Psyllid ID: psy7834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSFMGRSSKM
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHcccccccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccEEEEccccccccHHHHHccccccEEEEEEcccccEEEEEEEcccccEEEEEEEcccccEEEEEEccccccccccHHHHHHcccccccccccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEEEEEEEEcccEEEEEEccccccccc
cccccHHHccccHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHHHccHHcccccEEEEEccccccccccccccEEEEccccHHHHHHHHHcccccHHHHHHHHHccHHHcccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHcHHHcccccEEEEEccHHHccHHHccEEEEEEccEEccccHHHHHHEEEEEEEEEEcccccEEEEEEEEccccEEEEEEEEEcccEEEEEEcccEEEEEcccccHHcccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcHHHHHHcccEcHHHHHHHHHHHHHHHHHccHHHHEEEEEEccccccccc
mlavdrghyttwrpyancitnigygahmqapfqdntkfskFQQAMVLDDLSEELtegkkvldigsgngYFTALLAWCVGktgkvigiehIPQLVQRAThnvisgnpefvkdgrikfvlgdgrkgyldeapydiihvggsiedipegvrfghiaspkveSVMRSIDRrrfierpimnnpywdipqslgfgsvmsspkVHAQALEILKDYlkpgakvldigsgsgYLTACMAhmvgptgkvyAVEHIEDLVAQANKSMhtyypnlmeggrvqfvdgdgreghaaegpydviyvggavhhypfklmdqlkpggvmWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWrlpalasveeqkywyhpngfyddlDVHAQALEILKDYlkpgakvldigsgsgYLTACMAhmvgptgkvyAVEHIEDLVAQANKSMhtyypnlmeggRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSfmgrsskm
mlavdrghyttwrpyANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNvisgnpefvkdgrIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFghiaspkvesvmrsIDRRrfierpimnnpYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIilssfmgrsskm
MLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSFMGRSSKM
****DRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEML*********LAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSF*******
MLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSFMGR****
MLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSFMGRSSKM
*LAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVDRGHYTTWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKKVLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLGDGRKGYLDEAPYDIIHVGGSIEDIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNNRRTESNLAVVKAHKKDHGEWEEEFMGRLWRLPALASVEEQKYWYHPNGFYDDLDVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFTEMAEKVMQLRVHMMSFTLEEQSIIILSSFMGRSSKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query492 2.2.26 [Sep-21-2011]
P15246227 Protein-L-isoaspartate(D- yes N/A 0.341 0.740 0.5 2e-39
Q4R5H0227 Protein-L-isoaspartate(D- N/A N/A 0.341 0.740 0.5 1e-38
P80895227 Protein-L-isoaspartate(D- yes N/A 0.341 0.740 0.494 2e-38
P22061227 Protein-L-isoaspartate(D- no N/A 0.341 0.740 0.494 3e-38
Q5RA89227 Protein-L-isoaspartate(D- no N/A 0.341 0.740 0.494 4e-38
Q5F3N1228 Protein-L-isoaspartate(D- no N/A 0.363 0.785 0.459 5e-38
Q92047228 Protein-L-isoaspartate(D- yes N/A 0.363 0.785 0.443 2e-37
P23506227 Protein-L-isoaspartate(D- no N/A 0.341 0.740 0.482 4e-37
P22062227 Protein-L-isoaspartate(D- yes N/A 0.341 0.740 0.482 1e-36
Q43209230 Protein-L-isoaspartate O- N/A N/A 0.355 0.760 0.432 5e-35
>sp|P15246|PIMT_BOVIN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Bos taurus GN=PCMT1 PE=1 SV=2 Back     alignment and function desciption
 Score =  163 bits (413), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 112/172 (65%), Gaps = 4/172 (2%)

Query: 148 RFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKD 207
           + G I + KV  VM + DR  + +     NPY D PQS+GF + +S+P +HA ALE+L D
Sbjct: 19  KNGIIKTDKVFEVMLATDRSHYAK----CNPYMDSPQSIGFQATISAPHMHAYALELLFD 74

Query: 208 YLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGG 267
            L  GAK LD+GSGSG LTAC A MVGP+GKV  ++HI++LV  +  ++    P L+  G
Sbjct: 75  QLNEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSINNVRKDDPMLLSSG 134

Query: 268 RVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNA 319
           RVQ V GDGR G+AAE PYD I+VG A    P  L+DQLKPGG +   +G A
Sbjct: 135 RVQLVVGDGRMGYAAEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPA 186




Catalyzes the methyl esterification of L-isoaspartyl and D-aspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. Acts on microtubule-associated protein 2, calreticulin, clathrin light chains a and b, Ubiquitin carboxyl-terminal hydrolase isozyme L1, phosphatidylethanolamine-binding protein 1, stathmin, beta-synuclein and alpha-synuclein.
Bos taurus (taxid: 9913)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 7EC: 7
>sp|Q4R5H0|PIMT_MACFA Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Macaca fascicularis GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|P80895|PIMT_PIG Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Sus scrofa GN=PCMT1 PE=1 SV=3 Back     alignment and function description
>sp|P22061|PIMT_HUMAN Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens GN=PCMT1 PE=1 SV=4 Back     alignment and function description
>sp|Q5RA89|PIMT_PONAB Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Pongo abelii GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q5F3N1|PIMT_CHICK Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Gallus gallus GN=PCMT1 PE=2 SV=3 Back     alignment and function description
>sp|Q92047|PIMT_DANRE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Danio rerio GN=pcmt PE=2 SV=3 Back     alignment and function description
>sp|P23506|PIMT_MOUSE Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Mus musculus GN=Pcmt1 PE=1 SV=3 Back     alignment and function description
>sp|P22062|PIMT_RAT Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Rattus norvegicus GN=Pcmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q43209|PIMT_WHEAT Protein-L-isoaspartate O-methyltransferase OS=Triticum aestivum GN=PCM PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
322791057436 hypothetical protein SINV_06781 [Solenop 0.644 0.727 0.365 1e-57
195997337230 hypothetical protein TRIADDRAFT_49594 [T 0.337 0.721 0.470 4e-39
156355412224 predicted protein [Nematostella vectensi 0.337 0.741 0.488 6e-39
156392767200 predicted protein [Nematostella vectensi 0.357 0.88 0.458 1e-38
241566262277 protein-L-isoaspartate(D-aspartate) O-me 0.337 0.599 0.482 6e-38
426235212315 PREDICTED: protein-L-isoaspartate(D-aspa 0.337 0.526 0.505 1e-37
390345040296 PREDICTED: protein-L-isoaspartate(D-aspa 0.418 0.695 0.419 2e-37
124106313227 RecName: Full=Protein-L-isoaspartate(D-a 0.341 0.740 0.5 2e-37
440895106285 Protein-L-isoaspartate(D-aspartate) O-me 0.341 0.589 0.5 2e-37
260830152230 hypothetical protein BRAFLDRAFT_284774 [ 0.337 0.721 0.458 2e-37
>gi|322791057|gb|EFZ15657.1| hypothetical protein SINV_06781 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  230 bits (587), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 142/389 (36%), Positives = 201/389 (51%), Gaps = 72/389 (18%)

Query: 1   MLAVDRGHYT-TWRPYANCITNIGYGAHMQAPFQDNTKFSKFQQAMVLDDLSEELTEGKK 59
           MLAVDR  Y     PY +    IGY   + AP            A  L  LS++L +G K
Sbjct: 32  MLAVDRAKYCHEPDPYLDRPRRIGYNVTISAPHM---------HAYALSILSDQLFDGAK 82

Query: 60  VLDIGSGNGYFTALLAWCVGKTGKVIGIEHIPQLVQRATHNVISGNPEFVKDGRIKFVLG 119
            LD+GSG+GY +A +A+ VG  G+V GIEHIP+L++ +T NV   NP F+K+ RIKFV+G
Sbjct: 83  ALDVGSGSGYLSACMAFMVGSHGRVTGIEHIPELIEVSTRNVREDNPHFLKEDRIKFVVG 142

Query: 120 DGRKGYLDEAPY----------------------------------------DIIHVGGS 139
           DGR G+  + PY                                        D++ V  S
Sbjct: 143 DGRLGHAADGPYNAIHVGAAAETLPQTLIDQLAPGGRLICPVVAIEGFQRFQDLLQVDKS 202

Query: 140 IE-----------------DIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDI 182
            +                 D    +R   I S KV  VM S+DR ++ +    ++ Y D 
Sbjct: 203 TDGAITKKKLMQVSYVPLTDPTTQLRSRVIKSDKVFEVMNSVDRGKYTDP---SHAYIDA 259

Query: 183 PQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAV 242
           PQ +G+G  +S+P +HA ALE+L++ L  G + LD+GSGSGYLTACMA M+ P G    +
Sbjct: 260 PQGIGYGVTISAPHMHAYALELLEEKLINGTRALDVGSGSGYLTACMALMMRPQGLAIGI 319

Query: 243 EHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKL 302
           +HI +L A A +++   +P L+  GRV+ V GDGR G+    PYD I+VG A    P  L
Sbjct: 320 DHIPELRAMAEENIRHDHPELLSDGRVELVVGDGRLGYPNRAPYDAIHVGAAAKEMPQSL 379

Query: 303 MDQLKPGGVMWFTIG--NAEEMLKNNRRT 329
           +DQL PGG +   +G  N+++ L    +T
Sbjct: 380 IDQLAPGGRLIVPMGPENSDQTLIQIDKT 408




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195997337|ref|XP_002108537.1| hypothetical protein TRIADDRAFT_49594 [Trichoplax adhaerens] gi|190589313|gb|EDV29335.1| hypothetical protein TRIADDRAFT_49594 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|156355412|ref|XP_001623662.1| predicted protein [Nematostella vectensis] gi|156210383|gb|EDO31562.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|156392767|ref|XP_001636219.1| predicted protein [Nematostella vectensis] gi|156223320|gb|EDO44156.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|241566262|ref|XP_002402129.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] gi|215499989|gb|EEC09483.1| protein-L-isoaspartate(D-aspartate) O-methyltransferase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|426235212|ref|XP_004011583.1| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase [Ovis aries] Back     alignment and taxonomy information
>gi|390345040|ref|XP_786523.3| PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|124106313|sp|P15246.2|PIMT_BOVIN RecName: Full=Protein-L-isoaspartate(D-aspartate) O-methyltransferase; Short=PIMT; AltName: Full=L-isoaspartyl protein carboxyl methyltransferase; AltName: Full=Protein L-isoaspartyl/D-aspartyl methyltransferase; AltName: Full=Protein-beta-aspartate methyltransferase gi|296483921|tpg|DAA26036.1| TPA: protein-L-isoaspartate(D-aspartate) O-methyltransferase [Bos taurus] Back     alignment and taxonomy information
>gi|440895106|gb|ELR47379.1| Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|260830152|ref|XP_002610025.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] gi|229295388|gb|EEN66035.1| hypothetical protein BRAFLDRAFT_284774 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query492
UNIPROTKB|G3MZZ6228 PCMT1 "Protein-L-isoaspartate 0.400 0.864 0.450 9.9e-39
UNIPROTKB|P15246227 PCMT1 "Protein-L-isoaspartate( 0.400 0.867 0.450 9.9e-39
UNIPROTKB|E1BXJ0228 LOC423008 "Protein-L-isoaspart 0.357 0.771 0.467 2.6e-38
UNIPROTKB|P80895227 PCMT1 "Protein-L-isoaspartate( 0.400 0.867 0.446 4.3e-38
UNIPROTKB|J9JIK8208 PCMT1 "Protein-L-isoaspartate 0.373 0.884 0.463 7e-38
UNIPROTKB|H7BY58286 PCMT1 "Protein-L-isoaspartate 0.373 0.643 0.471 1.5e-37
UNIPROTKB|J3KP72285 PCMT1 "Protein-L-isoaspartate 0.373 0.645 0.471 1.5e-37
UNIPROTKB|P22061227 PCMT1 "Protein-L-isoaspartate( 0.373 0.810 0.471 1.5e-37
UNIPROTKB|Q5F3N1228 PCMT1 "Protein-L-isoaspartate( 0.400 0.864 0.436 1.5e-37
UNIPROTKB|E2R3G3286 PCMT1 "Protein-L-isoaspartate 0.400 0.688 0.441 3.9e-37
UNIPROTKB|G3MZZ6 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 414 (150.8 bits), Expect = 9.9e-39, P = 9.9e-39
 Identities = 92/204 (45%), Positives = 125/204 (61%)

Query:   137 GGSIEDIPEGVRF-GHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSP 195
             G S  ++   +R  G I + KV  VM + DR  + +     NPY D PQS+GF + +S+P
Sbjct:     7 GASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC----NPYMDSPQSIGFQATISAP 62

Query:   196 KVHAQALEILKDYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKS 255
              +HA ALE+L D L  GAK LD+GSGSG LTAC A MVGP+GKV  ++HI++LV  +  +
Sbjct:    63 HMHAYALELLFDQLNEGAKALDVGSGSGILTACFARMVGPSGKVIGIDHIKELVDDSINN 122

Query:   256 MHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFT 315
             +    P L+  GRVQ V GDGR G+AAE PYD I+VG A    P  L+DQLKPGG +   
Sbjct:   123 VRKDDPMLLSSGRVQLVVGDGRMGYAAEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILP 182

Query:   316 IGNA--EEMLKNNRRTESNLAVVK 337
             +G A   +ML+   + +     +K
Sbjct:   183 VGPAGGNQMLEQYDKLQDGSVKMK 206


GO:0005737 "cytoplasm" evidence=IEA
GO:0004719 "protein-L-isoaspartate (D-aspartate) O-methyltransferase activity" evidence=IEA
UNIPROTKB|P15246 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXJ0 LOC423008 "Protein-L-isoaspartate O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P80895 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9JIK8 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H7BY58 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP72 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P22061 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3N1 PCMT1 "Protein-L-isoaspartate(D-aspartate) O-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3G3 PCMT1 "Protein-L-isoaspartate O-methyltransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 2e-53
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 9e-45
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 2e-44
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 9e-32
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 3e-31
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 2e-30
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 1e-21
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 1e-21
TIGR04364394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 9e-21
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 1e-20
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 2e-20
pfam01135210 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartat 1e-18
TIGR04188363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 3e-16
PRK13943322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 3e-15
TIGR00080215 TIGR00080, pimt, protein-L-isoaspartate(D-aspartat 8e-15
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 9e-15
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethy 2e-13
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 1e-11
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 3e-11
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 1e-10
PRK13943322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 4e-10
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 4e-10
PRK13942212 PRK13942, PRK13942, protein-L-isoaspartate O-methy 5e-10
TIGR04364394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 9e-10
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 1e-09
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 2e-09
PRK00312212 PRK00312, pcm, protein-L-isoaspartate O-methyltran 3e-09
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 4e-09
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 1e-08
TIGR04188363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 2e-08
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 2e-08
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 2e-08
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 4e-08
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 6e-08
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 3e-07
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 3e-07
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 4e-07
PRK08317 241 PRK08317, PRK08317, hypothetical protein; Provisio 5e-07
COG2519256 COG2519, GCD14, tRNA(1-methyladenosine) methyltran 1e-06
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 1e-06
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 1e-06
TIGR04364 394 TIGR04364, methyltran_FxLD, methyltransferase, FxL 2e-06
PRK11873272 PRK11873, arsM, arsenite S-adenosylmethyltransfera 2e-06
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 2e-06
COG4106257 COG4106, Tam, Trans-aconitate methyltransferase [G 3e-06
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 4e-06
pfam01209233 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransf 8e-06
pfam01269229 pfam01269, Fibrillarin, Fibrillarin 8e-06
pfam01269229 pfam01269, Fibrillarin, Fibrillarin 8e-06
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 9e-06
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 1e-05
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 1e-05
pfam05175170 pfam05175, MTS, Methyltransferase small domain 1e-05
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 2e-05
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-05
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 2e-05
pfam13489154 pfam13489, Methyltransf_23, Methyltransferase doma 2e-05
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 2e-05
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 3e-05
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 3e-05
TIGR04188 363 TIGR04188, methyltr_grsp, methyltransferase, ATP-g 5e-05
PRK13943 322 PRK13943, PRK13943, protein-L-isoaspartate O-methy 9e-05
pfam13578105 pfam13578, Methyltransf_24, Methyltransferase doma 9e-05
COG4798238 COG4798, COG4798, Predicted methyltransferase [Gen 1e-04
COG4798238 COG4798, COG4798, Predicted methyltransferase [Gen 1e-04
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 2e-04
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 2e-04
PRK13944205 PRK13944, PRK13944, protein-L-isoaspartate O-methy 3e-04
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 5e-04
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 7e-04
PTZ00098263 PTZ00098, PTZ00098, phosphoethanolamine N-methyltr 8e-04
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 8e-04
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-m 0.001
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 0.001
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m 0.001
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 0.001
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltrans 0.001
PRK00377198 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltr 0.002
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 0.002
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 0.002
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 0.002
PRK14896258 PRK14896, ksgA, 16S ribosomal RNA methyltransferas 0.002
pfam08704309 pfam08704, GCD14, tRNA methyltransferase complex G 0.002
pfam08704 309 pfam08704, GCD14, tRNA methyltransferase complex G 0.002
pfam01596204 pfam01596, Methyltransf_3, O-methyltransferase 0.002
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 0.003
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 0.003
pfam00398254 pfam00398, RrnaAD, Ribosomal RNA adenine dimethyla 0.003
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Tr 0.003
COG4122219 COG4122, COG4122, Predicted O-methyltransferase [G 0.004
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 0.004
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 0.004
PRK01683258 PRK01683, PRK01683, trans-aconitate 2-methyltransf 0.004
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 0.004
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransf 0.004
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
 Score =  178 bits (453), Expect = 2e-53
 Identities = 80/191 (41%), Positives = 110/191 (57%), Gaps = 8/191 (4%)

Query: 148 RFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKD 207
            +G IAS KV   M ++DR  F+     +  Y DIP S+G+G  +S+P +HA  LE+L+ 
Sbjct: 12  NYGVIASDKVAEAMLAVDREEFVPESFKSYAYEDIPLSIGYGQTISAPHMHAMMLELLE- 70

Query: 208 YLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGG 267
            LKPG +VL+IGSGSGYLTAC A MVG  G V ++EHI +LV  A +++           
Sbjct: 71  -LKPGMRVLEIGSGSGYLTACFARMVGEVGLVVSIEHIPELVEIARRNLEKLGLE----- 124

Query: 268 RVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIG-NAEEMLKNN 326
            V  V GDGR+G     PYD I+VG A    P  L+DQLK GG +   +G N  ++L+  
Sbjct: 125 NVIVVVGDGRQGWPEFAPYDAIHVGAAAPEIPEALIDQLKEGGRLVIPVGPNGNQVLQQF 184

Query: 327 RRTESNLAVVK 337
            +      V+K
Sbjct: 185 DKRNDGSVVIK 195


Length = 210

>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|216320 pfam01135, PCMT, Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|232816 TIGR00080, pimt, protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225316 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|184409 PRK13942, PRK13942, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|178974 PRK00312, pcm, protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|225317 COG2519, GCD14, tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|234563 TIGR04364, methyltran_FxLD, methyltransferase, FxLD system Back     alignment and domain information
>gnl|CDD|237007 PRK11873, arsM, arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|226591 COG4106, Tam, Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family Back     alignment and domain information
>gnl|CDD|201699 pfam01269, Fibrillarin, Fibrillarin Back     alignment and domain information
>gnl|CDD|201699 pfam01269, Fibrillarin, Fibrillarin Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|234492 TIGR04188, methyltr_grsp, methyltransferase, ATP-grasp peptide maturase system Back     alignment and domain information
>gnl|CDD|237568 PRK13943, PRK13943, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222236 pfam13578, Methyltransf_24, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|227135 COG4798, COG4798, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|227135 COG4798, COG4798, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233708 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|140001 PRK13944, PRK13944, protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|173391 PTZ00098, PTZ00098, phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233687 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|234740 PRK00377, cbiT, cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237852 PRK14896, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>gnl|CDD|219979 pfam08704, GCD14, tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>gnl|CDD|219979 pfam08704, GCD14, tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>gnl|CDD|201880 pfam01596, Methyltransf_3, O-methyltransferase Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215900 pfam00398, RrnaAD, Ribosomal RNA adenine dimethylase Back     alignment and domain information
>gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|226607 COG4122, COG4122, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234970 PRK01683, PRK01683, trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 492
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.95
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.94
PLN02336475 phosphoethanolamine N-methyltransferase 99.93
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.92
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.92
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.91
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.9
KOG1661|consensus237 99.9
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.85
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 99.85
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.82
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.82
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.81
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.81
PLN02336 475 phosphoethanolamine N-methyltransferase 99.79
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.78
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.78
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.76
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.76
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.69
PLN02233261 ubiquinone biosynthesis methyltransferase 99.69
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.68
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.68
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.64
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.64
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.64
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.63
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 99.63
PLN02244340 tocopherol O-methyltransferase 99.63
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.62
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.62
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.62
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.6
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.6
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.6
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.6
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.59
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.59
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.58
KOG1661|consensus237 99.58
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.57
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.57
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.54
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.54
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.54
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.54
PRK11207197 tellurite resistance protein TehB; Provisional 99.54
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.54
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.53
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.52
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.52
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.52
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.52
KOG1540|consensus296 99.52
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.52
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.51
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.5
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.5
TIGR00452314 methyltransferase, putative. Known examples to dat 99.5
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.48
KOG1270|consensus282 99.48
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.48
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.48
PRK08317241 hypothetical protein; Provisional 99.47
PRK05785226 hypothetical protein; Provisional 99.47
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.47
PRK04266226 fibrillarin; Provisional 99.46
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.46
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.46
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.45
PLN02490340 MPBQ/MSBQ methyltransferase 99.45
PLN02233261 ubiquinone biosynthesis methyltransferase 99.45
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.45
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.45
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.45
PRK06922677 hypothetical protein; Provisional 99.44
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.44
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.43
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.43
PRK07402196 precorrin-6B methylase; Provisional 99.43
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.43
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.42
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.42
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.42
PRK12335287 tellurite resistance protein TehB; Provisional 99.42
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.41
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.4
COG2890280 HemK Methylase of polypeptide chain release factor 99.4
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.4
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.39
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.39
PLN02244340 tocopherol O-methyltransferase 99.39
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.39
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.38
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.38
KOG1541|consensus270 99.38
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.37
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.37
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.37
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.36
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.36
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.36
PRK14967223 putative methyltransferase; Provisional 99.36
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.35
PLN03075296 nicotianamine synthase; Provisional 99.35
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.34
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.34
PTZ00146293 fibrillarin; Provisional 99.33
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.33
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.33
KOG1540|consensus296 99.32
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.31
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.31
COG4122219 Predicted O-methyltransferase [General function pr 99.31
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.31
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.31
COG4123248 Predicted O-methyltransferase [General function pr 99.31
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.31
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.31
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.3
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.3
PRK06202232 hypothetical protein; Provisional 99.3
PLN02476278 O-methyltransferase 99.29
PRK14901434 16S rRNA methyltransferase B; Provisional 99.29
TIGR03438301 probable methyltransferase. This model represents 99.29
PRK14903431 16S rRNA methyltransferase B; Provisional 99.28
PRK14904445 16S rRNA methyltransferase B; Provisional 99.27
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.27
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.26
PRK14968188 putative methyltransferase; Provisional 99.26
KOG1499|consensus 346 99.26
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 99.25
KOG2904|consensus328 99.25
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.25
PRK10901427 16S rRNA methyltransferase B; Provisional 99.25
PRK11207197 tellurite resistance protein TehB; Provisional 99.24
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.24
PRK14902444 16S rRNA methyltransferase B; Provisional 99.24
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.23
PRK05785226 hypothetical protein; Provisional 99.23
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.23
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.23
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.22
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.22
KOG1271|consensus227 99.22
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.22
PLN02672 1082 methionine S-methyltransferase 99.21
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.21
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.21
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.2
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 99.2
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.2
PRK04457262 spermidine synthase; Provisional 99.2
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.19
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.19
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.19
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.19
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.18
PLN02589247 caffeoyl-CoA O-methyltransferase 99.18
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.18
PRK00811283 spermidine synthase; Provisional 99.17
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.16
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.16
TIGR00438188 rrmJ cell division protein FtsJ. 99.16
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.15
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.15
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.15
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.15
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.15
KOG4300|consensus252 99.15
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.15
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.14
PRK06202232 hypothetical protein; Provisional 99.14
PHA03412241 putative methyltransferase; Provisional 99.14
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.14
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.14
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.13
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.13
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.13
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.13
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.13
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.13
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.12
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 99.12
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.11
COG2890280 HemK Methylase of polypeptide chain release factor 99.1
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.1
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.1
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.1
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.09
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.08
PRK13256226 thiopurine S-methyltransferase; Reviewed 99.08
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 99.08
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.07
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.07
PHA03411279 putative methyltransferase; Provisional 99.07
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.07
PRK08317241 hypothetical protein; Provisional 99.06
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.06
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.06
PLN02490340 MPBQ/MSBQ methyltransferase 99.05
KOG3010|consensus261 99.05
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.05
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.05
KOG1500|consensus 517 99.05
COG4123248 Predicted O-methyltransferase [General function pr 99.04
TIGR00452314 methyltransferase, putative. Known examples to dat 99.04
PRK04266226 fibrillarin; Provisional 99.04
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.04
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.04
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 99.03
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 99.02
PRK01581374 speE spermidine synthase; Validated 99.02
PRK12335287 tellurite resistance protein TehB; Provisional 99.02
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 99.02
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.02
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.01
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.01
KOG2187|consensus534 99.01
KOG1270|consensus282 99.01
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.0
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.0
PHA03412241 putative methyltransferase; Provisional 99.0
PLN02366308 spermidine synthase 99.0
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 99.0
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.99
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.99
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.99
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.98
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.97
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.97
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.97
COG4122219 Predicted O-methyltransferase [General function pr 98.97
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.97
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.97
PLN03075296 nicotianamine synthase; Provisional 98.96
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.96
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.96
PLN02672 1082 methionine S-methyltransferase 98.96
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.96
PLN02476278 O-methyltransferase 98.96
PRK07402196 precorrin-6B methylase; Provisional 98.95
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.95
PRK06922677 hypothetical protein; Provisional 98.95
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.95
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.94
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.94
PRK03612521 spermidine synthase; Provisional 98.94
PHA03411279 putative methyltransferase; Provisional 98.93
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.93
KOG3420|consensus185 98.93
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.93
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.92
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.92
KOG1271|consensus227 98.92
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.92
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.92
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.92
PRK14967223 putative methyltransferase; Provisional 98.92
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.91
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.91
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.91
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.91
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.91
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.9
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.89
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.89
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.88
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.88
KOG1541|consensus270 98.88
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.88
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.87
KOG2904|consensus328 98.87
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.86
PLN02232160 ubiquinone biosynthesis methyltransferase 98.86
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.85
KOG2899|consensus288 98.84
PLN02589247 caffeoyl-CoA O-methyltransferase 98.84
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.84
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.83
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.83
PRK14901434 16S rRNA methyltransferase B; Provisional 98.82
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.81
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.81
PRK14904445 16S rRNA methyltransferase B; Provisional 98.81
KOG2915|consensus314 98.81
PRK14903431 16S rRNA methyltransferase B; Provisional 98.8
PRK14968188 putative methyltransferase; Provisional 98.8
PTZ00146293 fibrillarin; Provisional 98.8
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.79
KOG1663|consensus237 98.78
COG2265432 TrmA SAM-dependent methyltransferases related to t 98.78
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.77
PRK14902444 16S rRNA methyltransferase B; Provisional 98.76
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.76
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.75
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.75
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.74
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.73
KOG3420|consensus185 98.73
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.72
KOG3191|consensus209 98.71
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.71
PRK10901427 16S rRNA methyltransferase B; Provisional 98.7
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.69
KOG1499|consensus346 98.68
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.68
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.67
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.66
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 98.66
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.65
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.65
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.65
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.65
KOG4300|consensus252 98.65
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.65
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.65
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.64
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.64
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.64
KOG0820|consensus315 98.63
PRK04457262 spermidine synthase; Provisional 98.62
PRK04148134 hypothetical protein; Provisional 98.61
PLN02823336 spermine synthase 98.6
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.6
COG2521287 Predicted archaeal methyltransferase [General func 98.6
KOG2361|consensus264 98.6
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.59
COG1041347 Predicted DNA modification methylase [DNA replicat 98.58
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.58
TIGR03438301 probable methyltransferase. This model represents 98.58
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.57
KOG3010|consensus261 98.57
KOG1975|consensus389 98.56
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.56
COG1041347 Predicted DNA modification methylase [DNA replicat 98.55
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.55
KOG2940|consensus325 98.55
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.55
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.55
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.55
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.54
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.54
TIGR00438188 rrmJ cell division protein FtsJ. 98.54
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.52
KOG0820|consensus315 98.52
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.52
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.5
PRK04148134 hypothetical protein; Provisional 98.5
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.49
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 98.48
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.48
KOG2915|consensus314 98.48
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.47
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.47
PRK00811283 spermidine synthase; Provisional 98.45
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.45
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.42
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.41
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.39
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.39
COG2520341 Predicted methyltransferase [General function pred 98.38
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.34
KOG3191|consensus209 98.34
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.34
COG2520341 Predicted methyltransferase [General function pred 98.32
PLN02366308 spermidine synthase 98.31
KOG1500|consensus517 98.3
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 98.3
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.3
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.28
COG0421282 SpeE Spermidine synthase [Amino acid transport and 98.27
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.26
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.25
PRK00536262 speE spermidine synthase; Provisional 98.24
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 98.24
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.23
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.23
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.22
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.21
PRK01581374 speE spermidine synthase; Validated 98.21
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.21
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.19
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.19
KOG1663|consensus237 98.19
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.18
PRK03612521 spermidine synthase; Provisional 98.17
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.15
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 98.14
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.12
KOG2730|consensus263 98.11
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.1
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.09
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.08
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 98.08
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.06
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.05
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 98.03
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.03
KOG3045|consensus325 98.01
KOG2187|consensus534 97.99
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.98
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.96
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.96
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.96
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.94
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.93
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.92
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.92
KOG1331|consensus293 97.91
KOG2940|consensus325 97.91
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.9
PF13679141 Methyltransf_32: Methyltransferase domain 97.89
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.88
COG4076252 Predicted RNA methylase [General function predicti 97.86
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.81
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.81
PF13679141 Methyltransf_32: Methyltransferase domain 97.81
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 97.8
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.8
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 97.79
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.78
KOG1269|consensus364 97.78
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 97.78
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 97.77
KOG2899|consensus288 97.77
COG4262508 Predicted spermidine synthase with an N-terminal m 97.76
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.76
COG4798238 Predicted methyltransferase [General function pred 97.75
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.73
COG4076252 Predicted RNA methylase [General function predicti 97.71
KOG1975|consensus389 97.7
COG2521287 Predicted archaeal methyltransferase [General func 97.7
PLN02232160 ubiquinone biosynthesis methyltransferase 97.69
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.67
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.66
KOG1122|consensus460 97.63
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 97.6
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 97.59
KOG3178|consensus342 97.58
PLN02823336 spermine synthase 97.58
COG3897218 Predicted methyltransferase [General function pred 97.55
KOG4589|consensus232 97.54
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.54
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.54
COG2384226 Predicted SAM-dependent methyltransferase [General 97.49
COG2384226 Predicted SAM-dependent methyltransferase [General 97.49
KOG2361|consensus264 97.45
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.44
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.42
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 97.4
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.38
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.36
KOG1709|consensus271 97.32
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.3
KOG2730|consensus263 97.3
COG3897218 Predicted methyltransferase [General function pred 97.3
KOG1596|consensus317 97.29
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 97.28
PRK10742250 putative methyltransferase; Provisional 97.23
KOG2352|consensus482 97.22
PRK10742250 putative methyltransferase; Provisional 97.17
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.14
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.11
KOG1269|consensus364 97.06
KOG3987|consensus288 97.05
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 97.02
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.02
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.99
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 96.97
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.97
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 96.96
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.93
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 96.89
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 96.89
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 96.87
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.84
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 96.83
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 96.82
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 96.81
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.77
KOG2352|consensus 482 96.72
KOG3115|consensus249 96.7
PRK00536262 speE spermidine synthase; Provisional 96.7
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 96.67
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 96.63
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.61
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.6
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.49
PRK11524284 putative methyltransferase; Provisional 96.45
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 96.26
COG0286489 HsdM Type I restriction-modification system methyl 96.22
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.18
KOG0024|consensus354 96.16
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 96.15
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 96.12
KOG1501|consensus 636 96.08
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.07
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 96.05
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.95  E-value=1.3e-26  Score=206.84  Aligned_cols=176  Identities=35%  Similarity=0.598  Sum_probs=160.9

Q ss_pred             cccchhcccccChhHHHHHHhccccccccccccCCCCCCCCcccCCCCcccChHHHHHHHHHHHhccCCCCceEEEeccc
Q psy7834         143 IPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSGS  222 (492)
Q Consensus       143 l~~~L~~~~l~~~~~~~a~~~v~r~~f~~~~~~~~~y~d~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDiGcG~  222 (492)
                      +.++|+..++.+..+.+++..+||+.|+++.++..+|.|.+++++.++++++|.+.+++++.|.  ++++++|||||||+
T Consensus         6 l~~~lr~~~i~~~~v~~A~~~vPRe~FVp~~~~~~AY~d~~lpi~~gqtis~P~~vA~m~~~L~--~~~g~~VLEIGtGs   83 (209)
T COG2518           6 LVERLRTEGITDERVLKAFLAVPRELFVPAAYKHLAYEDRALPIGCGQTISAPHMVARMLQLLE--LKPGDRVLEIGTGS   83 (209)
T ss_pred             HHHHHHHcCCCcHHHHHHHHhCCHHhccCchhhcccccCCcccCCCCceecCcHHHHHHHHHhC--CCCCCeEEEECCCc
Confidence            4567788889999999999999999999999999999999999999999999999999999997  89999999999999


Q ss_pred             cHHHHHHHHHhCCCCeEEEEeCCHHHHHHHHHHHHhhCCCCCCCCcEEEEEccCCCCCcCCCCccEEEecCcchhhHHHH
Q psy7834         223 GYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKL  302 (492)
Q Consensus       223 G~~~~~la~~~~~~~~v~giD~s~~~l~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD~i~s~~~~~~~~~~~  302 (492)
                      ||.+..||+..+   +|+++|..++..+.|++|+...     +..||.++++|....+++.++||.|++.++...+|+.+
T Consensus        84 GY~aAvla~l~~---~V~siEr~~~L~~~A~~~L~~l-----g~~nV~v~~gDG~~G~~~~aPyD~I~Vtaaa~~vP~~L  155 (209)
T COG2518          84 GYQAAVLARLVG---RVVSIERIEELAEQARRNLETL-----GYENVTVRHGDGSKGWPEEAPYDRIIVTAAAPEVPEAL  155 (209)
T ss_pred             hHHHHHHHHHhC---eEEEEEEcHHHHHHHHHHHHHc-----CCCceEEEECCcccCCCCCCCcCEEEEeeccCCCCHHH
Confidence            999999999975   7999999999999999999986     45689999999999898889999999999999999999


Q ss_pred             HHHhccCCeEEEEeCCCc-ceeeeccc
Q psy7834         303 MDQLKPGGVMWFTIGNAE-EMLKNNRR  328 (492)
Q Consensus       303 ~~~L~pgG~l~~~~~~~~-~~~~~~~~  328 (492)
                      .++|||||+|++.++... |.+....+
T Consensus       156 l~QL~~gGrlv~PvG~~~~q~l~~~~k  182 (209)
T COG2518         156 LDQLKPGGRLVIPVGSGPAQRLLRITK  182 (209)
T ss_pred             HHhcccCCEEEEEEccCCcEEEEEEEE
Confidence            999999999999998433 55544433



>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>KOG1661|consensus Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1271|consensus Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG1541|consensus Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>KOG2904|consensus Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>KOG1499|consensus Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG0820|consensus Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG2915|consensus Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG1500|consensus Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>KOG1663|consensus Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>KOG2187|consensus Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1122|consensus Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>KOG3178|consensus Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4589|consensus Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG1709|consensus Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>KOG2730|consensus Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>KOG3987|consensus Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>KOG3115|consensus Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG1501|consensus Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 2e-39
1i1n_A226 Human Protein L-Isoaspartate O-Methyltransferase Wi 3e-15
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 1e-32
1r18_A227 Drosophila Protein Isoaspartyl Methyltransferase Wi 3e-11
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 3e-19
2yxe_A215 Crystal Structure Of L-Isoaspartyl Protein Carboxyl 1e-05
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 1e-18
3lbf_A210 Crystal Structure Of Protein L-Isoaspartyl Methyltr 3e-04
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 4e-17
2pbf_A227 Crystal Structure Of A Putative Protein-L-Isoaspart 7e-07
1jg4_A235 Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- 3e-14
1dl5_A317 Protein-L-Isoaspartate O-Methyltransferase Length = 8e-10
1vbf_A231 Crystal Structure Of Protein L-Isoaspartate O-Methy 3e-09
3dh0_A219 Crystal Structure Of A Sam Dependent Methyltransfer 7e-06
3dh0_A219 Crystal Structure Of A Sam Dependent Methyltransfer 1e-04
2yvl_A248 Crystal Structure Of Trna (m1a58) Methyltransferase 4e-05
1i9g_A280 Crystal Structure Of An Adomet Dependent Methyltran 2e-04
1o54_A277 Crystal Structure Of Sam-Dependent O-Methyltransfer 5e-04
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure

Iteration: 1

Score = 159 bits (403), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 85/172 (49%), Positives = 110/172 (63%), Gaps = 4/172 (2%) Query: 148 RFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKD 207 + G I + KV VM + DR + + NPY D PQS+GF + +S+P +HA ALE+L D Sbjct: 18 KNGIIKTDKVFEVMLATDRSHYAK----CNPYMDSPQSIGFQATISAPHMHAYALELLFD 73 Query: 208 YLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGG 267 L GAK LD+GSGSG LTAC A MVG TGKV ++HI++LV + ++ P L+ G Sbjct: 74 QLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSG 133 Query: 268 RVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNA 319 RVQ V GDGR G+A E PYD I+VG A P L+DQLKPGG + +G A Sbjct: 134 RVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPA 185
>pdb|1I1N|A Chain A, Human Protein L-Isoaspartate O-Methyltransferase With S- Adenosyl Homocysteine Length = 226 Back     alignment and structure
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|1R18|A Chain A, Drosophila Protein Isoaspartyl Methyltransferase With S-Adenosyl-L- Homocysteine Length = 227 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|2YXE|A Chain A, Crystal Structure Of L-Isoaspartyl Protein Carboxyl Methyltranferase Length = 215 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure
>pdb|3LBF|A Chain A, Crystal Structure Of Protein L-Isoaspartyl Methyltransferase From Escherichia Coli Length = 210 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|2PBF|A Chain A, Crystal Structure Of A Putative Protein-L-Isoaspartate O- Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine Length = 227 Back     alignment and structure
>pdb|1JG4|A Chain A, Crystal Structure Of L-Isoaspartyl (D-Aspartyl) O- Methyltransferase With S-Adenosylmethionine Length = 235 Back     alignment and structure
>pdb|1DL5|A Chain A, Protein-L-Isoaspartate O-Methyltransferase Length = 317 Back     alignment and structure
>pdb|1VBF|A Chain A, Crystal Structure Of Protein L-Isoaspartate O-Methyltransferase Homologue From Sulfolobus Tokodaii Length = 231 Back     alignment and structure
>pdb|3DH0|A Chain A, Crystal Structure Of A Sam Dependent Methyltransferase From Aquifex Aeolicus Length = 219 Back     alignment and structure
>pdb|3DH0|A Chain A, Crystal Structure Of A Sam Dependent Methyltransferase From Aquifex Aeolicus Length = 219 Back     alignment and structure
>pdb|2YVL|A Chain A, Crystal Structure Of Trna (m1a58) Methyltransferase Trmi From Aquifex Aeolicus Length = 248 Back     alignment and structure
>pdb|1I9G|A Chain A, Crystal Structure Of An Adomet Dependent Methyltransferase Length = 280 Back     alignment and structure
>pdb|1O54|A Chain A, Crystal Structure Of Sam-Dependent O-Methyltransferase (Tm0748) From Thermotoga Maritima At 1.65 A Resolution Length = 277 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query492
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 1e-63
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 7e-41
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 8e-27
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 3e-61
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 4e-37
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 1e-24
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-58
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 2e-34
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 3e-23
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 1e-57
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 1e-31
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 1e-20
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 7e-54
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 1e-28
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 1e-17
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 1e-53
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 2e-29
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 3e-18
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 5e-50
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 2e-25
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 3e-15
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 1e-47
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 2e-25
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 7e-19
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 3e-18
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 4e-09
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 4e-07
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 8e-17
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 2e-08
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 2e-08
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 4e-16
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 1e-05
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 7e-05
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 4e-16
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 5e-09
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 1e-07
2b25_A336 Hypothetical protein; structural genomics, methyl 4e-16
2b25_A 336 Hypothetical protein; structural genomics, methyl 4e-08
2b25_A336 Hypothetical protein; structural genomics, methyl 9e-07
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 7e-15
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 1e-11
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 7e-10
3dh0_A219 SAM dependent methyltransferase; cystal structure, 2e-14
3dh0_A219 SAM dependent methyltransferase; cystal structure, 1e-10
3dh0_A219 SAM dependent methyltransferase; cystal structure, 5e-10
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 3e-14
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 2e-06
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-14
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 8e-09
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 1e-08
3f4k_A257 Putative methyltransferase; structural genomics, P 2e-13
3f4k_A257 Putative methyltransferase; structural genomics, P 7e-10
3f4k_A 257 Putative methyltransferase; structural genomics, P 1e-04
1yb2_A275 Hypothetical protein TA0852; structural genomics, 3e-13
1yb2_A275 Hypothetical protein TA0852; structural genomics, 4e-08
1yb2_A275 Hypothetical protein TA0852; structural genomics, 2e-07
3ocj_A305 Putative exported protein; structural genomics, PS 6e-13
3ocj_A305 Putative exported protein; structural genomics, PS 4e-09
3ocj_A305 Putative exported protein; structural genomics, PS 6e-09
3dtn_A234 Putative methyltransferase MM_2633; structural gen 2e-12
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 8e-06
3dtn_A234 Putative methyltransferase MM_2633; structural gen 2e-05
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 2e-12
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 1e-07
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 4e-05
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-12
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 7e-09
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 1e-04
3gu3_A284 Methyltransferase; alpha-beta protein, structural 4e-12
3gu3_A284 Methyltransferase; alpha-beta protein, structural 2e-09
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 4e-08
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-12
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 2e-07
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 6e-07
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 7e-12
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 6e-07
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 4e-06
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 1e-11
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 4e-10
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 1e-06
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 2e-11
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 5e-09
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 1e-04
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 2e-11
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 4e-07
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 3e-06
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 3e-11
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 2e-05
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 4e-04
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 3e-11
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-07
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 3e-07
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 5e-11
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 1e-05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 7e-11
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 8e-06
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 9e-11
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 1e-04
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 1e-10
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 1e-07
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 1e-10
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 3e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 2e-10
3i9f_A170 Putative type 11 methyltransferase; structural gen 1e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 2e-06
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 2e-10
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 2e-06
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 3e-10
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 1e-07
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 2e-05
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 4e-10
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 5e-10
3hnr_A220 Probable methyltransferase BT9727_4108; structural 6e-10
3hnr_A220 Probable methyltransferase BT9727_4108; structural 8e-04
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 7e-10
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 3e-06
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 8e-10
3cc8_A230 Putative methyltransferase; structural genomics, j 8e-10
3cc8_A230 Putative methyltransferase; structural genomics, j 2e-04
3cc8_A 230 Putative methyltransferase; structural genomics, j 3e-04
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 1e-09
3ege_A261 Putative methyltransferase from antibiotic biosyn 1e-09
3ege_A261 Putative methyltransferase from antibiotic biosyn 8e-05
3ege_A 261 Putative methyltransferase from antibiotic biosyn 6e-04
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 1e-09
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 7e-08
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 1e-06
3m33_A226 Uncharacterized protein; structural genomics, PSI- 1e-09
3m33_A226 Uncharacterized protein; structural genomics, PSI- 1e-05
3m33_A226 Uncharacterized protein; structural genomics, PSI- 3e-05
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 2e-09
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 3e-06
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 3e-09
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 1e-04
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 3e-09
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 3e-09
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 8e-04
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 3e-09
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 5e-06
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 4e-09
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 2e-05
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 4e-09
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 7e-09
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 9e-07
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 2e-06
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 1e-08
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 2e-08
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 2e-08
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 7e-07
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 3e-06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 2e-08
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 1e-05
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 3e-08
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 8e-07
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 7e-06
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 3e-08
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 4e-07
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 3e-06
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 3e-08
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 7e-05
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 1e-04
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 4e-08
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 4e-08
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 5e-08
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 7e-07
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 5e-08
2p7i_A250 Hypothetical protein; putative methyltransferase, 5e-08
2p7i_A250 Hypothetical protein; putative methyltransferase, 1e-05
2p7i_A 250 Hypothetical protein; putative methyltransferase, 7e-05
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 6e-08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 2e-06
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 6e-04
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 7e-08
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 1e-07
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 6e-07
2avd_A229 Catechol-O-methyltransferase; structural genomics, 7e-08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 1e-07
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 4e-04
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 5e-04
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 1e-07
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 1e-07
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 8e-04
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 1e-07
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 2e-07
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 6e-07
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 3e-07
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 3e-07
3duw_A223 OMT, O-methyltransferase, putative; alternating of 4e-07
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 5e-07
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 5e-07
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 5e-05
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 5e-07
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 8e-04
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 6e-07
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 2e-06
3lcc_A235 Putative methyl chloride transferase; halide methy 6e-07
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 7e-07
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 8e-07
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 4e-06
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 9e-07
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 1e-06
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 1e-06
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 2e-06
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 2e-06
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 9e-05
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 3e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 2e-06
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 4e-05
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 2e-06
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 1e-04
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 8e-04
3ll7_A410 Putative methyltransferase; methytransferase, stru 2e-06
3ll7_A410 Putative methyltransferase; methytransferase, stru 6e-05
3lpm_A259 Putative methyltransferase; structural genomics, p 3e-06
3lpm_A259 Putative methyltransferase; structural genomics, p 3e-05
3lpm_A 259 Putative methyltransferase; structural genomics, p 2e-04
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 4e-06
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 5e-06
1xxl_A239 YCGJ protein; structural genomics, protein structu 4e-06
1vlm_A219 SAM-dependent methyltransferase; possible histamin 5e-06
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 5e-06
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 6e-06
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 7e-06
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 7e-06
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 7e-05
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 7e-06
2kw5_A202 SLR1183 protein; structural genomics, northeast st 8e-06
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 8e-06
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 2e-04
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 1e-05
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 1e-05
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 1e-05
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 2e-05
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 9e-05
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, str 2e-05
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 2e-05
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 2e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 3e-05
1wzn_A252 SAM-dependent methyltransferase; structural genomi 3e-05
1vl5_A260 Unknown conserved protein BH2331; putative methylt 3e-05
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 5e-05
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 7e-04
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 7e-05
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 8e-05
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 8e-05
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 9e-05
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 1e-04
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 1e-04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 1e-04
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 1e-04
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 1e-04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 2e-04
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 3e-04
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 3e-04
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 3e-04
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 4e-04
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 5e-04
2b3t_A276 Protein methyltransferase HEMK; translation termin 8e-04
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
 Score =  205 bits (524), Expect = 1e-63
 Identities = 88/203 (43%), Positives = 115/203 (56%), Gaps = 14/203 (6%)

Query: 147 VRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILK 206
            + G I + KV  VM + DR  + +     NPY D PQS+GF + +S+P +HA ALE+L 
Sbjct: 17  RKNGIIKTDKVFEVMLATDRSHYAK----CNPYMDSPQSIGFQATISAPHMHAYALELLF 72

Query: 207 DYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEG 266
           D L  GAK LD+GSGSG LTAC A MVG TGKV  ++HI++LV  +  ++    P L+  
Sbjct: 73  DQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSS 132

Query: 267 GRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNN 326
           GRVQ V GDGR G+A E PYD I+VG A    P  L+DQLKPGG +   +G A       
Sbjct: 133 GRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGG----- 187

Query: 327 RRTESNLAVVKAHKKDHGEWEEE 349
                 L      K   G  + +
Sbjct: 188 ---NQMLEQYD--KLQDGSIKMK 205


>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Length = 226 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Length = 227 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Length = 215 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Length = 231 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Length = 235 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Length = 210 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Length = 317 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Length = 258 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Length = 255 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Length = 248 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Length = 277 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Length = 336 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Length = 280 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Length = 275 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Length = 233 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Length = 210 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Length = 230 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Length = 237 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Length = 247 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} Length = 225 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Length = 242 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Length = 229 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Length = 221 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Length = 232 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B* 3pla_E* Length = 232 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} PDB: 3id5_B* 3pla_E* Length = 232 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Length = 248 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Length = 232 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Length = 223 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Length = 235 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Length = 227 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Length = 227 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Length = 233 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Length = 239 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Length = 233 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Length = 215 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Length = 236 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Length = 343 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Length = 343 Back     alignment and structure
>1im8_A YECO; methyltransferase, adenosylhomocysteine, structural genomics hypothetical protein, structure 2 function project, S2F, TR; HET: SAI; 2.20A {Haemophilus influenzae RD} SCOP: c.66.1.14 Length = 244 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Length = 292 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Length = 302 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Length = 375 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Length = 425 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Length = 210 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Length = 170 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Length = 221 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.87
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.86
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.85
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.85
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.84
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.82
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.79
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.77
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.74
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.66
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.65
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.65
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.64
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.64
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.64
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.64
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.63
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.63
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.63
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.63
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.62
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.62
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.61
2b25_A336 Hypothetical protein; structural genomics, methyl 99.61
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.61
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.61
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.6
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.6
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.6
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.6
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.6
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.6
3f4k_A257 Putative methyltransferase; structural genomics, P 99.6
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.59
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.59
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.59
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.58
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.57
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.57
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.57
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.57
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.57
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.57
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.57
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.56
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.56
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.56
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.56
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.55
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.55
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.55
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.55
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.55
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.55
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.55
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.55
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.55
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.55
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.54
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.54
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.54
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.54
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.54
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.54
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.54
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.54
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.54
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.54
3ocj_A305 Putative exported protein; structural genomics, PS 99.53
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.53
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.53
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.53
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.53
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.53
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.53
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.53
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.52
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.52
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.52
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.52
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.52
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.52
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.52
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.52
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.52
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.52
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.51
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.51
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.51
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.51
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.51
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.51
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.5
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.5
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.5
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.5
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.5
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.5
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.5
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.5
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.5
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.5
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.5
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.5
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.49
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.49
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.49
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.49
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.49
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.49
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.49
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.49
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.49
3lcc_A235 Putative methyl chloride transferase; halide methy 99.49
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.48
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.48
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.48
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.48
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.48
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.48
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.47
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.47
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.47
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.47
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.47
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.47
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.47
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.47
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.47
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.47
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.47
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.47
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.47
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.46
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.46
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.46
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.46
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.46
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.46
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.45
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.45
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.45
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.45
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.45
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.45
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.44
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.44
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.44
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.44
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.44
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.43
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.43
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.43
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.43
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.43
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.43
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.43
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.43
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.43
3lpm_A259 Putative methyltransferase; structural genomics, p 99.43
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.43
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.43
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.43
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.43
2h00_A254 Methyltransferase 10 domain containing protein; st 99.43
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.42
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.42
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.42
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.42
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.41
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 99.41
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.39
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.38
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.38
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.38
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.38
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.37
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.37
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 99.37
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.37
3giw_A277 Protein of unknown function DUF574; rossmann-fold 99.36
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.36
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.36
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.36
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.35
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.35
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.35
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.35
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.35
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.35
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.35
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.34
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.34
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.34
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.34
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.34
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.34
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.34
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.34
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.33
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.33
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 99.33
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.33
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.33
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.33
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.31
2b25_A336 Hypothetical protein; structural genomics, methyl 99.31
1xj5_A334 Spermidine synthase 1; structural genomics, protei 99.31
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.31
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.3
3cc8_A230 Putative methyltransferase; structural genomics, j 99.3
3gjy_A317 Spermidine synthase; APC62791, structural genomics 99.3
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.3
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.3
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.3
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.3
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.29
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.29
3k6r_A278 Putative transferase PH0793; structural genomics, 99.29
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.29
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.29
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.29
3f4k_A257 Putative methyltransferase; structural genomics, P 99.29
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 99.28
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.28
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 99.28
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.28
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 99.28
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.28
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.28
2o07_A304 Spermidine synthase; structural genomics, structur 99.28
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.28
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.27
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.27
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.27
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.27
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.26
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.26
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.26
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.26
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 99.26
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.26
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 99.26
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.26
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.26
3sso_A419 Methyltransferase; macrolide, natural product, ros 99.26
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.25
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.25
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.25
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 99.25
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.25
2pt6_A321 Spermidine synthase; transferase, structural genom 99.25
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.24
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.24
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 99.24
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 99.24
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.24
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.24
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.23
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.23
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.22
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.22
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.22
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.22
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.22
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.22
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.22
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.21
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.21
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.21
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.2
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.2
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.2
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.2
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.2
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.2
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.2
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.2
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.2
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.2
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.2
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.2
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.2
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.2
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.19
2i7c_A283 Spermidine synthase; transferase, structural genom 99.19
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.19
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.19
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.19
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.18
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.17
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.17
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.17
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.17
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 99.17
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.17
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.17
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.17
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.17
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.16
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.16
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.16
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.16
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 99.16
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.16
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.16
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.16
3ocj_A305 Putative exported protein; structural genomics, PS 99.16
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.15
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.15
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.15
2cmg_A262 Spermidine synthase; transferase, putrescine amino 99.15
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.15
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.15
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 99.15
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.15
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.15
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.14
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.14
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.14
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.14
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.14
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.14
2h00_A254 Methyltransferase 10 domain containing protein; st 99.14
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.14
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.14
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.13
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.13
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.13
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.13
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.13
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.13
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.13
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.13
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.13
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.13
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.13
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.13
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.12
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.12
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.12
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.12
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.12
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.12
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.12
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.11
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 99.11
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.11
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.11
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.11
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.11
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.11
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.11
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 99.11
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.1
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.1
3fut_A271 Dimethyladenosine transferase; methyltransferase, 99.1
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.1
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.1
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.1
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.1
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.1
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.1
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.09
3lpm_A259 Putative methyltransferase; structural genomics, p 99.09
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.09
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.09
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.09
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.09
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.09
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.09
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.09
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.08
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.08
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.08
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.08
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.08
3fut_A271 Dimethyladenosine transferase; methyltransferase, 99.08
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.08
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.08
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.08
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.08
3lcc_A235 Putative methyl chloride transferase; halide methy 99.08
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.08
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.07
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.07
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.07
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.07
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.07
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.07
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.07
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.06
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.06
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.06
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.06
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.06
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.05
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.05
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.05
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.05
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.04
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.04
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.04
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.04
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.04
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.04
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.02
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.02
3k6r_A278 Putative transferase PH0793; structural genomics, 99.02
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.02
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.02
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.02
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.02
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.02
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.01
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.01
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 99.01
3cvo_A202 Methyltransferase-like protein of unknown functio; 99.01
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.01
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 99.01
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 99.01
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.01
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.01
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.0
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.0
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.99
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.99
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.99
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.99
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.98
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.98
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.98
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.98
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.98
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.98
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.98
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.98
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.97
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.97
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.96
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.96
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.95
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.95
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.95
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.94
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.94
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.93
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.92
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.92
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.91
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.9
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.9
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.9
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.89
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.89
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.89
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.88
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.88
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.88
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.87
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.87
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.87
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.87
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.87
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.87
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.87
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.86
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.86
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.85
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.85
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.85
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.84
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.84
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 98.83
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.83
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.82
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.82
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.82
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.81
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.81
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.8
3cc8_A230 Putative methyltransferase; structural genomics, j 98.8
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.8
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.8
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.79
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.79
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.78
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.78
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.78
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.76
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.76
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.75
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.74
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.73
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.73
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.72
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.72
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
Probab=99.87  E-value=8.3e-22  Score=181.84  Aligned_cols=170  Identities=31%  Similarity=0.541  Sum_probs=150.7

Q ss_pred             ccccchhcccccChhHHHHHHhccccccccccccCCCCCCCCcccCCCCcccChHHHHHHHHHHHhccCCCCceEEEecc
Q psy7834         142 DIPEGVRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIGSG  221 (492)
Q Consensus       142 ~l~~~L~~~~l~~~~~~~a~~~v~r~~f~~~~~~~~~y~d~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDiGcG  221 (492)
                      .+.+.|+..++.++.+..++..++++.|.+.......|.+.+.+++.+..++.|.+.+.+++.+.  +.++.+|||+|||
T Consensus        10 ~~~~~l~~~gv~~~~~~~~~~~~~r~~f~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~l~--~~~~~~vLdiG~G   87 (210)
T 3lbf_A           10 ALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQPYMVARMTELLE--LTPQSRVLEIGTG   87 (210)
T ss_dssp             HHHHHHHHTTCCCHHHHHHHHHSCGGGGSCGGGGGGTTSSSCEECTTSCEECCHHHHHHHHHHTT--CCTTCEEEEECCT
T ss_pred             HHHHHHHHcCCCCHHHHHHHHhCCHHHcCCcchhhhccCCCccccCCCCEeCCHHHHHHHHHhcC--CCCCCEEEEEcCC
Confidence            45566778888999999999999999999988888899999999999999999999988888875  6789999999999


Q ss_pred             ccHHHHHHHHHhCCCCeEEEEeCCHHHHHHHHHHHHhhCCCCCCCCcEEEEEccCCCCCcCCCCccEEEecCcchhhHHH
Q psy7834         222 SGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFK  301 (492)
Q Consensus       222 ~G~~~~~la~~~~~~~~v~giD~s~~~l~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD~i~s~~~~~~~~~~  301 (492)
                      +|.++..+++.   .++|+++|+|+.+++.|++++...+     ..+++++.+|+.+.+...++||+|+++..+++++++
T Consensus        88 ~G~~~~~la~~---~~~v~~vD~~~~~~~~a~~~~~~~~-----~~~v~~~~~d~~~~~~~~~~~D~i~~~~~~~~~~~~  159 (210)
T 3lbf_A           88 SGYQTAILAHL---VQHVCSVERIKGLQWQARRRLKNLD-----LHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTA  159 (210)
T ss_dssp             TSHHHHHHHHH---SSEEEEEESCHHHHHHHHHHHHHTT-----CCSEEEEESCGGGCCGGGCCEEEEEESSBCSSCCTH
T ss_pred             CCHHHHHHHHh---CCEEEEEecCHHHHHHHHHHHHHcC-----CCceEEEECCcccCCccCCCccEEEEccchhhhhHH
Confidence            99999999988   3589999999999999999998753     357999999998766667899999999999999999


Q ss_pred             HHHHhccCCeEEEEeCCCcc
Q psy7834         302 LMDQLKPGGVMWFTIGNAEE  321 (492)
Q Consensus       302 ~~~~L~pgG~l~~~~~~~~~  321 (492)
                      +.++|||||++++.+++..+
T Consensus       160 ~~~~L~pgG~lv~~~~~~~~  179 (210)
T 3lbf_A          160 LMTQLDEGGILVLPVGEEHQ  179 (210)
T ss_dssp             HHHTEEEEEEEEEEECSSSC
T ss_pred             HHHhcccCcEEEEEEcCCce
Confidence            99999999999999876433



>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 492
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-33
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 6e-18
d1i1na_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 8e-10
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 1e-31
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-16
d1r18a_223 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 5e-08
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 7e-21
d1jg1a_215 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 1e-04
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-19
d1vbfa_224 c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransf 2e-05
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 1e-18
d2b25a1 324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 1e-09
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 2e-09
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 5e-18
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 4e-10
d1i9ga_264 c.66.1.13 (A:) Probable methyltransferase Rv2118c 1e-08
d1dl5a1213 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methylt 2e-15
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 4e-14
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 4e-08
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 7e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 2e-13
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 9e-10
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 4e-06
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 3e-12
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 3e-07
d1o54a_266 c.66.1.13 (A:) Hypothetical protein TM0748 {Thermo 4e-05
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 2e-10
d1ri5a_ 252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 2e-04
d1ri5a_252 c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf 0.003
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 1e-08
d1nkva_ 245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 2e-04
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 9e-08
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 1e-07
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 2e-05
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 1e-04
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 3e-07
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 3e-05
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 5e-05
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 4e-07
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 2e-05
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 5e-05
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 5e-07
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 4e-05
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 4e-05
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 5e-07
d1xxla_ 234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 2e-05
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 0.002
d1ve3a1226 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {A 1e-06
d1im8a_225 c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) 2e-06
d1im8a_225 c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) 8e-05
d1p91a_268 c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher 2e-06
d1p91a_268 c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher 0.002
d1zx0a1229 c.66.1.16 (A:8-236) Guanidinoacetate methyltransfe 3e-06
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 4e-06
d1vl5a_ 231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 1e-05
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 4e-04
d2p7ia1225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 7e-06
d2p7ia1 225 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 5e-04
d1jqea_280 c.66.1.19 (A:) Histamine methyltransferase {Human 7e-06
d2avna1246 c.66.1.41 (A:1-246) Hypothetical methyltransferase 9e-06
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 9e-06
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 0.002
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 0.004
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 1e-05
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 7e-05
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 3e-05
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 4e-04
d2fyta1 311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 0.002
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 3e-05
d1pjza_201 c.66.1.36 (A:) Thiopurine S-methyltransferase {Pse 0.001
d2bzga1229 c.66.1.36 (A:17-245) Thiopurine S-methyltransferas 1e-04
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 1e-04
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 2e-04
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 2e-04
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 0.002
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 2e-04
d1oria_ 316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.001
d1oria_316 c.66.1.6 (A:) Protein arginine N-methyltransferase 0.002
d1dusa_194 c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeo 5e-04
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 7e-04
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 0.001
d2nxca1254 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT 0.001
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.002
d1g6q1_328 c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba 0.003
d2oyra1250 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shi 0.002
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  124 bits (311), Expect = 2e-33
 Identities = 87/206 (42%), Positives = 117/206 (56%), Gaps = 14/206 (6%)

Query: 147 VRFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILK 206
            + G I + KV  VM + DR  + +     NPY D PQS+GF + +S+P +HA ALE+L 
Sbjct: 16  RKNGIIKTDKVFEVMLATDRSHYAK----CNPYMDSPQSIGFQATISAPHMHAYALELLF 71

Query: 207 DYLKPGAKVLDIGSGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEG 266
           D L  GAK LD+GSGSG LTAC A MVG TGKV  ++HI++LV  +  ++    P L+  
Sbjct: 72  DQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSS 131

Query: 267 GRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYPFKLMDQLKPGGVMWFTIGNAEEMLKNN 326
           GRVQ V GDGR G+A E PYD I+VG A    P  L+DQLKPGG +   +G A       
Sbjct: 132 GRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQM-- 189

Query: 327 RRTESNLAVVKAHKKDHGEWEEEFMG 352
                   + +  K   G  + + + 
Sbjct: 190 --------LEQYDKLQDGSIKMKPLM 207


>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 223 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Length = 224 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Length = 266 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 226 Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Length = 225 Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Length = 225 Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Length = 246 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Length = 201 Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 229 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 194 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Length = 254 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query492
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.95
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.93
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.93
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.91
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.91
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.86
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.83
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.82
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.79
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.78
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.77
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.77
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.75
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.74
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.74
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.73
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.7
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.7
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.68
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.67
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.65
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.65
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.64
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.64
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.64
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.63
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.62
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.61
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.61
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.61
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.61
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.6
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.6
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.6
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.59
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.59
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.59
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.59
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.58
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.58
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.58
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.56
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.54
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.53
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.53
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.53
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.52
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.51
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.51
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.49
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.46
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.45
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.45
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.43
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.42
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.41
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.4
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.39
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.37
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.37
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.36
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.36
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.35
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.35
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.34
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.34
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.33
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.33
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.33
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.32
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.3
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.29
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.29
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.28
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.28
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.28
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.28
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.27
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.27
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 99.26
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.25
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.25
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.25
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.25
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.24
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.23
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.22
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.22
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.21
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 99.21
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.2
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.2
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.19
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 99.18
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.17
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.16
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.16
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.16
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.16
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.15
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.15
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.14
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.13
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.12
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.12
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.12
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.08
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.08
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.07
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.06
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.05
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.05
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.04
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.04
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.04
d2h00a1250 Methyltransferase 10 domain containing protein MET 99.02
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.02
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.02
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.99
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.95
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.95
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.95
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.93
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.93
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.92
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.9
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.9
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.88
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.88
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.86
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.83
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.81
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.81
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.8
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.76
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.75
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.74
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.72
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.72
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.71
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.68
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.68
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 98.67
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.65
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.62
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.62
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.58
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.56
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.56
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 98.54
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.53
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.51
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.51
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.46
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.44
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.43
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.43
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.41
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.39
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.37
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.36
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.35
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.33
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 98.32
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.28
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.27
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.26
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 98.26
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.24
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 98.18
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 98.09
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.05
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 98.04
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.99
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.95
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 97.92
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.87
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.84
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.8
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.73
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.73
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.67
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.65
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.62
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 97.6
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.55
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 97.48
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.41
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.38
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.34
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.3
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.18
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.17
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.14
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.11
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 97.11
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.1
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.1
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.09
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.08
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.07
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 97.06
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.0
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.98
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 96.96
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 96.95
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 96.94
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 96.9
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 96.84
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.83
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 96.81
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.56
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.55
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.51
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.45
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.45
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.43
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.38
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.23
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.01
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.95
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.73
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.86
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.75
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 94.71
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 94.65
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.48
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 94.45
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 94.43
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.37
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.25
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.21
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.19
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.13
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 93.97
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.69
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.52
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 93.32
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.19
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 93.14
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 92.94
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 92.91
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 92.86
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 92.81
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 92.18
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 91.53
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 91.52
d1zkda1365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 91.28
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 91.26
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 90.35
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 90.05
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.99
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.71
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.66
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 89.61
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 88.55
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 88.51
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 87.97
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 87.8
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 87.47
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 87.08
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 86.89
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 86.6
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 86.12
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 85.45
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 85.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 84.83
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 84.44
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 83.77
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 83.58
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.96
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 82.67
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 82.13
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 82.06
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.01
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 81.82
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 81.17
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 80.4
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Protein-L-isoaspartyl O-methyltransferase
domain: Protein-L-isoaspartyl O-methyltransferase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=2.7e-28  Score=224.31  Aligned_cols=176  Identities=48%  Similarity=0.775  Sum_probs=156.5

Q ss_pred             cccccch-hcccccChhHHHHHHhccccccccccccCCCCCCCCcccCCCCcccChHHHHHHHHHHHhccCCCCceEEEe
Q psy7834         141 EDIPEGV-RFGHIASPKVESVMRSIDRRRFIERPIMNNPYWDIPQSLGFGSVMSSPKVHAQALEILKDYLKPGAKVLDIG  219 (492)
Q Consensus       141 ~~l~~~L-~~~~l~~~~~~~a~~~v~r~~f~~~~~~~~~y~d~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~vLDiG  219 (492)
                      .+|.+.+ +.+.+++..+.+++..+||+.|++.    .+|.|.+++++.++++++|.+.+.+++.|...+++|++|||||
T Consensus         9 ~~mv~~l~~~g~i~~~~v~~a~~~vpRe~Fvp~----~aY~D~~l~i~~~~~is~P~~~a~~le~L~~~l~~g~~VLdiG   84 (224)
T d1i1na_           9 SELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC----NPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVG   84 (224)
T ss_dssp             HHHHHHHHHTTSCCSHHHHHHHHTSCGGGTCSS----CTTSSSCEEEETTEEECCHHHHHHHHHHTTTTSCTTCEEEEET
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHhCCHHHcCCc----ccCCCCCccccchhhhhhhHHHHHHHHHHhhccCCCCeEEEec
Confidence            3566666 6666899999999999999999985    6899999999999999999999999999976689999999999


Q ss_pred             ccccHHHHHHHHHhCCCCeEEEEeCCHHHHHHHHHHHHhhCCCCCCCCcEEEEEccCCCCCcCCCCccEEEecCcchhhH
Q psy7834         220 SGSGYLTACMAHMVGPTGKVYAVEHIEDLVAQANKSMHTYYPNLMEGGRVQFVDGDGREGHAAEGPYDVIYVGGAVHHYP  299 (492)
Q Consensus       220 cG~G~~~~~la~~~~~~~~v~giD~s~~~l~~a~~~~~~~~~~~~~~~~v~~~~~d~~~~~~~~~~fD~i~s~~~~~~~~  299 (492)
                      ||+|+.|..||+.+++.++|+++|+++++++.|++++++.+.......++.++.+|+...++..++||+|++..+++++|
T Consensus        85 ~GsGy~ta~la~l~~~~g~V~~ie~~~~l~~~a~~~l~~~~~~~~~~~~~~~~~gD~~~~~~~~~~fD~I~~~~~~~~ip  164 (224)
T d1i1na_          85 SGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVP  164 (224)
T ss_dssp             CTTSHHHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHHHHCTHHHHTSSEEEEESCGGGCCGGGCCEEEEEECSBBSSCC
T ss_pred             CCCCHHHHHHHHHhCCCceEEEEcCCHHHHHHHHHhccccCcccccccceEEEEeecccccchhhhhhhhhhhcchhhcC
Confidence            99999999999999899999999999999999999998754221224579999999988888888999999999999999


Q ss_pred             HHHHHHhccCCeEEEEeCCCc
Q psy7834         300 FKLMDQLKPGGVMWFTIGNAE  320 (492)
Q Consensus       300 ~~~~~~L~pgG~l~~~~~~~~  320 (492)
                      +++.++|||||+|++.++..+
T Consensus       165 ~~l~~~LkpGG~LV~pv~~~~  185 (224)
T d1i1na_         165 QALIDQLKPGGRLILPVGPAG  185 (224)
T ss_dssp             HHHHHTEEEEEEEEEEESCTT
T ss_pred             HHHHhhcCCCcEEEEEEccCC
Confidence            999999999999999886543



>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure