Psyllid ID: psy7980

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MLCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
ccEEccccccEEEEEcccccEEEEEEEccccHHHHHHHHHHHcccccccEEEEEcccccEEccccccccccccEEEEEEccccccccEEEEcc
ccEEEcccccEEEEEEcccEEEEEEcccccEHHHHHHHHHHcccccHHHEEEEEEccccccccccccccccccEEEEEHHcccccccHHHEcc
mlcclvprgillraqlpnqqrtsvhIRKGQTLLEALSKAMKlrnlkpemctaydsntgvslqwdtdsdhlpttEIRVEVMEGNLALSSLLIRS
MLCCLVPRGIllraqlpnqqrtsvhirKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
MLCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
*LCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLAL*******
*******RGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
MLCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
MLCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCCLVPRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTDSDHLPTTEIRVEVMEGNLALSSLLIRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
P11346 782 Raf homolog serine/threon no N/A 0.774 0.092 0.479 5e-10
P28028 804 Serine/threonine-protein yes N/A 0.870 0.100 0.404 9e-09
P34908 807 Serine/threonine-protein N/A N/A 0.870 0.100 0.404 2e-08
Q04982 806 Serine/threonine-protein yes N/A 0.870 0.100 0.404 2e-08
P15056 766 Serine/threonine-protein yes N/A 0.870 0.105 0.404 3e-08
P05625 647 RAF proto-oncogene serine no N/A 0.752 0.108 0.386 3e-08
P09560 638 RAF proto-oncogene serine N/A N/A 0.752 0.109 0.364 3e-08
Q5R5M7 648 RAF proto-oncogene serine no N/A 0.752 0.108 0.36 2e-07
P04049 648 RAF proto-oncogene serine no N/A 0.752 0.108 0.36 2e-07
Q99N57 648 RAF proto-oncogene serine no N/A 0.752 0.108 0.36 2e-07
>sp|P11346|KRAF1_DROME Raf homolog serine/threonine-protein kinase phl OS=Drosophila melanogaster GN=phl PE=1 SV=5 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 10  ILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVS-LQWDTDSD 68
           ILLRA LPNQQRTSV +  G  L +AL KA+KLR L P+MC    +++G   + W TD  
Sbjct: 184 ILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDMCEVSTTHSGRHIIPWHTDIG 243

Query: 69  HLPTTEIRVEVME 81
            L   EI V +++
Sbjct: 244 TLHVEEIFVRLLD 256
Serine/threonine kinase required in the early embryo for the formation of terminal structure. Also required during the proliferation of imaginal cells. May act downstream of ras1 in the sev signal transduction pathway.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|P28028|BRAF_MOUSE Serine/threonine-protein kinase B-raf OS=Mus musculus GN=Braf PE=1 SV=3 Back     alignment and function description
>sp|P34908|BRAF_COTJA Serine/threonine-protein kinase B-raf OS=Coturnix coturnix japonica GN=BRAF PE=2 SV=1 Back     alignment and function description
>sp|Q04982|BRAF_CHICK Serine/threonine-protein kinase B-raf OS=Gallus gallus GN=BRAF PE=1 SV=1 Back     alignment and function description
>sp|P15056|BRAF_HUMAN Serine/threonine-protein kinase B-raf OS=Homo sapiens GN=BRAF PE=1 SV=4 Back     alignment and function description
>sp|P05625|RAF1_CHICK RAF proto-oncogene serine/threonine-protein kinase OS=Gallus gallus GN=RAF1 PE=2 SV=1 Back     alignment and function description
>sp|P09560|RAF1_XENLA RAF proto-oncogene serine/threonine-protein kinase OS=Xenopus laevis GN=raf1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5M7|RAF1_PONAB RAF proto-oncogene serine/threonine-protein kinase OS=Pongo abelii GN=RAF1 PE=2 SV=1 Back     alignment and function description
>sp|P04049|RAF1_HUMAN RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens GN=RAF1 PE=1 SV=1 Back     alignment and function description
>sp|Q99N57|RAF1_MOUSE RAF proto-oncogene serine/threonine-protein kinase OS=Mus musculus GN=Raf1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
189241664 885 PREDICTED: similar to AGAP004699-PA [Tri 0.806 0.084 0.533 3e-13
270001107 670 hypothetical protein TcasGA2_TC011404 [T 0.806 0.111 0.545 5e-13
241745228 667 hypothetical protein IscW_ISCW011622 [Ix 0.817 0.113 0.506 1e-12
391337008 943 PREDICTED: serine/threonine-protein kina 0.806 0.079 0.460 2e-12
383848403 715 PREDICTED: raf homolog serine/threonine- 0.817 0.106 0.518 3e-12
350416306 781 PREDICTED: raf homolog serine/threonine- 0.817 0.097 0.518 3e-12
391327424 917 PREDICTED: serine/threonine-protein kina 0.806 0.081 0.473 3e-12
340711505 782 PREDICTED: raf homolog serine/threonine- 0.817 0.097 0.518 4e-12
66554913 715 PREDICTED: raf homolog serine/threonine- 0.817 0.106 0.518 5e-12
380030049 715 PREDICTED: raf homolog serine/threonine- 0.817 0.106 0.518 5e-12
>gi|189241664|ref|XP_966969.2| PREDICTED: similar to AGAP004699-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 79.3 bits (194), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 50/75 (66%)

Query: 7   PRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQWDTD 66
           P    LRA LPNQQRTSV +R+G TL +AL+KAMKLRNL  EMC  Y  +T   + WDTD
Sbjct: 80  PEPRFLRAHLPNQQRTSVQVREGLTLRDALAKAMKLRNLICEMCCVYLGDTNTVVNWDTD 139

Query: 67  SDHLPTTEIRVEVME 81
              L   EI V++++
Sbjct: 140 ISTLNCEEITVKILD 154

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270001107|gb|EEZ97554.1| hypothetical protein TcasGA2_TC011404 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|241745228|ref|XP_002412436.1| hypothetical protein IscW_ISCW011622 [Ixodes scapularis] gi|215505831|gb|EEC15325.1| hypothetical protein IscW_ISCW011622 [Ixodes scapularis] Back     alignment and taxonomy information
>gi|391337008|ref|XP_003742866.1| PREDICTED: serine/threonine-protein kinase B-raf-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|383848403|ref|XP_003699840.1| PREDICTED: raf homolog serine/threonine-protein kinase phl-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350416306|ref|XP_003490906.1| PREDICTED: raf homolog serine/threonine-protein kinase phl-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|391327424|ref|XP_003738200.1| PREDICTED: serine/threonine-protein kinase B-raf-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|340711505|ref|XP_003394316.1| PREDICTED: raf homolog serine/threonine-protein kinase phl-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66554913|ref|XP_396892.2| PREDICTED: raf homolog serine/threonine-protein kinase phl [Apis mellifera] Back     alignment and taxonomy information
>gi|380030049|ref|XP_003698671.1| PREDICTED: raf homolog serine/threonine-protein kinase phl-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
FB|FBgn0003079 782 phl "pole hole" [Drosophila me 0.774 0.092 0.479 2.9e-10
UNIPROTKB|F1LZI6 360 Braf "Protein Braf" [Rattus no 0.870 0.225 0.404 2e-09
ZFIN|ZDB-GENE-990415-41 654 raf1a "v-raf-1 murine leukemia 0.752 0.107 0.426 2.7e-09
ZFIN|ZDB-GENE-040805-1 817 braf "v-raf murine sarcoma vir 0.870 0.099 0.404 4.6e-09
UNIPROTKB|F1NJV6 718 BRAF "Serine/threonine-protein 0.870 0.112 0.404 6.4e-09
ZFIN|ZDB-GENE-050102-2 608 araf "v-raf murine sarcoma 361 0.806 0.123 0.410 6.4e-09
UNIPROTKB|F1SRQ1 754 BRAF "Uncharacterized protein" 0.870 0.107 0.404 6.8e-09
UNIPROTKB|F1P1L9 760 BRAF "Serine/threonine-protein 0.870 0.106 0.404 6.9e-09
UNIPROTKB|F1P873 761 BRAF "Uncharacterized protein" 0.870 0.106 0.404 6.9e-09
UNIPROTKB|P15056 766 BRAF "Serine/threonine-protein 0.870 0.105 0.404 6.9e-09
FB|FBgn0003079 phl "pole hole" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 2.9e-10, P = 2.9e-10
 Identities = 35/73 (47%), Positives = 46/73 (63%)

Query:    10 ILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSL-QWDTDSD 68
             ILLRA LPNQQRTSV +  G  L +AL KA+KLR L P+MC    +++G  +  W TD  
Sbjct:   184 ILLRAHLPNQQRTSVEVISGVRLCDALMKALKLRQLTPDMCEVSTTHSGRHIIPWHTDIG 243

Query:    69 HLPTTEIRVEVME 81
              L   EI V +++
Sbjct:   244 TLHVEEIFVRLLD 256
GO:0007362 "terminal region determination" evidence=IMP
GO:0007165 "signal transduction" evidence=IMP
GO:0004674 "protein serine/threonine kinase activity" evidence=IDA
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IGI
GO:0008069 "dorsal/ventral axis specification, ovarian follicular epithelium" evidence=IMP
GO:0008293 "torso signaling pathway" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0035309 "wing and notum subfield formation" evidence=IGI
GO:0007283 "spermatogenesis" evidence=IMP
GO:0035171 "lamellocyte differentiation" evidence=IMP;TAS
GO:0042386 "hemocyte differentiation" evidence=IGI;IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0007472 "wing disc morphogenesis" evidence=IMP
GO:0007428 "primary branching, open tracheal system" evidence=TAS
GO:0030097 "hemopoiesis" evidence=TAS
GO:0007369 "gastrulation" evidence=IMP
GO:0005057 "receptor signaling protein activity" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0040014 "regulation of multicellular organism growth" evidence=IMP
GO:0002168 "instar larval development" evidence=IMP
GO:0046534 "positive regulation of photoreceptor cell differentiation" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IGI
GO:0008284 "positive regulation of cell proliferation" evidence=IMP
GO:0007552 "metamorphosis" evidence=IMP
UNIPROTKB|F1LZI6 Braf "Protein Braf" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-41 raf1a "v-raf-1 murine leukemia viral oncogene homolog 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040805-1 braf "v-raf murine sarcoma viral oncogene homolog B1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJV6 BRAF "Serine/threonine-protein kinase B-raf" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050102-2 araf "v-raf murine sarcoma 3611 viral oncogene homolog" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRQ1 BRAF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1L9 BRAF "Serine/threonine-protein kinase B-raf" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P873 BRAF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P15056 BRAF "Serine/threonine-protein kinase B-raf" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
cd0181674 cd01816, Raf_RBD, Ubiquitin domain of Raf serine/t 6e-19
pfam0219671 pfam02196, RBD, Raf-like Ras-binding domain 3e-13
smart0045570 smart00455, RBD, Raf-like Ras-binding domain 5e-13
cd0176072 cd01760, RBD, Ubiquitin-like domain of RBD-like S/ 7e-13
>gnl|CDD|176411 cd01816, Raf_RBD, Ubiquitin domain of Raf serine/threonine kinases Back     alignment and domain information 
 Score = 73.2 bits (180), Expect = 6e-19
 Identities = 33/74 (44%), Positives = 49/74 (66%), Gaps = 4/74 (5%)

Query: 11 LLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAY----DSNTGVSLQWDTD 66
          L+R  LPN+QRT V++R G TL +AL+KA+K+R L+PE C  +     S+  + + WDTD
Sbjct: 1  LIRVFLPNKQRTVVNVRPGMTLRDALAKALKVRGLQPECCAVFRLGDGSSKKLRIDWDTD 60

Query: 67 SDHLPTTEIRVEVM 80
             L   E++VEV+
Sbjct: 61 ISSLIGEELQVEVL 74

The Raf serine/threonine kinases are composed of three conserved regions, CR1, CR2 and CR3. CR1 has two Ras binding domains (RBD and CRD), CR2 is a serine/threonine rich domain and CR3 is the catalytic kinase domain. The RBD of Raf is structurally similar to ubiquitin with little of no sequence similarity.The Raf signalling pathway plays an important role in the proliferation and survival of tumor cells. Length = 74
>gnl|CDD|202147 pfam02196, RBD, Raf-like Ras-binding domain Back     alignment and domain information
>gnl|CDD|128731 smart00455, RBD, Raf-like Ras-binding domain Back     alignment and domain information
>gnl|CDD|176358 cd01760, RBD, Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
cd0181674 Raf_RBD Ubiquitin domain of Raf serine/threonine k 100.0
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 100.0
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 99.97
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 99.96
smart0045570 RBD Raf-like Ras-binding domain. 99.95
KOG0193|consensus 678 99.89
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 98.64
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.03
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 97.18
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 96.09
cd0176887 RA RA (Ras-associating) ubiquitin domain. The RA ( 95.96
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 95.95
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 95.34
smart0031490 RA Ras association (RalGDS/AF-6) domain. RasGTP ef 94.68
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 93.7
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 93.17
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 91.71
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 89.96
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 89.21
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 86.11
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 85.25
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 84.39
PF14847105 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 83.96
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 83.84
PLN02593117 adrenodoxin-like ferredoxin protein 82.07
>cd01816 Raf_RBD Ubiquitin domain of Raf serine/threonine kinases Back     alignment and domain information 
Probab=100.00  E-value=9.8e-39  Score=209.47  Aligned_cols=70  Identities=46%  Similarity=0.796  Sum_probs=66.3

Q ss_pred             eEEEEcCCCCeeeEEecCCCcHHHHHHHHHHhcCCCCCceEEEeC-CC---CcccccCCCCCCcCCceeEEEee
Q psy7980          11 LLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDS-NT---GVSLQWDTDSDHLPTTEIRVEVM   80 (93)
Q Consensus        11 ~irv~LPn~QrT~V~vrpG~tlrdaL~Kalk~R~L~~~~C~Vy~~-~~---~~~i~wdtD~~~L~~eEl~Ve~l   80 (93)
                      +|||||||||||+|+||||||+||||+||||+|||+||||+||+. ++   +.+++||||++.|+||||+||++
T Consensus         1 ~ir~~LPnqQrT~V~vrpG~tl~daL~KaLk~R~l~pe~C~V~~~~~~~~~~~~i~W~td~~~L~geEL~V~~l   74 (74)
T cd01816           1 LIRVFLPNKQRTVVNVRPGMTLRDALAKALKVRGLQPECCAVFRLGDGSSKKLRIDWDTDISSLIGEELQVEVL   74 (74)
T ss_pred             CeeEECCCCCeEEEEecCCcCHHHHHHHHHHHcCCChhHeEEEEcCCCcccccccchhhhhhhccCceEEEEeC
Confidence            589999999999999999999999999999999999999999995 34   69999999999999999999985

The Raf serine/threonine kinases are composed of three conserved regions, CR1, CR2 and CR3. CR1 has two Ras binding domains (RBD and CRD), CR2 is a serine/threonine rich domain and CR3 is the catalytic kinase domain. The RBD of Raf is structurally similar to ubiquitin with little of no sequence similarity.The Raf signalling pathway plays an important role in the proliferation and survival of tumor cells.
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>cd01768 RA RA (Ras-associating) ubiquitin domain Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>smart00314 RA Ras association (RalGDS/AF-6) domain Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PF14847 Ras_bdg_2: Ras-binding domain of Byr2; PDB: 1I35_A 1K8R_B Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
2l05_A95 Solution Nmr Structure Of The Ras-Binding Domain Of 1e-09
3ny5_A96 Crystal Structure Of The Rbd Domain Of SerineTHREON 3e-09
1rfa_A79 Nmr Solution Structure Of The Ras-Binding Domain Of 4e-09
1rrb_A107 The Ras-Binding Domain Of Raf-1 From Rat, Nmr, 1 St 6e-09
1c1y_B77 Crystal Structure Of Rap.Gmppnp In Complex With The 6e-09
1gua_B81 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 8e-09
3kud_B81 Complex Of Ras-Gdp With Rafrbd(A85k) Length = 81 3e-08
3kuc_B81 Complex Of Rap1a(E30dK31E)GDP WITH RAFRBD(A85KN71R) 4e-08
1wxm_A86 Solution Structure Of The N-Terminal Ras-Binding Do 2e-07
>pdb|2L05|A Chain A, Solution Nmr Structure Of The Ras-Binding Domain Of SerineTHREONINE- Protein Kinase B-Raf From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4694f Length = 95 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
Query: 7  PRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTG--VSLQWD 64
          P+  ++R  LPN+QRT V  R G T+ ++L KA+ +R L PE C  Y    G    + WD
Sbjct: 15 PQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWD 74
Query: 65 TDSDHLPTTEIRVEVME 81
          TD   L   E+ VEV+E
Sbjct: 75 TDISWLTGEELHVEVLE 91
>pdb|3NY5|A Chain A, Crystal Structure Of The Rbd Domain Of SerineTHREONINE-Protein Kinase B-Raf From Homo Sapiens. Northeast Structural Genomics Consortium Target Hr4694f Length = 96 Back     alignment and structure
>pdb|1RFA|A Chain A, Nmr Solution Structure Of The Ras-Binding Domain Of C-Raf-1 Length = 79 Back     alignment and structure
>pdb|1RRB|A Chain A, The Ras-Binding Domain Of Raf-1 From Rat, Nmr, 1 Structure Length = 107 Back     alignment and structure
>pdb|1C1Y|B Chain B, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 77 Back     alignment and structure
>pdb|1GUA|B Chain B, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 81 Back     alignment and structure
>pdb|3KUD|B Chain B, Complex Of Ras-Gdp With Rafrbd(A85k) Length = 81 Back     alignment and structure
>pdb|3KUC|B Chain B, Complex Of Rap1a(E30dK31E)GDP WITH RAFRBD(A85KN71R) Length = 81 Back     alignment and structure
>pdb|1WXM|A Chain A, Solution Structure Of The N-Terminal Ras-Binding Domain (Rbd) In Human A-Raf Kinase Length = 86 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 4e-24
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 6e-24
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 1e-23
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 3e-23
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 6e-22
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} Length = 96 Back     alignment and structure
 Score = 86.6 bits (214), Expect = 4e-24
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 2/78 (2%)

Query: 7  PRGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDSNTGVSLQ--WD 64
           +  ++R  LPN+QRT V  R G T+ ++L KA+ +R L PE C  Y    G      WD
Sbjct: 11 MQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWD 70

Query: 65 TDSDHLPTTEIRVEVMEG 82
          TD   L   E+ VEV+E 
Sbjct: 71 TDISWLTGEELHVEVLEN 88
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Length = 107 Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Length = 86 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 100.0
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 100.0
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 100.0
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 100.0
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 100.0
1wfy_A104 Regulator of G-protein signaling 14; RAP1/RAP2 int 97.63
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 97.32
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 96.24
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 95.3
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 94.5
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 91.62
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 90.71
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 90.47
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 89.4
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 88.72
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 88.49
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 88.1
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 87.83
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 87.47
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 87.13
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 87.08
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 86.96
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 86.9
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 86.83
4gmv_A 281 RAS-associated and pleckstrin homology domains-CO 86.43
3tca_A 291 Amyloid beta A4 precursor protein-binding family 1 86.39
3hk0_A 256 Growth factor receptor-bound protein 10; GRB10, RA 86.39
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 85.33
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 84.99
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 83.34
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 83.19
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 82.47
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 81.98
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 81.8
2pjh_A80 Protein NPL4, nuclear protein localization protein 81.13
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 80.74
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 80.02
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
Probab=100.00  E-value=3.5e-46  Score=253.64  Aligned_cols=83  Identities=36%  Similarity=0.555  Sum_probs=75.5

Q ss_pred             CCceEEEEcCCCCeeeEEecCCCcHHHHHHHHHHhcCCCCCceEEEeC--CCCcccccCCCCCCcCCceeEEEeeccccc
Q psy7980           8 RGILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYDS--NTGVSLQWDTDSDHLPTTEIRVEVMEGNLA   85 (93)
Q Consensus         8 ~~~~irv~LPn~QrT~V~vrpG~tlrdaL~Kalk~R~L~~~~C~Vy~~--~~~~~i~wdtD~~~L~~eEl~Ve~ld~~p~   85 (93)
                      ++++|||||||||||+|+||||+|+||||+||||+|||+|+||+||+.  +++++|+||+|++.|+||||+||++|+||+
T Consensus        12 ~~~~irvhLPNqQrT~V~VrpG~tlrdaL~KaLk~R~L~pe~C~Vy~~~~~~~~~I~WdtDi~~L~geEL~Ve~ld~~pl   91 (96)
T 3ny5_A           12 QKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL   91 (96)
T ss_dssp             SSCEEEEEETTTEEEEEECCTTCBHHHHHHHHHHTTTCCGGGEEEEECC---CEEECTTBBGGGGTTCEEEEEECCCCCB
T ss_pred             hhCEEEEECCCCceEEEEecCCcCHHHHHHHHHHHcCCChHHeEEEEccCCCcCcccccccchhcccceEEehhhhcCCC
Confidence            489999999999999999999999999999999999999999999994  779999999999999999999999999999


Q ss_pred             ccccc
Q psy7980          86 LSSLL   90 (93)
Q Consensus        86 ~~h~f   90 (93)
                      ++|||
T Consensus        92 ttHnF   96 (96)
T 3ny5_A           92 TTHNF   96 (96)
T ss_dssp             C----
T ss_pred             cccCC
Confidence            99999
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>1wfy_A Regulator of G-protein signaling 14; RAP1/RAP2 interacting protein; regulators of G-protein signaling, RAS family, structural genomics; NMR {Mus musculus} SCOP: d.15.1.5 Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1wxma173 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/thre 7e-17
d1c1yb_77 d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [Ta 2e-16
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: A-Raf proto-oncogene serine/threonine-protein kinase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.3 bits (162), Expect = 7e-17
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 11 LLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAY--DSNTGVSLQWDTDSD 68
           ++  LPN+QRT V +R G ++ ++L KA+K+R L  + C  Y           WDT   
Sbjct: 2  TVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIA 61

Query: 69 HLPTTEIRVEVM 80
           L   E+ VEV+
Sbjct: 62 PLDGEELIVEVL 73
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 100.0
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wfya_104 Regulator of G-protein signaling 14, RGS14 {Mouse 98.28
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 97.58
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 96.74
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 92.65
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 90.5
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 90.41
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 87.77
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 87.7
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 87.09
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 85.42
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 83.69
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 82.65
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 80.96
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ras-binding domain, RBD
domain: A-Raf proto-oncogene serine/threonine-protein kinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.7e-36  Score=191.74  Aligned_cols=71  Identities=35%  Similarity=0.608  Sum_probs=68.5

Q ss_pred             ceEEEEcCCCCeeeEEecCCCcHHHHHHHHHHhcCCCCCceEEEe--CCCCcccccCCCCCCcCCceeEEEee
Q psy7980          10 ILLRAQLPNQQRTSVHIRKGQTLLEALSKAMKLRNLKPEMCTAYD--SNTGVSLQWDTDSDHLPTTEIRVEVM   80 (93)
Q Consensus        10 ~~irv~LPn~QrT~V~vrpG~tlrdaL~Kalk~R~L~~~~C~Vy~--~~~~~~i~wdtD~~~L~~eEl~Ve~l   80 (93)
                      ++|||||||||+|+|+||||+|+||||+|+|++|||++++|.||+  .+++++|+||+|++.|+|+||+||++
T Consensus         1 g~iRv~LPngq~T~V~vrpG~tir~~L~k~l~kRgl~~~~~~V~~~~~g~~~~i~~d~d~~~L~g~El~ve~~   73 (73)
T d1wxma1           1 GTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVL   73 (73)
T ss_dssp             SEEEEECSSSCEEEEECCSSCBSHHHHHHHHHTTTCCSSSEEEEEESSSCEEEECSSSBSTTCSSCEEEEEEC
T ss_pred             CeEEEEcCCCCeEEEEecCCCCHHHHHHHHHHHcCCCHHHEEEEEecCCCcceeecCCccccccCcEEEEEeC
Confidence            579999999999999999999999999999999999999999998  58899999999999999999999985
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfya_ d.15.1.5 (A:) Regulator of G-protein signaling 14, RGS14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure