Psyllid ID: psy7974

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MKSIRALPVSVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGNNNNKYSNFNSNEDSYRSDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHSTS
cccEEEEEHHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccc
cccEEEEEHHHHHHHEHHEccccccccccccHHHHHHHHHHHHcccccccccccccccccEcccEcEcccccccEccccccccccccccHHHHHHHHHHHccccEEccccEEccEcccccEcEccHHcccccccc
mksiralpVSVLLIFVFISsvrgfdqsyyknaynhnkynylkgnnnnkysnfnsnedsyrsdksdlifpgtkwcgagdiatdyndlgtnvetdkccrdhdhcsEYILAKSslhgldtfsglalfpawlgfehsts
mksiralpvsVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGNNNNKYSNFNSNEDSYRSDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHSTS
MKSIRALPVSVLLIFVFISSVRGFDQSyyknaynhnkynylkgnnnnkysnfnsnEDSYRSDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHSTS
*****ALPVSVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGN********************DLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGF*****
****R**PVSVLLIFVFISSVRGFDQSYYKNA*********************************LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHS**
MKSIRALPVSVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGNNNNKYSNFNSNEDSYRSDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHSTS
*KSIRALPVSVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGNN***************SDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFE****
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSIRALPVSVLLIFVFISSVRGFDQSYYKNAYNHNKYNYLKGNNNNKYSNFNSNEDSYRSDKSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLGFEHSTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
P80003142 Acidic phospholipase A2 P N/A N/A 0.370 0.352 0.58 3e-12
P16354143 Phospholipase A2 isozymes N/A N/A 0.392 0.370 0.547 5e-12
P0436239 Phospholipase A2 (Fragmen N/A N/A 0.274 0.948 0.675 5e-10
P82971136 Phospholipase A2 OS=Bombu no N/A 0.370 0.367 0.56 1e-09
Q7M4I6136 Phospholipase A2 OS=Megab N/A N/A 0.370 0.367 0.56 1e-09
Q6PXP0157 Phospholipase A2 phaiodac N/A N/A 0.362 0.312 0.549 6e-09
Q9BMK4134 Phospholipase A2 OS=Apis N/A N/A 0.370 0.373 0.48 4e-08
Q7M4I5134 Phospholipase A2 OS=Apis N/A N/A 0.370 0.373 0.46 7e-08
P0C8L9239 Phospholipase A2 OS=Hadru N/A N/A 0.385 0.217 0.490 1e-07
P00630167 Phospholipase A2 OS=Apis no N/A 0.370 0.299 0.48 2e-07
>sp|P80003|PA2A2_HELSU Acidic phospholipase A2 PA4 OS=Heloderma suspectum PE=1 SV=2 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%)

Query: 66  LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
            I PGT WCGAG+ A+DY+ LGT  +TD CCRDHDHCS+ + A    HG+
Sbjct: 3   FIMPGTLWCGAGNAASDYSQLGTEKDTDMCCRDHDHCSDTMAALEYKHGM 52
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Heloderma suspectum (taxid: 8554)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 4
>sp|P16354|PA23_HELSU Phospholipase A2 isozymes PA3A/PA3B/PA5 OS=Heloderma suspectum PE=1 SV=3 Back     alignment and function description
>sp|P04362|PA2_HELHO Phospholipase A2 (Fragment) OS=Heloderma horridum horridum PE=1 SV=1 Back     alignment and function description
>sp|P82971|PA2_BOMTE Phospholipase A2 OS=Bombus terrestris PE=1 SV=1 Back     alignment and function description
>sp|Q7M4I6|PA2_MEGPE Phospholipase A2 OS=Megabombus pennsylvanicus PE=1 SV=1 Back     alignment and function description
>sp|Q6PXP0|PA2_ANUPH Phospholipase A2 phaiodactylipin OS=Anuroctonus phaiodactylus PE=1 SV=2 Back     alignment and function description
>sp|Q9BMK4|PA2_APICC Phospholipase A2 OS=Apis cerana cerana PE=2 SV=1 Back     alignment and function description
>sp|Q7M4I5|PA2_APIDO Phospholipase A2 OS=Apis dorsata PE=1 SV=1 Back     alignment and function description
>sp|P0C8L9|PA2_HADGE Phospholipase A2 OS=Hadrurus gertschi PE=2 SV=1 Back     alignment and function description
>sp|P00630|PA2_APIME Phospholipase A2 OS=Apis mellifera PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
241779329 416 phospholipase A2 precursor, putative [Ix 0.392 0.127 0.641 3e-13
195025539172 GH20736 [Drosophila grimshawi] gi|193902 0.437 0.343 0.548 1e-12
442760795 413 Putative phospholipase, partial [Ixodes 0.392 0.128 0.622 2e-12
195382147187 GJ21785 [Drosophila virilis] gi|19414458 0.385 0.278 0.615 4e-12
110761217 261 PREDICTED: hypothetical protein LOC40930 0.829 0.429 0.376 5e-12
195025532189 GH21166 [Drosophila grimshawi] gi|193902 0.385 0.275 0.615 6e-12
195431172188 GK21320 [Drosophila willistoni] gi|19415 0.4 0.287 0.574 9e-12
241654403 280 phospholipase A2 precursor, putative [Ix 0.392 0.189 0.603 1e-11
195149327186 GL11167 [Drosophila persimilis] gi|19845 0.4 0.290 0.574 1e-11
195431170157 GK22012 [Drosophila willistoni] gi|19415 0.437 0.375 0.548 1e-11
>gi|241779329|ref|XP_002399895.1| phospholipase A2 precursor, putative [Ixodes scapularis] gi|215508544|gb|EEC17998.1| phospholipase A2 precursor, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 39/53 (73%)

Query: 63  KSDLIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
           KS  IFPGTKWCGAGD+A +Y+DLG N  TD CCR+HDH  E I A  S HG+
Sbjct: 170 KSLFIFPGTKWCGAGDVAKNYDDLGVNKATDMCCREHDHSGESIEALKSKHGI 222

Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195025539|ref|XP_001986078.1| GH20736 [Drosophila grimshawi] gi|193902078|gb|EDW00945.1| GH20736 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|442760795|gb|JAA72556.1| Putative phospholipase, partial [Ixodes ricinus] Back     alignment and taxonomy information
>gi|195382147|ref|XP_002049792.1| GJ21785 [Drosophila virilis] gi|194144589|gb|EDW60985.1| GJ21785 [Drosophila virilis] Back     alignment and taxonomy information
>gi|110761217|ref|XP_392825.3| PREDICTED: hypothetical protein LOC409307 [Apis mellifera] Back     alignment and taxonomy information
>gi|195025532|ref|XP_001986077.1| GH21166 [Drosophila grimshawi] gi|193902077|gb|EDW00944.1| GH21166 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195431172|ref|XP_002063622.1| GK21320 [Drosophila willistoni] gi|194159707|gb|EDW74608.1| GK21320 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|241654403|ref|XP_002411323.1| phospholipase A2 precursor, putative [Ixodes scapularis] gi|215503953|gb|EEC13447.1| phospholipase A2 precursor, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|195149327|ref|XP_002015609.1| GL11167 [Drosophila persimilis] gi|198456043|ref|XP_001360214.2| GA10773 [Drosophila pseudoobscura pseudoobscura] gi|194109456|gb|EDW31499.1| GL11167 [Drosophila persimilis] gi|198135498|gb|EAL24788.2| GA10773 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195431170|ref|XP_002063621.1| GK22012 [Drosophila willistoni] gi|194159706|gb|EDW74607.1| GK22012 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
FB|FBgn0033170186 sPLA2 "secretory Phospholipase 0.362 0.263 0.612 7.9e-14
FB|FBgn0029720 364 CG3009 [Drosophila melanogaste 0.362 0.134 0.489 1.5e-11
UNIPROTKB|Q6PXP0157 Q6PXP0 "Phospholipase A2 phaio 0.392 0.337 0.535 1.7e-11
FB|FBgn0050503173 CG30503 [Drosophila melanogast 0.348 0.271 0.574 3.5e-11
ZFIN|ZDB-GENE-051113-96 528 zgc:123275 "zgc:123275" [Danio 0.407 0.104 0.535 9.8e-11
FB|FBgn0030013272 GIIIspla2 [Drosophila melanoga 0.414 0.205 0.5 5.5e-10
FB|FBgn0250862363 CG42237 [Drosophila melanogast 0.362 0.134 0.530 9.5e-10
UNIPROTKB|P00630167 P00630 "Phospholipase A2" [Api 0.370 0.299 0.48 2.2e-09
UNIPROTKB|P8678039 P86780 "Phospholipase A2" [Bun 0.266 0.923 0.583 8.7e-08
UNIPROTKB|Q9NZ20 509 PLA2G3 "Group 3 secretory phos 0.444 0.117 0.35 2.4e-06
FB|FBgn0033170 sPLA2 "secretory Phospholipase A2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 179 (68.1 bits), Expect = 7.9e-14, P = 7.9e-14
 Identities = 30/49 (61%), Positives = 35/49 (71%)

Query:    69 PGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDT 117
             PGTKWCG G+ A ++ DLG   ETDKCCR HDHC E I +  +LHGL T
Sbjct:    46 PGTKWCGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPT 94
GO:0004623 "phospholipase A2 activity" evidence=ISS;NAS
GO:0047498 "calcium-dependent phospholipase A2 activity" evidence=IDA
GO:0006644 "phospholipid metabolic process" evidence=IEA
GO:0016042 "lipid catabolic process" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
FB|FBgn0029720 CG3009 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PXP0 Q6PXP0 "Phospholipase A2 phaiodactylipin" [Anuroctonus phaiodactylus (taxid:246982)] Back     alignment and assigned GO terms
FB|FBgn0050503 CG30503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-96 zgc:123275 "zgc:123275" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030013 GIIIspla2 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0250862 CG42237 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P00630 P00630 "Phospholipase A2" [Apis mellifera (taxid:7460)] Back     alignment and assigned GO terms
UNIPROTKB|P86780 P86780 "Phospholipase A2" [Bunodosoma caissarum (taxid:31165)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZ20 PLA2G3 "Group 3 secretory phospholipase A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691
3rd Layer3.1.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd0470497 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: 6e-25
pfam0582699 pfam05826, Phospholip_A2_2, Phospholipase A2 1e-22
cd0061883 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a 4e-08
smart00085117 smart00085, PA2c, Phospholipase A2 8e-04
>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information 
 Score = 90.8 bits (226), Expect = 6e-25
 Identities = 31/50 (62%), Positives = 37/50 (74%)

Query: 66  LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
            I PGTKWCG G+IAT+Y+DLG   ETDKCCR+HDHC + I A    +GL
Sbjct: 1   FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGL 50

PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s. Length = 97
>gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 Back     alignment and domain information
>gnl|CDD|153092 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>gnl|CDD|214508 smart00085, PA2c, Phospholipase A2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
cd0470497 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam 99.96
PF0582699 Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 99.96
cd04705100 PLA2_group_III_like PLA2_group_III_like: A sub-fam 99.5
cd0061883 PLA2_like PLA2_like: Phospholipase A2, a super-fam 99.38
smart00085117 PA2c Phospholipase A2. 98.78
cd04706117 PLA2_plant PLA2_plant: Plant-specific sub-family o 97.79
cd00125115 PLA2c PLA2c: Phospholipase A2, a family of secreto 96.87
cd04707117 otoconin_90 otoconin_90: Phospholipase A2-like dom 96.83
PF0839864 Parvo_coat_N: Parvovirus coat protein VP1; InterPr 95.83
KOG4087|consensus144 94.48
PF00068116 Phospholip_A2_1: Phospholipase A2; InterPro: IPR00 92.56
>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information 
Probab=99.96  E-value=1e-30  Score=189.36  Aligned_cols=63  Identities=49%  Similarity=0.872  Sum_probs=61.3

Q ss_pred             eeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccceeCCCCCccceecc
Q psy7974          66 LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWL  128 (135)
Q Consensus        66 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~  128 (135)
                      ||+|||||||+||+|.+|+|||.+.+||+|||+||+||++|+++++|||++|.+|+|+.-|.|
T Consensus         1 ~~~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCr~HD~C~~~i~~~~~kyg~~N~~~~t~~~C~C   63 (97)
T cd04704           1 FIVPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCDC   63 (97)
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchHHHccccCcCcccccccccCccCCCccccccCcH
Confidence            589999999999999999999999999999999999999999999999999999999998876

PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s.
>PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>smart00085 PA2c Phospholipase A2 Back     alignment and domain information
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia Back     alignment and domain information
>PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>KOG4087|consensus Back     alignment and domain information
>PF00068 Phospholip_A2_1: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1poc_A134 Crystal Structure Of Bee-venom Phospholipase A2 In 2e-08
>pdb|1POC|A Chain A, Crystal Structure Of Bee-venom Phospholipase A2 In A Complex With A Transition-state Analogue Length = 134 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)
Query: 66  LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
           +I+PGT WCG G+ ++  N+LG    TD CCR HD C + + A  S HGL
Sbjct: 1   IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGL 50

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 2e-20
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 Back     alignment and structure
 Score = 80.1 bits (197), Expect = 2e-20
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 66  LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
           +I+PGT WCG G+ ++  N+LG    TD CCR HD C + + A  S HGL
Sbjct: 1   IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGL 50

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 99.95
2wg7_A130 PLA2, putative phospholipase A2; hydrolase, secret 96.95
1gp7_A151 Phospholipase A2; snake venom, KING cobra, cardiot 95.74
1bk9_A124 Phospholipase A2; hydrolase, platelet aggregation 95.73
1p7o_A124 Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 95.68
3jql_A119 Phospholipase A2 isoform 3; phospholipase A2, hexa 95.65
1g4i_A123 Phospholipase A2; lipid degradation, hydrolase; 0. 95.65
3u8i_A124 Phospholipase A2, membrane associated; secreted ph 95.63
4h0s_A137 Svpla2 homolog, basic phospholipase A2 homolog CTS 95.62
2aoz_A121 Myotoxin II, phospholipase A2 homolog; X-RAY diffr 95.61
4h0q_A121 Phospholipase A2, acid 5; alpha-helix, glycerophos 95.52
1jlt_A122 Phospholipase A2 inhibitor; heterodimer complex, h 95.51
3r0l_D122 Phospholipase A2 CB; crotoxin, presynaptic neuroto 95.5
2g58_A121 Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d 95.49
4hg9_A122 Basic phospholipase A2 B; alpha-helix, glycerophos 95.48
3dih_A122 Phospholipase A2 homolog, ammodytin L; phospholipa 95.44
1zlb_A122 Hypotensive phospholipase A2; Asp49-PLA2, toxin, s 95.43
1m8t_A119 Phospholipase A2; twinned crystal, alpha, beta, hy 95.41
1bun_A120 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 95.4
2qhd_A122 Phospholipase A2; beta sheet, three helices, prote 95.39
2h4c_B122 Phospholipase A2-II; non-inhibitor acidic PLA2, ba 95.35
1g0z_A118 Phospholipase A2; toxin; 2.18A {Bungarus caeruleus 95.34
4e4c_A119 Phospholipase A2; hydrolase; HET: MES; 1.80A {Note 95.32
1mc2_A122 Acutohaemonlysin, phospholipase A2; YS49-phospholi 95.27
3vbz_A118 Phospholipase A2 homolog, taipoxin beta chain; pho 95.27
1jlt_B122 Phospholipase A2, vipoxin; heterodimer complex, hy 95.25
1gmz_A122 Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot 95.22
1oz6_A120 Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { 95.18
1vip_A121 Phospholipase A2; hydrolase, anticoagulant; 2.20A 95.15
1le6_A123 Group X secretory phospholipase A2; human phosphat 94.99
3ntt_A 724 Capsid protein; gene therapy vector, cystic fibros 92.32
3ng9_A 736 Capsid protein; beta barrel, single-stranded DNA V 82.72
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Back     alignment and structure
Probab=99.95  E-value=1.4e-29  Score=191.52  Aligned_cols=63  Identities=38%  Similarity=0.769  Sum_probs=60.9

Q ss_pred             eeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccceeCCCCCccceecc
Q psy7974          66 LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWL  128 (135)
Q Consensus        66 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~  128 (135)
                      ||+|||||||+||+|.+|+|||.+.+||+|||+||+||++|++++++|||+|.+++|+.-|-|
T Consensus         1 ~i~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~~~gl~N~~~~t~shC~C   63 (134)
T 1poc_A            1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDC   63 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHH
T ss_pred             CcCCCCcccCCCCCCCCcccccCcchHhHHHhccccCcccccCccccCCeeCCCccccccCcH
Confidence            699999999999999999999999999999999999999999999999999999999988765
>2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A Back     alignment and structure
>1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R Back     alignment and structure
>1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A Back     alignment and structure
>3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... Back     alignment and structure
>1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... Back     alignment and structure
>3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A Back     alignment and structure
>4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} Back     alignment and structure
>2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} Back     alignment and structure
>4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A Back     alignment and structure
>1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A Back     alignment and structure
>3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A Back     alignment and structure
>2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... Back     alignment and structure
>4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* Back     alignment and structure
>3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A Back     alignment and structure
>1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A Back     alignment and structure
>1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 Back     alignment and structure
>2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* Back     alignment and structure
>2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} Back     alignment and structure
>1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* Back     alignment and structure
>4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A Back     alignment and structure
>1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... Back     alignment and structure
>3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A Back     alignment and structure
>1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B Back     alignment and structure
>1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 Back     alignment and structure
>1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 Back     alignment and structure
>1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 Back     alignment and structure
>1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A Back     alignment and structure
>3ntt_A Capsid protein; gene therapy vector, cystic fibros sialic acid receptor, icosahedral virus; 3.45A {Adeno-associated virus - 5} Back     alignment and structure
>3ng9_A Capsid protein; beta barrel, single-stranded DNA V parvovirus, icosahedral virus; HET: ADE; 2.50A {Adeno-associated virus - 1} PDB: 3kic_A* 3kie_A* 3j1q_A 3oah_A* 1vu0_U 1vu1_o 3tsx_A 3shm_A 1lp3_A 3j1s_A 2qa0_A 3ra2_A 3ra4_A* 3ra8_A* 3ra9_A* 3raa_A* 3ux1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1poca_134 a.133.1.1 (A:) Phospholipase A2 {European honeybee 3e-23
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 Back     information, alignment and structure

class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]

 Score = 85.7 bits (212), Expect = 3e-23
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 66  LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGL 115
           +I+PGT WCG G+ ++  N+LG    TD CCR HD C + + A  S HGL
Sbjct: 1   IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGL 50

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1poca_134 Phospholipase A2 {European honeybee (Apis mellifer 99.96
d1n28a_124 Phospholipase A2 {Human (Homo sapiens), synovial f 97.03
d1g0za_118 Snake phospholipase A2 {Indian krait (Bungarus cae 97.03
d1buna_120 Snake phospholipase A2 {Many-banded krait (Bungaru 96.94
d1m8ta_119 Snake phospholipase A2 {King cobra (Ophiophagus ha 96.92
d1le6a_123 Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax 96.9
d2g58a1121 Snake phospholipase A2 {Snake (Daboia russellii pu 96.88
d1ae7a_119 Snake phospholipase A2 {Mainland tiger snake (Note 96.87
d1sz8a_119 Snake phospholipase A2 {Andaman cobra (Naja sagitt 96.82
d1m8ra_124 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.81
d1ppaa_121 Snake phospholipase A2 {Eastern cottonmouth snake 96.76
d1jiaa_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.75
d1gmza_122 Snake phospholipase A2 {Snake (Bothrops pirajai), 96.73
d1oz6a_120 Snake phospholipase A2 {Saw-scaled viper (Echis ca 96.73
d1zlba1122 Snake phospholipase A2 {Jararacussu (Bothrops jara 96.72
d1mc2a_122 Snake phospholipase A2 {Hundred-pace snake (Agkist 96.69
d1g4ia_123 Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI 96.66
d1bjja_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.64
d1p7oa_124 Snake phospholipase A2 {Small-eye snake (Micropech 96.64
d1jltb_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 96.63
d1jlta_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 96.59
d1vipa_121 Snake phospholipase A2 {Russell's viper (Vipera ru 96.54
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Back     information, alignment and structure
class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]

Probab=99.96  E-value=1.2e-31  Score=201.42  Aligned_cols=64  Identities=38%  Similarity=0.757  Sum_probs=61.9

Q ss_pred             eeecCCccccCCCCCCCCCCCCCCCccccccccccCCcccccccccccceeCCCCCccceeccc
Q psy7974          66 LIFPGTKWCGAGDIATDYNDLGTNVETDKCCRDHDHCSEYILAKSSLHGLDTFSGLALFPAWLG  129 (135)
Q Consensus        66 ~i~PGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~Cp~~I~a~e~kygl~N~~~~t~~~~~~~  129 (135)
                      +|+|||||||+||+|.+|+|||.+.++|+|||+||+||++|+|+++||||+|.+++|++-|.|-
T Consensus         1 ~i~PGTkWCG~Gn~A~~~~dlG~~~~~D~CCR~HD~Cp~~I~~~~~k~gl~N~~~~TishC~CD   64 (134)
T d1poca_           1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCD   64 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHHH
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchhhHhHccCcccccccccccceecCCccccCCCchH
Confidence            5999999999999999999999999999999999999999999999999999999999998763
>d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} Back     information, alignment and structure
>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} Back     information, alignment and structure
>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} Back     information, alignment and structure
>d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} Back     information, alignment and structure
>d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} Back     information, alignment and structure
>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} Back     information, alignment and structure
>d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} Back     information, alignment and structure
>d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} Back     information, alignment and structure
>d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} Back     information, alignment and structure
>d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} Back     information, alignment and structure
>d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} Back     information, alignment and structure
>d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} Back     information, alignment and structure
>d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} Back     information, alignment and structure
>d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} Back     information, alignment and structure
>d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} Back     information, alignment and structure
>d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} Back     information, alignment and structure