAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGN 182
             E L+L    G +VL++GSGSGY T  FA MVG  G V+ +EHIPEL+E + RN+ K  
Sbjct: 65  MLELLEL--KPGMRVLEIGSGSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEK-- 120

Query: 183 KDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMD 242
              L    V +V  D R+G+   APYD I+ G    E+P  +++QLK+GGR++ P+GP +
Sbjct: 121 ---LGLENVIVVVGDGRQGWPEFAPYDAIHVGAAAPEIPEALIDQLKEGGRLVIPVGP-N 176

Query: 243 DFQKLTQIDRFHDNTLQKTDLFEVAY 268
             Q L Q D+ +D ++   DL  V +
Sbjct: 177 GNQVLQQFDKRNDGSVVIKDLEGVRF 202


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase Back     alignment and domain information
>gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family Back     alignment and domain information
>gnl|CDD|201699 pfam01269, Fibrillarin, Fibrillarin Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 511
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 100.0
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 100.0
KOG1661|consensus237 99.97
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.96
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.96
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.96
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.92
PLN02336475 phosphoethanolamine N-methyltransferase 99.89
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.87
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.87
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.68
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.66
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.65
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.64
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.63
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.63
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.58
PLN02233261 ubiquinone biosynthesis methyltransferase 99.58
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.56
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.55
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.55
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.55
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.55
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.54
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.54
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.54
COG2890280 HemK Methylase of polypeptide chain release factor 99.53
PLN02244340 tocopherol O-methyltransferase 99.53
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.52
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.52
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.52
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.5
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.5
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.5
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.49
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.49
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.49
PRK14903431 16S rRNA methyltransferase B; Provisional 99.49
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.48
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.48
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.47
PRK14901434 16S rRNA methyltransferase B; Provisional 99.47
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.46
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.46
PRK10901427 16S rRNA methyltransferase B; Provisional 99.46
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.44
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.44
KOG2904|consensus328 99.44
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.43
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.43
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.43
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.43
PRK11207197 tellurite resistance protein TehB; Provisional 99.43
PRK14902444 16S rRNA methyltransferase B; Provisional 99.43
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.43
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.42
PRK04266226 fibrillarin; Provisional 99.42
KOG1540|consensus296 99.41
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.41
PRK14904445 16S rRNA methyltransferase B; Provisional 99.41
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.41
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.41
PRK07402196 precorrin-6B methylase; Provisional 99.41
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.41
COG4123248 Predicted O-methyltransferase [General function pr 99.4
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.4
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.39
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.39
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.39
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.39
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.39
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.38
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.38
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.37
PRK08317241 hypothetical protein; Provisional 99.36
PLN02336475 phosphoethanolamine N-methyltransferase 99.36
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.36
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.35
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.34
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.34
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.34
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.34
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.33
COG4122219 Predicted O-methyltransferase [General function pr 99.33
TIGR00452314 methyltransferase, putative. Known examples to dat 99.33
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.33
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.33
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.33
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.32
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.32
PRK14967223 putative methyltransferase; Provisional 99.31
KOG1270|consensus282 99.31
PTZ00146293 fibrillarin; Provisional 99.31
PLN02490340 MPBQ/MSBQ methyltransferase 99.31
PLN02476278 O-methyltransferase 99.31
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.3
PLN02672 1082 methionine S-methyltransferase 99.3
PLN03075296 nicotianamine synthase; Provisional 99.3
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.29
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.29
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.29
PRK06922677 hypothetical protein; Provisional 99.29
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.28
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.28
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.28
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.27
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.27
PRK12335287 tellurite resistance protein TehB; Provisional 99.27
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.27
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.26
PRK05785226 hypothetical protein; Provisional 99.26
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.25
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.25
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.24
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.24
PRK07402196 precorrin-6B methylase; Provisional 99.22
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.22
PRK14968188 putative methyltransferase; Provisional 99.22
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.21
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 99.21
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.21
PLN02589247 caffeoyl-CoA O-methyltransferase 99.21
PRK04457262 spermidine synthase; Provisional 99.19
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.19
KOG1271|consensus227 99.19
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.19
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.19
KOG1541|consensus270 99.17
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.16
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.15
TIGR03438301 probable methyltransferase. This model represents 99.15
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.14
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.13
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.12
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.1
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 99.1
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.1
TIGR00438188 rrmJ cell division protein FtsJ. 99.09
PRK00811283 spermidine synthase; Provisional 99.07
PHA03412241 putative methyltransferase; Provisional 99.07
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.07
PRK06202232 hypothetical protein; Provisional 99.06
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.05
PRK04266226 fibrillarin; Provisional 99.05
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.05
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.04
KOG4300|consensus252 99.04
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.04
KOG2915|consensus314 99.03
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.03
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.03
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.03
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.01
KOG2915|consensus314 99.0
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.0
PHA03411279 putative methyltransferase; Provisional 99.0
PLN02233261 ubiquinone biosynthesis methyltransferase 98.99
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 98.99
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.98
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.98
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.97
PRK01581374 speE spermidine synthase; Validated 98.97
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.97
PLN02366308 spermidine synthase 98.97
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.96
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.96
COG4123248 Predicted O-methyltransferase [General function pr 98.96
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.96
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.95
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.95
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.95
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.95
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.94
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.93
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.93
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.93
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.93
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.92
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.92
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.92
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.91
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.9
PLN02476278 O-methyltransferase 98.9
PTZ00146293 fibrillarin; Provisional 98.89
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.88
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.88
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.88
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.87
KOG2361|consensus264 98.87
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.87
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.86
PRK03612521 spermidine synthase; Provisional 98.86
COG4122219 Predicted O-methyltransferase [General function pr 98.86
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.85
KOG3191|consensus209 98.85
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.85
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.84
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.84
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.84
KOG3420|consensus185 98.84
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.84
PRK14901434 16S rRNA methyltransferase B; Provisional 98.84
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.83
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.83
KOG2899|consensus288 98.83
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.83
COG1041347 Predicted DNA modification methylase [DNA replicat 98.83
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.83
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.83
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.83
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.82
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.82
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.82
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.82
KOG2940|consensus325 98.82
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.82
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.81
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.81
KOG1663|consensus237 98.81
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.8
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.79
PRK14904445 16S rRNA methyltransferase B; Provisional 98.79
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.78
PRK14903431 16S rRNA methyltransferase B; Provisional 98.77
PLN02244340 tocopherol O-methyltransferase 98.77
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.76
COG2521287 Predicted archaeal methyltransferase [General func 98.76
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.76
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.75
KOG3010|consensus261 98.74
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.74
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.74
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.74
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.73
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.73
PRK14902444 16S rRNA methyltransferase B; Provisional 98.73
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.71
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.71
COG4106257 Tam Trans-aconitate methyltransferase [General fun 98.71
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.7
PLN02589247 caffeoyl-CoA O-methyltransferase 98.7
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.7
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.69
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.68
PRK04457262 spermidine synthase; Provisional 98.68
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.68
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.67
PRK08317241 hypothetical protein; Provisional 98.67
KOG1661|consensus237 98.66
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.66
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.66
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.64
PLN02823336 spermine synthase 98.64
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.64
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.64
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.63
PRK10901427 16S rRNA methyltransferase B; Provisional 98.63
PLN02490340 MPBQ/MSBQ methyltransferase 98.62
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.62
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.62
KOG1499|consensus346 98.62
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.62
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.62
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.61
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.6
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.6
KOG1975|consensus389 98.6
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.6
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.59
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.58
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.58
PRK14967223 putative methyltransferase; Provisional 98.56
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.56
KOG1122|consensus460 98.55
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.55
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.55
COG2890280 HemK Methylase of polypeptide chain release factor 98.55
COG2520341 Predicted methyltransferase [General function pred 98.54
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.53
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.53
PRK11207197 tellurite resistance protein TehB; Provisional 98.53
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 98.52
PLN03075296 nicotianamine synthase; Provisional 98.52
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.51
PRK04148134 hypothetical protein; Provisional 98.51
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.51
KOG0820|consensus315 98.51
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.5
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.5
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.49
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.49
TIGR00438188 rrmJ cell division protein FtsJ. 98.49
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.49
PLN02232160 ubiquinone biosynthesis methyltransferase 98.47
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.46
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.46
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.46
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.45
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.44
KOG1500|consensus517 98.43
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.42
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.42
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.42
PRK14968188 putative methyltransferase; Provisional 98.41
KOG1270|consensus282 98.41
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.4
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.4
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 98.39
TIGR00452314 methyltransferase, putative. Known examples to dat 98.39
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.38
PRK06922 677 hypothetical protein; Provisional 98.38
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.37
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.37
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.37
PRK00536262 speE spermidine synthase; Provisional 98.37
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.36
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.36
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.35
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.34
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.33
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.33
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.33
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.32
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.32
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.3
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.29
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.29
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.28
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.27
PHA03411279 putative methyltransferase; Provisional 98.26
PRK00811283 spermidine synthase; Provisional 98.25
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 98.25
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.24
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.23
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.23
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.22
PRK01581374 speE spermidine synthase; Validated 98.22
PRK12335287 tellurite resistance protein TehB; Provisional 98.22
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.21
PHA03412241 putative methyltransferase; Provisional 98.21
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.21
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.2
KOG1541|consensus270 98.2
KOG1540|consensus296 98.2
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.2
KOG0820|consensus 315 98.18
PRK06202232 hypothetical protein; Provisional 98.18
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.17
KOG2899|consensus288 98.17
TIGR03438301 probable methyltransferase. This model represents 98.17
PRK05785226 hypothetical protein; Provisional 98.15
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.14
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 98.13
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.12
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.11
KOG2187|consensus534 98.11
KOG3420|consensus185 98.11
KOG2352|consensus482 98.09
PLN02366308 spermidine synthase 98.09
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 98.09
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.08
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.08
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.07
COG2521287 Predicted archaeal methyltransferase [General func 98.07
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 98.05
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.05
KOG1596|consensus317 98.04
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 98.04
PRK03612521 spermidine synthase; Provisional 98.02
KOG2904|consensus328 98.02
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.01
KOG1663|consensus237 98.0
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.0
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.99
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.99
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.99
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.98
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.95
PLN02672 1082 methionine S-methyltransferase 97.95
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.94
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.93
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.92
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 97.92
KOG3010|consensus261 97.9
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.9
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.86
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.86
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.85
KOG3045|consensus325 97.84
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.82
PF13679141 Methyltransf_32: Methyltransferase domain 97.81
KOG2198|consensus375 97.8
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 97.8
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.8
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.79
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.79
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.78
COG1041347 Predicted DNA modification methylase [DNA replicat 97.76
COG2384226 Predicted SAM-dependent methyltransferase [General 97.75
COG3897218 Predicted methyltransferase [General function pred 97.74
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.74
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.73
COG4262508 Predicted spermidine synthase with an N-terminal m 97.73
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.72
PRK04148134 hypothetical protein; Provisional 97.71
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.71
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.7
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.69
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.68
COG4076252 Predicted RNA methylase [General function predicti 97.68
KOG1709|consensus271 97.68
KOG1271|consensus227 97.67
KOG3191|consensus209 97.63
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.62
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.61
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.59
KOG1269|consensus364 97.57
PRK10742250 putative methyltransferase; Provisional 97.57
KOG2730|consensus263 97.56
KOG4589|consensus232 97.55
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.55
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.55
KOG1122|consensus460 97.51
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.49
COG4798238 Predicted methyltransferase [General function pred 97.49
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.46
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.45
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 97.41
KOG2187|consensus534 97.41
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.39
PRK11524284 putative methyltransferase; Provisional 97.38
COG4076252 Predicted RNA methylase [General function predicti 97.38
KOG2730|consensus263 97.36
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.35
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.34
KOG3115|consensus249 97.27
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.23
KOG1331|consensus293 97.22
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 97.2
KOG2361|consensus264 97.17
KOG4300|consensus252 97.16
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.15
PLN02823336 spermine synthase 97.15
COG2520341 Predicted methyltransferase [General function pred 97.14
KOG3178|consensus342 97.14
KOG3115|consensus249 97.11
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.1
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.09
PRK13699227 putative methylase; Provisional 97.09
KOG1596|consensus317 97.07
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.06
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.03
PF13679141 Methyltransf_32: Methyltransferase domain 97.02
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.0
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.99
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 96.97
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.95
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.94
KOG3987|consensus288 96.92
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.89
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.85
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 96.84
COG0286489 HsdM Type I restriction-modification system methyl 96.83
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.82
KOG2198|consensus375 96.81
KOG2671|consensus421 96.8
KOG1499|consensus 346 96.79
KOG4589|consensus232 96.72
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 96.68
KOG1975|consensus 389 96.68
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 96.68
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.67
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 96.63
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.56
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 96.55
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.54
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.4
PHA01634156 hypothetical protein 96.35
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.32
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.26
KOG1500|consensus 517 96.24
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 96.2
COG0421282 SpeE Spermidine synthase [Amino acid transport and 96.16
KOG1562|consensus337 96.16
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.15
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.15
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 96.09
KOG0024|consensus354 96.03
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 96.0
COG3129292 Predicted SAM-dependent methyltransferase [General 96.0
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 95.99
COG4798238 Predicted methyltransferase [General function pred 95.92
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 95.92
KOG4058|consensus199 95.86
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 95.84
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.8
KOG1253|consensus525 95.7
PRK10742250 putative methyltransferase; Provisional 95.64
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 95.59
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 95.55
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2e-31  Score=234.65  Aligned_cols=196  Identities=36%  Similarity=0.613  Sum_probs=183.4

Q ss_pred             HHHHHHHHHcCCCCCHHHHHHHHhCCCCCccCC----CCCCCcccccCCCcccchhHHHHHHHHHHhhcCCCCCEEEEEc
Q psy7829          66 TDLVNHLRDIGKIRTERVAQAFYKVDRGNFANE----EPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKVLDLG  141 (511)
Q Consensus        66 ~~l~~~l~~~~~~~~~~~~~a~~~~~r~~~~~~----~~y~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~vLDiG  141 (511)
                      ..+.++|+..++ .++.+.+||..+||+.|+|.    .+|.|.++++++++++++|+++++++++|.  ++++.+|||||
T Consensus         4 ~~l~~~lr~~~i-~~~~v~~A~~~vPRe~FVp~~~~~~AY~d~~lpi~~gqtis~P~~vA~m~~~L~--~~~g~~VLEIG   80 (209)
T COG2518           4 RMLVERLRTEGI-TDERVLKAFLAVPRELFVPAAYKHLAYEDRALPIGCGQTISAPHMVARMLQLLE--LKPGDRVLEIG   80 (209)
T ss_pred             HHHHHHHHHcCC-CcHHHHHHHHhCCHHhccCchhhcccccCCcccCCCCceecCcHHHHHHHHHhC--CCCCCeEEEEC
Confidence            568899999996 56999999999999999996    499999999999999999999999999998  99999999999


Q ss_pred             CCccHHHHHHHHHhCCCceEEEEeCCHHHHHHHHHHHhccCCCcCCCCCeEEEEccCCCCCCCCCCccEEEecCCCCchH
Q psy7829         142 SGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVP  221 (511)
Q Consensus       142 ~G~G~~~~~la~~~~~~~~v~~iD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD~I~~~~~~~~~~  221 (511)
                      |||||.++.+|+..+   +|+++|+.+...+.|++|++..     +..||.++++|...++++.++||.|++......+|
T Consensus        81 tGsGY~aAvla~l~~---~V~siEr~~~L~~~A~~~L~~l-----g~~nV~v~~gDG~~G~~~~aPyD~I~Vtaaa~~vP  152 (209)
T COG2518          81 TGSGYQAAVLARLVG---RVVSIERIEELAEQARRNLETL-----GYENVTVRHGDGSKGWPEEAPYDRIIVTAAAPEVP  152 (209)
T ss_pred             CCchHHHHHHHHHhC---eEEEEEEcHHHHHHHHHHHHHc-----CCCceEEEECCcccCCCCCCCcCEEEEeeccCCCC
Confidence            999999999999974   6999999999999999999995     57789999999999998889999999999999999


Q ss_pred             HHHHhhcccCcEEEEEEccCCCcceEEEEEEecCCeEEEEeecceEEEeccc
Q psy7829         222 SRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMR  273 (511)
Q Consensus       222 ~~~~~~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  273 (511)
                      +.+.++|||||++++|++ ....+.+.++.+..++.+..+..+.+.|+|+.+
T Consensus       153 ~~Ll~QL~~gGrlv~PvG-~~~~q~l~~~~k~~~~~~~~~~l~~v~~vPl~~  203 (209)
T COG2518         153 EALLDQLKPGGRLVIPVG-SGPAQRLLRITKDGDGNFERRDLFNVRFVPLVG  203 (209)
T ss_pred             HHHHHhcccCCEEEEEEc-cCCcEEEEEEEEcCCCcEEEeeeccceeeecCC
Confidence            999999999999999999 556788899999888899999999999999987



>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG2198|consensus Back     alignment and domain information
>KOG2671|consensus Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1562|consensus Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG4058|consensus Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 1e-44
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 5e-09
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 1e-08
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 3e-38
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 5e-21
1jg4_A235 Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- 9e-17
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 1e-15
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 1e-14
1dl5_A317 Protein-L-Isoaspartate O-Methyltransferase Length = 2e-12
1dl5_A 317 Protein-L-Isoaspartate O-Methyltransferase Length = 9e-04
1vbf_A231 Crystal Structure Of Protein L-Isoaspartate O-Methy 1e-09
3dh0_A219 Crystal Structure Of A Sam Dependent Methyltransfer 2e-04
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 177 bits (449), Expect = 1e-44, Method: Compositional matrix adjust. Identities = 92/220 (41%), Positives = 133/220 (60%) Query: 58 FKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAP 117 +K+ G ++L+++LR G I+T++V + DR ++A PY D S+G+ ++AP Sbjct: 2 WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAP 61 Query: 118 NQIADAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRN 177 + A A E L L +GAK LD+GSGSG T FA MVG TGKVIG++HI EL++ S+ N Sbjct: 62 HMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNN 121 Query: 178 ISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAP 237 + K + LL SGRV++V D R GY EAPYD I+ G VP +++QLK GGR++ P Sbjct: 122 VRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP 181 Query: 238 IGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQ 277 +GP Q L Q D+ D +++ L V Y + K Q Sbjct: 182 VGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQ 221
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|1JG4|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- Methyltransferase With S-Adenosylmethionine Length = 235 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure
>pdb|1DL5|A Chain A, Protein-L-Isoaspartate O-Methyltransferase Length = 317 Back     alignment and structure
>pdb|1DL5|A Chain A, Protein-L-Isoaspartate O-Methyltransferase Length = 317 Back     alignment and structure
>pdb|1VBF|A Chain A, Crystal Structure Of Protein L-Isoaspartate O-Methyltransferase Homologue From Sulfolobus Tokodaii Length = 231 Back     alignment and structure
>pdb|3DH0|A Chain A, Crystal Structure Of A Sam Dependent Methyltransferase From Aquifex Aeolicus Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query511
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 3e-69
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 7e-16
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 1e-15
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 1e-67
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 3e-13
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 5e-13
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-61
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 1e-12
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-12
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 2e-55
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 3e-11
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 8e-11
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 2e-55
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 1e-13
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 2e-13
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 3e-48
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 2e-10
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 6e-10
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 2e-47
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 6e-09
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 1e-08
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 3e-46
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 1e-12
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 2e-12
3dh0_A219 SAM dependent methyltransferase; cystal structure, 3e-14
3dh0_A219 SAM dependent methyltransferase; cystal structure, 8e-09
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 8e-09
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 4e-14
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 4e-07
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 4e-07
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 2e-13
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-07
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 7e-07
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 7e-13
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 5e-05
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 1e-04
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 7e-13
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 7e-07
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 7e-07
2b25_A336 Hypothetical protein; structural genomics, methyl 2e-12
2b25_A336 Hypothetical protein; structural genomics, methyl 2e-06
2b25_A 336 Hypothetical protein; structural genomics, methyl 2e-06
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 2e-12
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 3e-07
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 5e-07
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 5e-12
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 3e-11
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 6e-06
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 8e-06
3ocj_A305 Putative exported protein; structural genomics, PS 4e-11
3ocj_A305 Putative exported protein; structural genomics, PS 9e-06
3ocj_A 305 Putative exported protein; structural genomics, PS 9e-06
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 4e-11
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 9e-05
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 9e-05
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 4e-11
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 6e-11
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 6e-11
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 8e-04
3f4k_A257 Putative methyltransferase; structural genomics, P 1e-10
3f4k_A257 Putative methyltransferase; structural genomics, P 3e-06
3f4k_A 257 Putative methyltransferase; structural genomics, P 5e-04
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 3e-10
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 1e-07
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 1e-07
3gu3_A284 Methyltransferase; alpha-beta protein, structural 3e-10
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 1e-06
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 1e-06
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-10
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 8e-07
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-05
1yb2_A275 Hypothetical protein TA0852; structural genomics, 4e-10
1yb2_A275 Hypothetical protein TA0852; structural genomics, 1e-06
1yb2_A275 Hypothetical protein TA0852; structural genomics, 6e-06
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 5e-10
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 4e-04
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 4e-04
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 7e-10
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-06
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 6e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 1e-09
3m33_A226 Uncharacterized protein; structural genomics, PSI- 9e-04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 4e-09
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 8e-04
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 5e-09
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 7e-05
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 7e-05
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 6e-09
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 1e-06
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 8e-09
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 1e-08
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 2e-08
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-08
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 5e-08
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 4e-04
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 4e-04
3i9f_A170 Putative type 11 methyltransferase; structural gen 2e-07
3i9f_A170 Putative type 11 methyltransferase; structural gen 5e-05
3i9f_A170 Putative type 11 methyltransferase; structural gen 5e-05
3ll7_A410 Putative methyltransferase; methytransferase, stru 2e-07
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 2e-07
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 3e-05
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 4e-04
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 2e-07
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 4e-07
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 5e-07
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3dtn_A234 Putative methyltransferase MM_2633; structural gen 1e-06
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 2e-06
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 2e-06
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 2e-06
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-06
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 4e-06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 5e-06
2kw5_A202 SLR1183 protein; structural genomics, northeast st 5e-06
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 7e-06
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 8e-06
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 9e-06
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 1e-05
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 5e-04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 7e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 1e-05
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 1e-05
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 3e-05
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 8e-05
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 1e-04
3lpm_A259 Putative methyltransferase; structural genomics, p 3e-05
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 4e-05
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 4e-05
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 4e-05
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 5e-05
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 5e-05
1xxl_A239 YCGJ protein; structural genomics, protein structu 6e-05
1xxl_A239 YCGJ protein; structural genomics, protein structu 2e-04
1xxl_A 239 YCGJ protein; structural genomics, protein structu 2e-04
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 8e-05
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 8e-05
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 1e-04
3ege_A261 Putative methyltransferase from antibiotic biosyn 1e-04
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 1e-04
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 1e-04
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 1e-04
3hnr_A220 Probable methyltransferase BT9727_4108; structural 1e-04
1vlm_A219 SAM-dependent methyltransferase; possible histamin 1e-04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 1e-04
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 2e-04
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 3e-04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 2e-04
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 2e-04
3duw_A223 OMT, O-methyltransferase, putative; alternating of 2e-04
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 3e-04
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 3e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 3e-04
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 3e-04
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 3e-04
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 3e-04
1vl5_A260 Unknown conserved protein BH2331; putative methylt 3e-04
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 4e-04
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 3e-04
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 4e-04
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 4e-04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 4e-04
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 4e-04
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 5e-04
2fpo_A202 Methylase YHHF; structural genomics, putative meth 5e-04
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 5e-04
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 9e-04
2avd_A229 Catechol-O-methyltransferase; structural genomics, 5e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 6e-04
3lcc_A235 Putative methyl chloride transferase; halide methy 6e-04
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 6e-04
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 7e-04
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 8e-04
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 8e-04
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 8e-04
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 8e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  220 bits (563), Expect = 3e-69
 Identities = 88/202 (43%), Positives = 125/202 (61%)

Query: 67  DLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAEN 126
           +L+++LR  G I+T++V +     DR ++A   PY D   S+G+   ++AP+  A A E 
Sbjct: 11  ELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALEL 70

Query: 127 LKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLL 186
           L   L +GAK LD+GSGSG  T  FA MVG TGKVIG++HI EL++ S+ N+ K +  LL
Sbjct: 71  LFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLL 130

Query: 187 DSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQK 246
            SGRV++V  D R GY  EAPYD I+ G     VP  +++QLK GGR++ P+GP    Q 
Sbjct: 131 SSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQM 190

Query: 247 LTQIDRFHDNTLQKTDLFEVAY 268
           L Q D+  D +++   L  V Y
Sbjct: 191 LEQYDKLQDGSIKMKPLMGVIY 212


>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B* 3pla_E* Length = 232 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4er3_A* 3sr4_A* Length = 438 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Length = 227 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Length = 233 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Length = 354 Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Length = 202 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Length = 235 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Length = 348 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Length = 480 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query511
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.95
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.94
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.94
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.91
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.9
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.89
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.85
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.81
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.67
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.66
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.61
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.59
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.59
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.59
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.56
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.55
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.55
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.55
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.53
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.53
2b25_A336 Hypothetical protein; structural genomics, methyl 99.53
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.52
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.52
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.52
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.51
3f4k_A257 Putative methyltransferase; structural genomics, P 99.51
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.51
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.51
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.51
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.51
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.51
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.51
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.51
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.51
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.5
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.5
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.5
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.5
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.5
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.5
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.5
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.49
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.49
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.49
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.48
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.48
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.48
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.48
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.48
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.47
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.47
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.47
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.47
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.47
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.46
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.46
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.46
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.46
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.45
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.45
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.45
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.45
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.45
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.45
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.44
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.44
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.44
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.44
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.44
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.44
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.44
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.44
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.44
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.44
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.43
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.43
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.43
3ocj_A305 Putative exported protein; structural genomics, PS 99.43
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.43
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.43
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.43
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.43
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.42
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.42
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.42
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.42
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.42
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.42
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.42
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.42
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.42
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.42
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.42
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.42
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.42
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.42
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.41
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.41
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.41
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.41
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.41
3lpm_A259 Putative methyltransferase; structural genomics, p 99.41
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.41
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.41
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.41
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.41
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.4
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.4
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.4
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.4
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.4
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.4
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.4
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.4
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.4
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.4
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.4
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.39
3lcc_A235 Putative methyl chloride transferase; halide methy 99.39
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.39
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.39
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.39
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.39
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.39
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.39
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.38
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.38
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.38
2h00_A254 Methyltransferase 10 domain containing protein; st 99.38
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.38
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.38
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.37
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.37
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.37
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.37
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.37
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.37
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.36
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.36
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.35
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.35
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.35
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.35
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.35
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.35
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.34
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.34
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.34
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.34
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.33
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.33
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.33
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.33
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.32
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.32
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.31
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.31
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.3
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.29
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.29
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.29
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.29
3k6r_A278 Putative transferase PH0793; structural genomics, 99.29
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.29
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.29
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.29
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.29
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.29
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.29
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.28
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.28
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.28
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.28
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.28
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.28
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.28
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.28
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.27
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.27
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.27
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.27
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.27
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.26
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.26
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.25
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.25
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.25
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.25
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.25
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.25
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.24
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.24
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.24
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.24
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.24
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.22
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.22
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.22
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.21
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.21
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.21
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.21
2o07_A304 Spermidine synthase; structural genomics, structur 99.21
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.21
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.2
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.2
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.2
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.19
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.18
2pt6_A321 Spermidine synthase; transferase, structural genom 99.18
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.18
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.18
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.17
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.17
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.17
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.16
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.16
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.15
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.15
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.15
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.13
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.13
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.12
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.12
3cc8_A230 Putative methyltransferase; structural genomics, j 99.12
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.12
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.12
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.11
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.11
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.11
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.11
2i7c_A283 Spermidine synthase; transferase, structural genom 99.11
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.11
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.11
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.1
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.1
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.09
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.09
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.09
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.09
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.08
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.08
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.07
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.07
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.07
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.06
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.05
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.05
3cvo_A202 Methyltransferase-like protein of unknown functio; 99.05
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.04
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.04
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.04
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.03
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.03
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.02
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.01
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.01
2b25_A336 Hypothetical protein; structural genomics, methyl 99.01
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 99.0
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.0
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.0
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.0
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.99
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.99
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.98
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.97
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.97
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.96
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.96
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.96
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.96
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.95
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.95
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.95
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.94
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.94
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.94
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.93
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.93
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.93
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.92
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.92
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.91
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.91
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.91
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.91
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.91
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.9
3f4k_A257 Putative methyltransferase; structural genomics, P 98.9
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.9
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.9
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.9
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.9
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.89
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.89
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.89
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.88
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.88
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.88
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.88
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.88
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.88
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.88
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.88
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.87
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.87
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.86
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.86
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.86
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.85
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.85
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.85
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.85
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.84
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.84
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.84
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.84
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.84
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.83
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.83
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.83
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.83
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.82
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.82
3lpm_A259 Putative methyltransferase; structural genomics, p 98.81
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.81
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.81
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.81
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.8
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.8
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.8
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.8
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.8
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.79
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.79
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.79
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.78
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.78
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.77
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.77
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.77
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.75
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.75
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 98.75
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.75
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.75
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.74
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.74
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.74
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.74
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.73
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 98.73
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.73
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.73
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.72
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.72
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.72
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.71
3khk_A544 Type I restriction-modification system methylation 98.7
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.7
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.7
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.7
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.69
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.69
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.69
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.68
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.68
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.68
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.68
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.68
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.68
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.68
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.67
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.67
3lkd_A542 Type I restriction-modification system methyltrans 98.67
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.67
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.67
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.67
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.66
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.66
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.66
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.65
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.65
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.65
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.65
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.65
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.64
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.64
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.64
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.64
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.64
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.63
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.63
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 98.63
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.62
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.62
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.62
3k6r_A278 Putative transferase PH0793; structural genomics, 98.61
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.61
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.6
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.6
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.59
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.59
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.59
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.59
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.59
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.59
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.58
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.58
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 98.58
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.57
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.57
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 98.57
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.56
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.56
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.56
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.55
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.55
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.54
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.54
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.54
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.53
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.52
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.52
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.51
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.51
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.51
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.5
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.5
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.49
2h00_A254 Methyltransferase 10 domain containing protein; st 98.49
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.49
2o07_A304 Spermidine synthase; structural genomics, structur 98.48
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.48
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.48
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.48
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.47
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.47
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.46
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.46
2pt6_A321 Spermidine synthase; transferase, structural genom 98.45
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.45
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 98.45
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.44
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.44
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.44
3ocj_A305 Putative exported protein; structural genomics, PS 98.44
2i7c_A283 Spermidine synthase; transferase, structural genom 98.44
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 98.44
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.43
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.43
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.43
3lcc_A235 Putative methyl chloride transferase; halide methy 98.43
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.43
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.42
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.41
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.4
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.4
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.4
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.4
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.4
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.4
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.39
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.39
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.39
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 98.38
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.38
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.37
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.37
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.36
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.35
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.35
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.35
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.34
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.33
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.33
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.32
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.32
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.32
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.31
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.31
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.31
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.3
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.3
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.3
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.3
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.28
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.28
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.28
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.28
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.27
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.26
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.26
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.24
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.24
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.23
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.23
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.23
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.23
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
Probab=99.95  E-value=2.5e-27  Score=220.69  Aligned_cols=218  Identities=36%  Similarity=0.641  Sum_probs=190.2

Q ss_pred             CCCcccCCCccHHHHHHHHHHcCCCCCHHHHHHHHhCCCCCccCCCCCCCcccccCCCcccchhHHHHHHHHHHhhcCCC
Q psy7829          54 NLNHFKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVD  133 (511)
Q Consensus        54 ~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~a~~~~~r~~~~~~~~y~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~  133 (511)
                      ..|.|++++.++..++++|...+++.++.+.++|..++|+.|.+..+|.+.+++++++.++++|.+.+.+++.+...+++
T Consensus         5 ~~m~~~~~~~~~~~l~~~l~~~~~~~~~~~~~a~~~~~r~~f~~~~~y~d~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~   84 (227)
T 1r18_A            5 IHMAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMHAFALEYLRDHLKP   84 (227)
T ss_dssp             CCCCCCCBCSSHHHHHHHHHHTTSCCCHHHHHHHHTSCGGGTCSSCTTBSSCEEEETTEEECCHHHHHHHHHHTTTTCCT
T ss_pred             ceeeeecCccHHHHHHHHHHhcCCCCCHHHHHHHHhCCHHHcCCcccccCCCcccCCCCccCChHHHHHHHHHHHhhCCC
Confidence            46788999999999999999999878999999999999999999999999999999999999999999999988655788


Q ss_pred             CCEEEEEcCCccHHHHHHHHHhCC-----CceEEEEeCCHHHHHHHHHHHhccCCCcCCCCCeEEEEccCCCCCCCCCCc
Q psy7829         134 GAKVLDLGSGSGYQTCVFAHMVGP-----TGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPY  208 (511)
Q Consensus       134 ~~~vLDiG~G~G~~~~~la~~~~~-----~~~v~~iD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~f  208 (511)
                      +.+|||+|||+|+++..+++..+.     .++|+++|+++.+++.|++++...+...+..++++++.+|+.+.+...++|
T Consensus        85 ~~~VLdiG~G~G~~~~~la~~~~~~~~~~~~~v~~vD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~f  164 (227)
T 1r18_A           85 GARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPY  164 (227)
T ss_dssp             TCEEEEESCTTSHHHHHHHHHHHHSCCCTTCEEEEEESCHHHHHHHHHHHHHHHHHHHHHTSEEEEESCGGGCCGGGCSE
T ss_pred             CCEEEEECCCccHHHHHHHHhcccccCCccCEEEEEEcCHHHHHHHHHHHHhcCccccCCCceEEEECCcccCCCcCCCc
Confidence            999999999999999999997642     368999999999999999998763200000357999999998755444789


Q ss_pred             cEEEecCCCCchHHHHHhhcccCcEEEEEEccCCCcceEEEEEEecCCeEEEEeecceEEEec
Q psy7829         209 DVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAI  271 (511)
Q Consensus       209 D~I~~~~~~~~~~~~~~~~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  271 (511)
                      |+|+++.+++++++++.++|||||++++++++....+.+..+.+..++.+..+.++.+.|+|+
T Consensus       165 D~I~~~~~~~~~~~~~~~~LkpgG~lvi~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~p~  227 (227)
T 1r18_A          165 NAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL  227 (227)
T ss_dssp             EEEEECSCBSSCCHHHHHTEEEEEEEEEEESCSSSCEEEEEEEECTTSCEEEEEEEEECCCCC
T ss_pred             cEEEECCchHHHHHHHHHHhcCCCEEEEEEecCCCceEEEEEEEcCCCcEEEEEeccEEEeeC
Confidence            999999999999999999999999999999987777888888887788899999999999886



>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 511
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 9e-45
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 9e-07
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 3e-06
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 5e-41
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 6e-05
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 7e-05
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 4e-29
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 3e-25
d1dl5a1213 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methylt 1e-19
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 9e-14
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 8e-08
d1i9ga_ 264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 2e-06
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 3e-12
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 6e-08
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 1e-07
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 4e-10
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 1e-09
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 1e-08
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 2e-07
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 2e-09
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 4e-04
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 5e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 5e-08
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 6e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 0.004
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 7e-07
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 1e-06
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 0.004
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 2e-05
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 3e-05
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 6e-05
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-05
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-04
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-04
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 9e-05
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 1e-04
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 2e-04
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 5e-04
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 0.002
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 3e-04
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 0.002
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.003
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.004
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.004
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  155 bits (391), Expect = 9e-45
 Identities = 89/207 (42%), Positives = 127/207 (61%)

Query: 62  GTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIA 121
           G   ++L+++LR  G I+T++V +     DR ++A   PY D   S+G+   ++AP+  A
Sbjct: 5   GASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHA 64

Query: 122 DAAENLKLHLVDGAKVLDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKG 181
            A E L   L +GAK LD+GSGSG  T  FA MVG TGKVIG++HI EL++ S+ N+ K 
Sbjct: 65  YALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKD 124

Query: 182 NKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCVSEVPSRVLNQLKKGGRILAPIGPM 241
           +  LL SGRV++V  D R GY  EAPYD I+ G     VP  +++QLK GGR++ P+GP 
Sbjct: 125 DPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPA 184

Query: 242 DDFQKLTQIDRFHDNTLQKTDLFEVAY 268
              Q L Q D+  D +++   L  V Y
Sbjct: 185 GGNQMLEQYDKLQDGSIKMKPLMGVIY 211


>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query511
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 100.0
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 100.0
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.97
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.96
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.94
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.71
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.7
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.69
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.69
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.68
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.68
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.66
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.64
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.64
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.63
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.63
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.58
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.57
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.56
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.56
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.55
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.54
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.54
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.54
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.54
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.52
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.52
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.52
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.52
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.52
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.5
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.49
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.49
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.48
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.47
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.47
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.46
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.45
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.45
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.45
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.45
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.44
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.44
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.44
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.44
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.43
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.42
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.42
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.4
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.38
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.36
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.35
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.35
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.34
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.3
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.29
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.26
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.25
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.25
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.25
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.24
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.23
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.23
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.22
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.22
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.21
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.19
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.19
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.19
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.19
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.19
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 99.18
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.18
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.16
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.16
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.14
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.13
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 99.13
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.13
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.12
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.12
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.11
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 99.11
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.1
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.08
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.07
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.06
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.05
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.99
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.92
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.9
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.89
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.86
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.85
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.84
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.84
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.82
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.81
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.8
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.8
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.78
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.77
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.77
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.77
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.76
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.73
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.73
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.73
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.73
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.73
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.72
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.72
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.7
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.69
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.67
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.66
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.66
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.65
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.63
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.63
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.63
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.62
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.62
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.59
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.57
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.55
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.55
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.54
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.54
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.52
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.5
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.5
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.5
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.49
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.49
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.48
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.48
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.48
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.46
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.45
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.45
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.45
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.44
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.43
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.42
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.42
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.38
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.37
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.35
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.34
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.33
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.31
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.3
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.28
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.28
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.26
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.23
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.22
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.21
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.21
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.19
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.19
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 98.16
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.14
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.12
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.11
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.1
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 98.09
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 98.03
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.0
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.0
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.98
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.88
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.66
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.62
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.53
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.45
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.43
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 97.4
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.3
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 97.3
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.27
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.27
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.27
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.22
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.21
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.16
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.15
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.11
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.1
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.08
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.08
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.05
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.03
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.97
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.93
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.9
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.85
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.85
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 96.76
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.74
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.69
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 96.68
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 96.66
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.65
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.55
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.52
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 96.48
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.46
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.44
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 96.38
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.38
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.25
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.19
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.19
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.13
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 96.13
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.06
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.05
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.05
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.98
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 95.96
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.87
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.77
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.41
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 95.41
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.38
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.22
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.18
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.08
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 95.01
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 94.83
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.79
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 94.67
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 94.39
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.39
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.36
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 94.28
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 94.25
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 94.24
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 94.24
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.18
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 94.11
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.07
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.02
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.01
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 93.77
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 93.6
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.38
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.34
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 93.24
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.09
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.06
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.04
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 93.0
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.1
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 91.91
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 91.79
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 91.62
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 91.42
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 91.04
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 91.01
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 90.68
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 90.48
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.22
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.96
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 89.89
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 89.47
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.17
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 88.48
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.33
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 87.12
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 86.47
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 85.96
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 85.42
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 85.15
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 84.92
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 84.17
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 80.94
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.1e-35  Score=271.74  Aligned_cols=223  Identities=41%  Similarity=0.693  Sum_probs=203.6

Q ss_pred             ccCCCccHHHHHHHHHHcCCCCCHHHHHHHHhCCCCCccCCCCCCCcccccCCCcccchhHHHHHHHHHHhhcCCCCCEE
Q psy7829          58 FKNEGTCQTDLVNHLRDIGKIRTERVAQAFYKVDRGNFANEEPYQDVSASLGYAGVMNAPNQIADAAENLKLHLVDGAKV  137 (511)
Q Consensus        58 ~~~~~~~~~~l~~~l~~~~~~~~~~~~~a~~~~~r~~~~~~~~y~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~~~v  137 (511)
                      |.+++.++..|+++|+..|.+.++.+.+||+.+||+.|+|..+|.|.++++++++++++|.+.+++++.|...+++|.+|
T Consensus         1 ~~s~~~~~~~mv~~l~~~g~i~~~~v~~a~~~vpRe~Fvp~~aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~V   80 (224)
T d1i1na_           1 WKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKA   80 (224)
T ss_dssp             CCCCCSSHHHHHHHHHHTTSCCSHHHHHHHHTSCGGGTCSSCTTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEE
T ss_pred             CCCCcccHHHHHHHHHHcCCCCCHHHHHHHHhCCHHHcCCcccCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeE
Confidence            67788999999999999998899999999999999999999999999999999999999999999999996568999999


Q ss_pred             EEEcCCccHHHHHHHHHhCCCceEEEEeCCHHHHHHHHHHHhccCCCcCCCCCeEEEEccCCCCCCCCCCccEEEecCCC
Q psy7829         138 LDLGSGSGYQTCVFAHMVGPTGKVIGVEHIPELIEASLRNISKGNKDLLDSGRVRIVEADAREGYLPEAPYDVIYYGGCV  217 (511)
Q Consensus       138 LDiG~G~G~~~~~la~~~~~~~~v~~iD~~~~~~~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD~I~~~~~~  217 (511)
                      ||||||+|+.+..+|+..++.++|+++|+++++++.|++++++.+...+...++.++.+|+...++..++||+|+++..+
T Consensus        81 LdiG~GsGy~ta~la~l~~~~g~V~~ie~~~~l~~~a~~~l~~~~~~~~~~~~~~~~~gD~~~~~~~~~~fD~I~~~~~~  160 (224)
T d1i1na_          81 LDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAA  160 (224)
T ss_dssp             EEETCTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHHCTHHHHTSSEEEEESCGGGCCGGGCCEEEEEECSBB
T ss_pred             EEecCCCCHHHHHHHHHhCCCceEEEEcCCHHHHHHHHHhccccCcccccccceEEEEeecccccchhhhhhhhhhhcch
Confidence            99999999999999999988999999999999999999999875422223568999999998877777899999999999


Q ss_pred             CchHHHHHhhcccCcEEEEEEccCCCcceEEEEEEecCCeEEEEeecceEEEecccccccccc
Q psy7829         218 SEVPSRVLNQLKKGGRILAPIGPMDDFQKLTQIDRFHDNTLQKTDLFEVAYDAIMRKALQMDI  280 (511)
Q Consensus       218 ~~~~~~~~~~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  280 (511)
                      ++++..+.++|||||+++++++.....+.+..+.+..++.+..+.++++.|+||.+...+|.+
T Consensus       161 ~~ip~~l~~~LkpGG~LV~pv~~~~~~q~l~~~~k~~~~~~~~~~l~~v~fvPl~~~~~~~~~  223 (224)
T d1i1na_         161 PVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSR  223 (224)
T ss_dssp             SSCCHHHHHTEEEEEEEEEEESCTTSCEEEEEEEECTTSCEEEEEEEEECCCBCCCHHHHCCC
T ss_pred             hhcCHHHHhhcCCCcEEEEEEccCCCcEEEEEEEEeCCCeEEEEEEeeEEEECCCCchhhccC
Confidence            999999999999999999999988778888899998888899999999999999988777753



>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure