Psyllid ID: psy7968


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MQTFAGEETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
ccccccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc
ccEEEEEEccccccccccccccHHHHHcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcc
mqtfageetassatfsvepvpdyhriigkpmdfgtikhKLNMFqyrnnsevlfdcnlvfdncfaynkedseiyeptikLNTFLSCLCHLCT
mqtfageetassatfsvepvpDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
MQTFAGEETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
******************PVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLC*
******EETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
*************TFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
*QTF**EETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTFAGEETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSCLCHLCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q8WZM0464 Histone acetyltransferase yes N/A 0.725 0.142 0.393 8e-10
Q9UIF82168 Bromodomain adjacent to z yes N/A 0.582 0.024 0.509 1e-09
Q9DE132130 Bromodomain adjacent to z yes N/A 0.582 0.024 0.509 2e-09
Q8K2F0 726 Bromodomain-containing pr no N/A 0.582 0.073 0.490 5e-09
Q15059 726 Bromodomain-containing pr no N/A 0.582 0.073 0.490 5e-09
Q6MGA9 798 Bromodomain-containing pr no N/A 0.582 0.066 0.490 5e-09
Q7JJ13 798 Bromodomain-containing pr no N/A 0.582 0.066 0.490 5e-09
P25440 801 Bromodomain-containing pr no N/A 0.582 0.066 0.490 5e-09
Q5TJG6 803 Bromodomain-containing pr no N/A 0.582 0.066 0.490 5e-09
Q32S26 803 Bromodomain-containing pr no N/A 0.582 0.066 0.490 5e-09
>sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 Back     alignment and function desciption
 Score = 62.4 bits (150), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 26/66 (39%), Positives = 40/66 (60%)

Query: 18  EPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTI 77
           + VPDY+ +I +PMD  T++ +L    Y+   E ++D  LVF+NC AYN E +  Y+   
Sbjct: 384 DEVPDYYEVIKEPMDLSTMEQRLEADSYKTMEEFVYDARLVFNNCRAYNNETTTYYKNAN 443

Query: 78  KLNTFL 83
           KL  F+
Sbjct: 444 KLEKFM 449




Acetylates histone H2B to form H2BK11ac and H2BK16ac, histone H3 to form H3K14ac, with a lower preference histone H4 to form H4K8ac and H4K16ac, and contributes to H2A.Z acetylation. Acetylation of histones gives a specific tag for epigenetic transcription activation.
Yarrowia lipolytica (strain CLIB 122 / E 150) (taxid: 284591)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 Back     alignment and function description
>sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 Back     alignment and function description
>sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 Back     alignment and function description
>sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 Back     alignment and function description
>sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=2 SV=1 Back     alignment and function description
>sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 Back     alignment and function description
>sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 Back     alignment and function description
>sp|Q5TJG6|BRD2_CANFA Bromodomain-containing protein 2 OS=Canis familiaris GN=BRD2 PE=3 SV=1 Back     alignment and function description
>sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
195055941 1592 GH13739 [Drosophila grimshawi] gi|193892 0.747 0.042 0.544 2e-12
328719118 1312 PREDICTED: bromodomain adjacent to zinc 0.769 0.053 0.471 2e-12
328719116 1273 PREDICTED: bromodomain adjacent to zinc 0.769 0.054 0.471 2e-12
195110751 1494 GI24812 [Drosophila mojavensis] gi|19391 0.747 0.045 0.529 5e-12
383863769 1448 PREDICTED: bromodomain adjacent to zinc 0.615 0.038 0.589 8e-12
194740838 1510 GF17489 [Drosophila ananassae] gi|190625 0.747 0.045 0.529 1e-11
380025897 1447 PREDICTED: LOW QUALITY PROTEIN: bromodom 0.615 0.038 0.571 2e-11
328788377 1449 PREDICTED: bromodomain adjacent to zinc 0.615 0.038 0.571 2e-11
340714618 1454 PREDICTED: bromodomain adjacent to zinc 0.615 0.038 0.571 2e-11
350410937 1454 PREDICTED: bromodomain adjacent to zinc 0.615 0.038 0.571 2e-11
>gi|195055941|ref|XP_001994871.1| GH13739 [Drosophila grimshawi] gi|193892634|gb|EDV91500.1| GH13739 [Drosophila grimshawi] Back     alignment and taxonomy information
 Score = 76.6 bits (187), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%)

Query: 20   VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKL 79
            VPDYH+II  PMD   IK KLNM QY+ N EVL D  LVF NC  YN E +EIY+   +L
Sbjct: 1506 VPDYHKIIKTPMDLAKIKSKLNMGQYQINEEVLSDIQLVFKNCDLYNVEGNEIYDAGSEL 1565

Query: 80   NTFLSCLC 87
              F+   C
Sbjct: 1566 ERFVMSRC 1573




Source: Drosophila grimshawi

Species: Drosophila grimshawi

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328719118|ref|XP_003246668.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328719116|ref|XP_001943234.2| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195110751|ref|XP_001999943.1| GI24812 [Drosophila mojavensis] gi|193916537|gb|EDW15404.1| GI24812 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|383863769|ref|XP_003707352.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|194740838|ref|XP_001952897.1| GF17489 [Drosophila ananassae] gi|190625956|gb|EDV41480.1| GF17489 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|380025897|ref|XP_003696700.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain adjacent to zinc finger domain protein 1A-like [Apis florea] Back     alignment and taxonomy information
>gi|328788377|ref|XP_395223.4| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A [Apis mellifera] Back     alignment and taxonomy information
>gi|340714618|ref|XP_003395823.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350410937|ref|XP_003489182.1| PREDICTED: bromodomain adjacent to zinc finger domain protein 1A-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
FB|FBgn00276201476 Acf1 "ATP-dependent chromatin 0.747 0.046 0.514 3.4e-11
UNIPROTKB|F1MG251456 BAZ2B "Uncharacterized protein 0.582 0.036 0.509 4.3e-09
FB|FBgn0039124 513 tbrd-1 "testis-specifically ex 0.604 0.107 0.472 6.3e-09
UNIPROTKB|F1MCP32110 BAZ2B "Uncharacterized protein 0.582 0.025 0.509 9.7e-09
POMBASE|SPCC1450.02 578 bdf1 "Swr1 complex bromodomain 0.725 0.114 0.416 9.8e-09
UNIPROTKB|E1BNJ52169 BAZ2B "Uncharacterized protein 0.582 0.024 0.509 1e-08
TAIR|locus:2044722 386 IMB1 "AT2G34900" [Arabidopsis 0.571 0.134 0.461 1.7e-08
CGD|CAL0001703449 GCN5 [Candida albicans (taxid: 0.736 0.149 0.402 2.3e-08
UNIPROTKB|Q59PZ5449 GCN5 "Likely histone acetyltra 0.736 0.149 0.402 2.3e-08
UNIPROTKB|Q9UIF82168 BAZ2B "Bromodomain adjacent to 0.582 0.024 0.509 2.4e-08
FB|FBgn0027620 Acf1 "ATP-dependent chromatin assembly factor large subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 3.4e-11, P = 3.4e-11
 Identities = 35/68 (51%), Positives = 42/68 (61%)

Query:    20 VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKL 79
             VPDYH+II  PMD   IK KLNM  Y+ N E+L D  LVF NC  YN E +EIY+   +L
Sbjct:  1390 VPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVFRNCDLYNVEGNEIYDAGCQL 1449

Query:    80 NTFLSCLC 87
               F+   C
Sbjct:  1450 ERFVIDRC 1457




GO:0006355 "regulation of transcription, DNA-dependent" evidence=IDA
GO:0016584 "nucleosome positioning" evidence=IDA
GO:0016590 "ACF complex" evidence=IDA;IPI
GO:0006334 "nucleosome assembly" evidence=IDA
GO:0006333 "chromatin assembly or disassembly" evidence=NAS;TAS
GO:0004402 "histone acetyltransferase activity" evidence=IDA
GO:0016589 "NURF complex" evidence=IDA
GO:0008623 "CHRAC" evidence=IDA;NAS
GO:0042766 "nucleosome mobilization" evidence=IDA;TAS
GO:0003677 "DNA binding" evidence=IDA;TAS
GO:0031497 "chromatin assembly" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0043462 "regulation of ATPase activity" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0048666 "neuron development" evidence=IMP
GO:0008544 "epidermis development" evidence=IMP
GO:0007517 "muscle organ development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
UNIPROTKB|F1MG25 BAZ2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0039124 tbrd-1 "testis-specifically expressed bromodomain containing protein-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCP3 BAZ2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
POMBASE|SPCC1450.02 bdf1 "Swr1 complex bromodomain subunit Brf1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNJ5 BAZ2B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2044722 IMB1 "AT2G34900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0001703 GCN5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59PZ5 GCN5 "Likely histone acetyltransferase Gcn5" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UIF8 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DE13BAZ2B_CHICKNo assigned EC number0.50940.58240.0248yesN/A
Q9UIF8BAZ2B_HUMANNo assigned EC number0.50940.58240.0244yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 2e-25
smart00297107 smart00297, BROMO, bromo domain 5e-20
cd0436999 cd04369, Bromodomain, Bromodomain 9e-20
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 1e-16
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 2e-16
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 7e-16
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 9e-16
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-15
pfam0043984 pfam00439, Bromodomain, Bromodomain 3e-15
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 8e-15
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 1e-14
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 2e-14
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 4e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-13
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 2e-13
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 3e-13
COG5076 371 COG5076, COG5076, Transcription factor involved in 4e-13
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 4e-13
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-12
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 4e-12
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 6e-11
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 6e-10
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 8e-10
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 2e-09
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 2e-08
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 6e-08
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 8e-08
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 7e-07
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 7e-07
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 1e-06
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 1e-04
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
 Score = 90.5 bits (225), Expect = 2e-25
 Identities = 34/64 (53%), Positives = 41/64 (64%)

Query: 20  VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKL 79
           VPDY+ II KPMD GTIK KLNM +Y+   E L D  LVF NCF YN E + +Y+   +L
Sbjct: 42  VPDYYDIIKKPMDLGTIKEKLNMGEYKLAEEFLSDIQLVFSNCFLYNPEHTSVYKAGTRL 101

Query: 80  NTFL 83
             F 
Sbjct: 102 QRFF 105


Bromo adjacent to zinc finger 1A (BAZ1A) was identified as a novel human bromodomain gene by cDNA library screening. The Drosophila homologue, Acf1, is part of the CHRAC (chromatin accessibility complex) and regulates ISWI-induced nucleosome remodeling. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 115

>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 100.0
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.98
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.98
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.97
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.97
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.97
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.97
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.97
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.97
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.97
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.97
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.97
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.97
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.97
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.97
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.97
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.97
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.97
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.96
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.96
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.96
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.96
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.96
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.96
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.96
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.96
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.96
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.96
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.96
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.96
KOG1474|consensus 640 99.95
smart00297107 BROMO bromo domain. 99.95
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.95
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.94
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.94
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.93
COG5076 371 Transcription factor involved in chromatin remodel 99.89
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.88
KOG1245|consensus1404 99.85
KOG1472|consensus720 99.71
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.56
KOG0955|consensus 1051 99.39
KOG1827|consensus 629 99.38
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.37
KOG0008|consensus1563 99.36
KOG1472|consensus 720 99.27
KOG0386|consensus1157 99.26
KOG0008|consensus 1563 99.19
KOG1828|consensus 418 98.78
KOG1474|consensus 640 98.68
KOG1828|consensus 418 98.41
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 98.09
COG5076371 Transcription factor involved in chromatin remodel 98.05
KOG0644|consensus1113 97.54
KOG0732|consensus 1080 94.92
KOG0644|consensus 1113 91.43
TIGR0260669 antidote_CC2985 putative addiction module antidote 90.99
PF14372101 DUF4413: Domain of unknown function (DUF4413) 89.61
PF0369380 RHH_2: Uncharacterised protein family (UPF0156); I 87.01
KOG1827|consensus 629 85.57
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
Probab=100.00  E-value=1.5e-32  Score=164.75  Aligned_cols=85  Identities=31%  Similarity=0.468  Sum_probs=81.4

Q ss_pred             CCCCCcCCCCCCCC--CCcchhhhcCCcCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhcCCCCHHHHHHHHHHHH
Q psy7968           5 AGEETASSATFSVE--PVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTF   82 (91)
Q Consensus         5 ~~~~~~F~~pv~~~--~~p~Y~~~I~~PmdL~~I~~rl~~~~Y~s~~~f~~D~~li~~Na~~yn~~~s~~~~~a~~l~~~   82 (91)
                      ...+.||..||++.  ++|||+++|++||||++|++||++|.|.++++|.+||++||.||..||+++|.++.+|..|++.
T Consensus        20 ~~~s~~F~~PVd~~~~~~pdY~~iIk~PmDL~tI~~kL~~~~Y~s~~ef~~D~~li~~Na~~yN~~~s~i~~~A~~l~~~   99 (107)
T cd05497          20 HKFAWPFQQPVDAVKLNLPDYHKIIKTPMDLGTIKKRLENNYYWSASECIQDFNTMFTNCYIYNKPGDDVVLMAQTLEKL   99 (107)
T ss_pred             CCcCccccCCCCcccccCCcHHHHHcCcccHHHHHHHHcCCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Confidence            35789999999976  7999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhh
Q psy7968          83 LSCLCHL   89 (91)
Q Consensus        83 fe~~~~~   89 (91)
                      |++.++.
T Consensus       100 f~~~l~~  106 (107)
T cd05497         100 FLQKLAQ  106 (107)
T ss_pred             HHHHHHc
Confidence            9999874



Human Brdt is a testis-specific member of the BET subfamily of bromodomain proteins; the first bromodomain in Brdt has been shown to be essential for male germ cell differentiation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.

>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>TIGR02606 antidote_CC2985 putative addiction module antidote protein, CC2985 family Back     alignment and domain information
>PF14372 DUF4413: Domain of unknown function (DUF4413) Back     alignment and domain information
>PF03693 RHH_2: Uncharacterised protein family (UPF0156); InterPro: IPR022789 This family of proteins are about 80 amino acids in length and their function is unknown Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-10
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 4e-10
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 3e-09
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-09
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 4e-09
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 4e-09
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 4e-09
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 2e-08
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-08
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-08
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 2e-08
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 2e-08
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 3e-08
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 4e-08
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 4e-08
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 5e-08
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 5e-08
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 6e-08
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 6e-08
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 6e-08
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 9e-08
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 9e-08
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 9e-08
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 1e-07
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 1e-07
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 1e-07
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 2e-07
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 2e-07
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 3e-07
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 3e-07
2e7n_A117 Solution Structure Of The Second Bromodomain From H 3e-07
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 4e-07
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 5e-07
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-07
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 6e-07
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 6e-07
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 8e-07
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 1e-06
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 2e-06
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 2e-06
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 4e-06
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 4e-06
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 4e-06
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 5e-06
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 5e-06
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 6e-06
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 6e-06
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 7e-06
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 7e-06
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 7e-06
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 8e-06
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 9e-06
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 2e-05
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 3e-05
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 4e-05
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 1e-04
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 1e-04
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 4e-04
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 4e-04
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 4e-04
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 4e-04
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 4e-04
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 6e-04
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 6e-04
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 7e-04
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 7e-04
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 7e-04
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 8e-04
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 9e-04
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 27/53 (50%), Positives = 35/53 (66%) Query: 20 VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEI 72 VP Y ++I KPMDF TI+ KL+ QY N D LVFDNC +N++DS+I Sbjct: 43 VPGYKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDI 95
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-24
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-24
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 4e-24
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 6e-24
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 7e-24
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 8e-24
3nxb_A116 CAT eye syndrome critical region protein 2; struct 8e-24
2d9e_A121 Peregrin; four-helix bundle, transcription activat 8e-24
3d7c_A112 General control of amino acid synthesis protein 5; 1e-23
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 1e-23
3p1f_A119 CREB-binding protein; structural genomics consorti 2e-23
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 2e-23
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-23
3rcw_A135 Bromodomain-containing protein 1; transcription, s 5e-23
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 8e-23
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-22
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 2e-22
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-22
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 2e-22
2grc_A129 Probable global transcription activator SNF2L4; br 3e-22
3uv4_A158 Second bromodomain of human transcription initiat 4e-22
3aad_A292 Transcription initiation factor TFIID subunit 1; p 4e-22
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 2e-18
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 4e-22
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 2e-18
2dat_A123 Possible global transcription activator SNF2L2; br 4e-22
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 4e-22
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 5e-22
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-22
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 1e-21
2r10_A361 Chromatin structure-remodeling complex protein RSC 1e-21
2r10_A 361 Chromatin structure-remodeling complex protein RSC 7e-17
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-21
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 2e-17
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-21
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 7e-21
3dai_A130 ATPase family AAA domain-containing protein 2; anc 1e-19
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 7e-19
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-16
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 5e-13
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 5e-09
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 9e-07
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
 Score = 89.9 bits (223), Expect = 1e-24
 Identities = 25/63 (39%), Positives = 33/63 (52%)

Query: 20  VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKL 79
            PDY+ +I  PM F  IK KL   QY   SE + D  L+FDNC  YN  +S +      +
Sbjct: 53  CPDYYDVIKNPMSFSCIKTKLKKGQYAYPSEFVKDVQLIFDNCSLYNTSNSVVAITGKNI 112

Query: 80  NTF 82
            T+
Sbjct: 113 ETY 115


>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3d7c_A112 General control of amino acid synthesis protein 5; 100.0
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 100.0
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 100.0
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 100.0
2dat_A123 Possible global transcription activator SNF2L2; br 100.0
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 100.0
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.98
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.98
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.98
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.98
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.98
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.98
2grc_A129 Probable global transcription activator SNF2L4; br 99.98
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.98
3p1f_A119 CREB-binding protein; structural genomics consorti 99.98
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.97
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.97
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.97
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.97
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.97
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.97
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.97
3uv4_A158 Second bromodomain of human transcription initiat 99.97
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.97
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.97
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.97
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.97
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.96
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.96
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.96
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.96
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.95
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 99.95
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.95
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.95
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 99.94
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.94
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.94
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 99.92
2r10_A 361 Chromatin structure-remodeling complex protein RSC 99.92
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.72
3kxe_C88 Antitoxin protein PARD-1; complex, TA system, prot 80.22
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
Probab=100.00  E-value=1.1e-32  Score=165.63  Aligned_cols=85  Identities=24%  Similarity=0.288  Sum_probs=82.1

Q ss_pred             CCCCcCCCCCCCCCCcchhhhcCCcCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhcCCCCHHHHHHHHHHHHHHH
Q psy7968           6 GEETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSC   85 (91)
Q Consensus         6 ~~~~~F~~pv~~~~~p~Y~~~I~~PmdL~~I~~rl~~~~Y~s~~~f~~D~~li~~Na~~yn~~~s~~~~~a~~l~~~fe~   85 (91)
                      ..+.||..||++..+|+|+++|++||||+||++||++|.|.++++|.+||++||+||+.||+++|.++.+|..|++.|++
T Consensus        23 ~~~~~F~~pvd~~~~pdY~~iIk~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~~s~~~~~A~~L~~~f~~  102 (112)
T 3d7c_A           23 PSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYF  102 (112)
T ss_dssp             GGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHH
T ss_pred             CCchhhcCCCCcccccCHHHHccCCcCHHHHHHHHcCCCCcCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhhhc
Q psy7968          86 LCHLC   90 (91)
Q Consensus        86 ~~~~~   90 (91)
                      .|+..
T Consensus       103 ~~~~~  107 (112)
T 3d7c_A          103 KLKEG  107 (112)
T ss_dssp             HHHHT
T ss_pred             HHHHC
Confidence            99853



>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kxe_C Antitoxin protein PARD-1; complex, TA system, protein binding; 2.60A {Caulobacter crescentus NA1000} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 3e-17
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 5e-17
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-16
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 4e-16
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 1e-15
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 2e-15
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: CREB-binding protein, CBP
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.1 bits (166), Expect = 3e-17
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 20  VPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKL 79
           +PDY  I+  PMD  TIK KL+  QY+   + + D  L+F+N + YN++ S +Y+   KL
Sbjct: 39  IPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKL 98

Query: 80  NTFL 83
               
Sbjct: 99  AEVF 102


>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 100.0
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.98
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.97
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.97
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.97
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7e-33  Score=162.70  Aligned_cols=84  Identities=24%  Similarity=0.299  Sum_probs=81.2

Q ss_pred             CCCCcCCCCCCCCCCcchhhhcCCcCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhcCCCCHHHHHHHHHHHHHHH
Q psy7968           6 GEETASSATFSVEPVPDYHRIIGKPMDFGTIKHKLNMFQYRNNSEVLFDCNLVFDNCFAYNKEDSEIYEPTIKLNTFLSC   85 (91)
Q Consensus         6 ~~~~~F~~pv~~~~~p~Y~~~I~~PmdL~~I~~rl~~~~Y~s~~~f~~D~~li~~Na~~yn~~~s~~~~~a~~l~~~fe~   85 (91)
                      ..+.||..||++.++|+|+++|++||||++|++||++|.|.|+++|.+||++||.||..||+++|.++.+|..|++.|++
T Consensus        18 ~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~~A~~l~~~f~~   97 (102)
T d3d7ca1          18 PSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYF   97 (102)
T ss_dssp             GGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHH
T ss_pred             CCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH
Confidence            45889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhhh
Q psy7968          86 LCHL   89 (91)
Q Consensus        86 ~~~~   89 (91)
                      .++.
T Consensus        98 ~~ke  101 (102)
T d3d7ca1          98 KLKE  101 (102)
T ss_dssp             HHHH
T ss_pred             HHhc
Confidence            9874



>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure