Psyllid ID: psy7990
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| 70909509 | 193 | ribosomal protein S9e [Sphaerius sp. APV | 0.736 | 0.290 | 0.821 | 4e-18 | |
| 291242674 | 190 | PREDICTED: ribosomal protein S9-like [Sa | 0.763 | 0.305 | 0.758 | 7e-18 | |
| 332374562 | 194 | unknown [Dendroctonus ponderosae] | 0.75 | 0.293 | 0.789 | 8e-18 | |
| 125977176 | 195 | GA28351 [Drosophila pseudoobscura pseudo | 0.763 | 0.297 | 0.775 | 3e-17 | |
| 110671456 | 195 | putative ribosomal protein S9 [Diaphorin | 0.578 | 0.225 | 0.977 | 4e-17 | |
| 307202013 | 193 | 40S ribosomal protein S9 [Harpegnathos s | 0.736 | 0.290 | 0.785 | 5e-17 | |
| 307182078 | 193 | 40S ribosomal protein S9 [Camponotus flo | 0.736 | 0.290 | 0.785 | 5e-17 | |
| 340724942 | 193 | PREDICTED: 40S ribosomal protein S9-like | 0.736 | 0.290 | 0.785 | 5e-17 | |
| 355428300 | 193 | hypothetical protein [Triatoma rubida] | 0.736 | 0.290 | 0.767 | 6e-17 | |
| 62083481 | 194 | ribosomal protein S9 [Lysiphlebus testac | 0.75 | 0.293 | 0.754 | 6e-17 |
| >gi|70909509|emb|CAJ17220.1| ribosomal protein S9e [Sphaerius sp. APV-2005] | Back alignment and taxonomy information |
|---|
Score = 95.5 bits (236), Expect = 4e-18, Method: Compositional matrix adjust.
Identities = 46/56 (82%), Positives = 47/56 (83%)
Query: 19 VRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNLRKAASSATAPTEED 74
VRKQVVNIPSF+VRLDSQKHIDFSL SPFGGG GRVKRKNLRK A TA EED
Sbjct: 138 VRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLRKGAKGETAEEEED 193
|
Source: Sphaerius sp. APV-2005 Species: Sphaerius sp. APV-2005 Genus: Sphaerius Family: Sphaeriusidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|291242674|ref|XP_002741225.1| PREDICTED: ribosomal protein S9-like [Saccoglossus kowalevskii] | Back alignment and taxonomy information |
|---|
| >gi|332374562|gb|AEE62422.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|125977176|ref|XP_001352621.1| GA28351 [Drosophila pseudoobscura pseudoobscura] gi|195168054|ref|XP_002024847.1| GL17960 [Drosophila persimilis] gi|195178296|ref|XP_002029028.1| GL20135 [Drosophila persimilis] gi|195191346|ref|XP_002029552.1| GL21280 [Drosophila persimilis] gi|54641369|gb|EAL30119.1| GA28351 [Drosophila pseudoobscura pseudoobscura] gi|194103695|gb|EDW25738.1| GL21280 [Drosophila persimilis] gi|194108277|gb|EDW30320.1| GL17960 [Drosophila persimilis] gi|194117383|gb|EDW39426.1| GL20135 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|110671456|gb|ABG81979.1| putative ribosomal protein S9 [Diaphorina citri] | Back alignment and taxonomy information |
|---|
| >gi|307202013|gb|EFN81577.1| 40S ribosomal protein S9 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307182078|gb|EFN69456.1| 40S ribosomal protein S9 [Camponotus floridanus] gi|322799909|gb|EFZ21050.1| hypothetical protein SINV_10506 [Solenopsis invicta] gi|332017469|gb|EGI58192.1| 40S ribosomal protein S9 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|340724942|ref|XP_003400837.1| PREDICTED: 40S ribosomal protein S9-like [Bombus terrestris] gi|350422075|ref|XP_003493048.1| PREDICTED: 40S ribosomal protein S9-like [Bombus impatiens] gi|380027607|ref|XP_003697513.1| PREDICTED: 40S ribosomal protein S9-like isoform 1 [Apis florea] gi|383854712|ref|XP_003702864.1| PREDICTED: 40S ribosomal protein S9-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|355428300|gb|AER92466.1| hypothetical protein [Triatoma rubida] | Back alignment and taxonomy information |
|---|
| >gi|62083481|gb|AAX62465.1| ribosomal protein S9 [Lysiphlebus testaceipes] gi|62083483|gb|AAX62466.1| ribosomal protein S9 variant 1 [Lysiphlebus testaceipes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| FB|FBgn0010408 | 195 | RpS9 "Ribosomal protein S9" [D | 0.763 | 0.297 | 0.741 | 1.2e-17 | |
| UNIPROTKB|A6QLG5 | 194 | RPS9 "40S ribosomal protein S9 | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| UNIPROTKB|E2R8R8 | 194 | RPS9 "Uncharacterized protein" | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| UNIPROTKB|P46781 | 194 | RPS9 "40S ribosomal protein S9 | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| UNIPROTKB|I3LEX0 | 193 | RPS9 "40S ribosomal protein S9 | 0.763 | 0.300 | 0.706 | 3.2e-17 | |
| UNIPROTKB|A9L913 | 194 | RPS9 "40S ribosomal protein S9 | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| MGI|MGI:1924096 | 194 | Rps9 "ribosomal protein S9" [M | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| RGD|619889 | 194 | Rps9 "ribosomal protein S9" [R | 0.763 | 0.298 | 0.706 | 3.2e-17 | |
| ZFIN|ZDB-GENE-010724-15 | 194 | rps9 "ribosomal protein S9" [D | 0.763 | 0.298 | 0.706 | 6.7e-17 | |
| RGD|1566136 | 194 | RGD1566136 "similar to 40S rib | 0.763 | 0.298 | 0.672 | 7.7e-16 |
| FB|FBgn0010408 RpS9 "Ribosomal protein S9" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 215 (80.7 bits), Expect = 1.2e-17, P = 1.2e-17
Identities = 43/58 (74%), Positives = 46/58 (79%)
Query: 19 VRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNLRKAASSATAPTEEDEE 76
VRKQVVNIPSFVVRLDSQKHIDFSL SPFGGG GRVKRKNL+K EE+E+
Sbjct: 138 VRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
|
|
| UNIPROTKB|A6QLG5 RPS9 "40S ribosomal protein S9" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R8R8 RPS9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P46781 RPS9 "40S ribosomal protein S9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LEX0 RPS9 "40S ribosomal protein S9" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A9L913 RPS9 "40S ribosomal protein S9" [Papio anubis (taxid:9555)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1924096 Rps9 "ribosomal protein S9" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619889 Rps9 "ribosomal protein S9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-010724-15 rps9 "ribosomal protein S9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1566136 RGD1566136 "similar to 40S ribosomal protein S9" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| PLN00189 | 194 | PLN00189, PLN00189, 40S ribosomal protein S9; Prov | 1e-24 | |
| PTZ00155 | 181 | PTZ00155, PTZ00155, 40S ribosomal protein S9; Prov | 2e-21 | |
| TIGR01018 | 162 | TIGR01018, rpsD_arch, ribosomal protein S4(archaea | 6e-11 |
| >gnl|CDD|177783 PLN00189, PLN00189, 40S ribosomal protein S9; Provisional | Back alignment and domain information |
|---|
Score = 90.2 bits (224), Expect = 1e-24
Identities = 41/58 (70%), Positives = 45/58 (77%), Gaps = 1/58 (1%)
Query: 19 VRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNLRKAASSATAPTEEDEE 76
V KQ+VN+PSF+VR+DSQKHIDFSL SP GGG GRVKRKN KAAS EEDEE
Sbjct: 138 VGKQIVNVPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQ-KAASGGGDGDEEDEE 194
|
Length = 194 |
| >gnl|CDD|185484 PTZ00155, PTZ00155, 40S ribosomal protein S9; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213577 TIGR01018, rpsD_arch, ribosomal protein S4(archaeal type)/S9(eukaryote cytosolic type) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| PLN00189 | 194 | 40S ribosomal protein S9; Provisional | 99.95 | |
| PTZ00155 | 181 | 40S ribosomal protein S9; Provisional | 99.91 | |
| KOG3301|consensus | 183 | 99.91 | ||
| COG0522 | 205 | RpsD Ribosomal protein S4 and related proteins [Tr | 99.81 | |
| TIGR01018 | 162 | rpsD_arch ribosomal protein S4(archaeal type)/S9(e | 99.81 | |
| PRK04051 | 177 | rps4p 30S ribosomal protein S4P; Validated | 99.72 | |
| CHL00113 | 201 | rps4 ribosomal protein S4; Reviewed | 98.99 | |
| PF01479 | 48 | S4: S4 domain; InterPro: IPR002942 Ribosomes are t | 98.93 | |
| TIGR01017 | 200 | rpsD_bact ribosomal protein S4, bacterial/organell | 98.88 | |
| PRK05327 | 203 | rpsD 30S ribosomal protein S4; Validated | 98.86 | |
| cd00165 | 70 | S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The | 98.14 | |
| TIGR02988 | 59 | YaaA_near_RecF S4 domain protein YaaA. This small | 97.99 | |
| smart00363 | 60 | S4 S4 RNA-binding domain. | 97.83 | |
| PRK10348 | 133 | ribosome-associated heat shock protein Hsp15; Prov | 97.61 | |
| KOG4655|consensus | 181 | 97.58 | ||
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 97.37 | |
| COG1188 | 100 | Ribosome-associated heat shock protein implicated | 97.36 | |
| TIGR03069 | 257 | PS_II_S4 photosystem II S4 domain protein. Members | 97.09 | |
| PLN00051 | 267 | RNA-binding S4 domain-containing protein; Provisio | 96.26 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 96.18 | |
| PRK10839 | 232 | 16S rRNA pseudouridylate synthase A; Provisional | 96.11 | |
| PRK10700 | 289 | 23S rRNA pseudouridylate synthase B; Provisional | 95.8 | |
| COG2302 | 257 | Uncharacterized conserved protein, contains S4-lik | 95.32 | |
| PRK11180 | 325 | rluD 23S rRNA pseudouridine synthase D; Provisiona | 95.28 | |
| TIGR00005 | 299 | rluA_subfam pseudouridine synthase, RluA family. m | 95.04 | |
| PRK10475 | 290 | 23S rRNA pseudouridine synthase F; Provisional | 94.84 | |
| PRK11507 | 70 | ribosome-associated protein; Provisional | 94.06 | |
| PRK11025 | 317 | 23S rRNA pseudouridylate synthase C; Provisional | 93.24 | |
| COG0564 | 289 | RluA Pseudouridylate synthases, 23S RNA-specific [ | 92.87 | |
| PRK13354 | 410 | tyrosyl-tRNA synthetase; Provisional | 92.85 | |
| COG1187 | 248 | RsuA 16S rRNA uridine-516 pseudouridylate synthase | 92.54 | |
| PF13275 | 65 | S4_2: S4 domain; PDB: 1P9K_A. | 91.79 | |
| PRK05912 | 408 | tyrosyl-tRNA synthetase; Validated | 90.96 | |
| COG1471 | 241 | RPS4A Ribosomal protein S4E [Translation, ribosoma | 90.74 | |
| PF14451 | 81 | Ub-Mut7C: Mut7-C ubiquitin | 83.3 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 82.55 |
| >PLN00189 40S ribosomal protein S9; Provisional | Back alignment and domain information |
|---|
Probab=99.95 E-value=1e-28 Score=179.38 Aligned_cols=73 Identities=48% Similarity=0.756 Sum_probs=67.2
Q ss_pred CCccchhhhhhhhcCCeEECCEEeCccceeeecCCCCceeeeeCCCCCCCCcchhhhhhhhhhhccCCCCCCc
Q psy7990 1 MCSALFLSTQYWEHQGPGVRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNLRKAASSATAPTEE 73 (76)
Q Consensus 1 ~~~t~~~ARQ~V~HgHI~Vng~~VniPSy~Vk~~de~~I~~~~~SP~~~~~pgR~krk~~~~~~~~~~~~~~e 73 (76)
||+|+.+|||||+||||.|||++||+|||+|++++|++|+|+.+|||+++.|||+|||+++++++++++|+|+
T Consensus 120 ~a~si~~ARqlI~hgHI~V~~~~V~~Ps~~V~~~~e~~Itw~~~Sp~~~~~p~r~~~k~~~~~~~~~~~~~~~ 192 (194)
T PLN00189 120 MAKSIHHARVLIRQRHIRVGKQIVNVPSFMVRVDSQKHIDFSLTSPLGGGRPGRVKRKNQKAASGGGDGDEED 192 (194)
T ss_pred CcCCHHHHHHheeCCCEeECCEEEecCcEEEecCCEEEEEEecCCcccCCChhHHHHHHHHhccCCCCccccc
Confidence 7999999999999999999999999999999999999999999999999789999999999997765554443
|
|
| >PTZ00155 40S ribosomal protein S9; Provisional | Back alignment and domain information |
|---|
| >KOG3301|consensus | Back alignment and domain information |
|---|
| >COG0522 RpsD Ribosomal protein S4 and related proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01018 rpsD_arch ribosomal protein S4(archaeal type)/S9(eukaryote cytosolic type) | Back alignment and domain information |
|---|
| >PRK04051 rps4p 30S ribosomal protein S4P; Validated | Back alignment and domain information |
|---|
| >CHL00113 rps4 ribosomal protein S4; Reviewed | Back alignment and domain information |
|---|
| >PF01479 S4: S4 domain; InterPro: IPR002942 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >TIGR01017 rpsD_bact ribosomal protein S4, bacterial/organelle type | Back alignment and domain information |
|---|
| >PRK05327 rpsD 30S ribosomal protein S4; Validated | Back alignment and domain information |
|---|
| >cd00165 S4 S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site; Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized functional similarity between these three protein classes | Back alignment and domain information |
|---|
| >TIGR02988 YaaA_near_RecF S4 domain protein YaaA | Back alignment and domain information |
|---|
| >smart00363 S4 S4 RNA-binding domain | Back alignment and domain information |
|---|
| >PRK10348 ribosome-associated heat shock protein Hsp15; Provisional | Back alignment and domain information |
|---|
| >KOG4655|consensus | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >COG1188 Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03069 PS_II_S4 photosystem II S4 domain protein | Back alignment and domain information |
|---|
| >PLN00051 RNA-binding S4 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10839 16S rRNA pseudouridylate synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK10700 23S rRNA pseudouridylate synthase B; Provisional | Back alignment and domain information |
|---|
| >COG2302 Uncharacterized conserved protein, contains S4-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK11180 rluD 23S rRNA pseudouridine synthase D; Provisional | Back alignment and domain information |
|---|
| >TIGR00005 rluA_subfam pseudouridine synthase, RluA family | Back alignment and domain information |
|---|
| >PRK10475 23S rRNA pseudouridine synthase F; Provisional | Back alignment and domain information |
|---|
| >PRK11507 ribosome-associated protein; Provisional | Back alignment and domain information |
|---|
| >PRK11025 23S rRNA pseudouridylate synthase C; Provisional | Back alignment and domain information |
|---|
| >COG0564 RluA Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13354 tyrosyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1187 RsuA 16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13275 S4_2: S4 domain; PDB: 1P9K_A | Back alignment and domain information |
|---|
| >PRK05912 tyrosyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >COG1471 RPS4A Ribosomal protein S4E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14451 Ub-Mut7C: Mut7-C ubiquitin | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 76 | ||||
| 3iz6_C | 195 | Localization Of The Small Subunit Ribosomal Protein | 5e-14 | ||
| 3izb_C | 197 | Localization Of The Small Subunit Ribosomal Protein | 3e-12 | ||
| 1s1h_D | 179 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 4e-12 | ||
| 2xzm_D | 181 | Crystal Structure Of The Eukaryotic 40s Ribosomal S | 3e-10 | ||
| 3zey_6 | 190 | High-resolution Cryo-electron Microscopy Structure | 9e-09 | ||
| 3jyv_D | 158 | Structure Of The 40s Rrna And Proteins And PE TRNA | 8e-07 |
| >pdb|3IZ6|C Chain C, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 195 | Back alignment and structure |
|
| >pdb|3IZB|C Chain C, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 197 | Back alignment and structure |
| >pdb|1S1H|D Chain D, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 179 | Back alignment and structure |
| >pdb|2XZM|D Chain D, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 181 | Back alignment and structure |
| >pdb|3ZEY|6 Chain 6, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 190 | Back alignment and structure |
| >pdb|3JYV|D Chain D, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 158 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| 3u5c_J | 197 | 40S ribosomal protein S9-A; translation, ribosome, | 1e-18 | |
| 3iz6_C | 195 | 40S ribosomal protein S9 (S4P); eukaryotic ribosom | 9e-18 | |
| 2xzm_D | 181 | Ribosomal protein S4 containing protein; ribosome, | 9e-16 | |
| 2cqj_A | 71 | BRMS2, U3 small nucleolar ribonucleoprotein protei | 8e-10 |
| >3u5c_J 40S ribosomal protein S9-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_C 3o30_E 3o2z_E 3u5g_J 1s1h_D 3jyv_D* Length = 197 | Back alignment and structure |
|---|
Score = 74.8 bits (183), Expect = 1e-18
Identities = 32/76 (42%), Positives = 47/76 (61%)
Query: 1 MCSALFLSTQYWEHQGPGVRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNL 60
+ ++ + + V KQ+VNIPSF+VRLDS+KHIDF+ SPFGG GRV R+N
Sbjct: 118 LAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNA 177
Query: 61 RKAASSATAPTEEDEE 76
+ A ++ +E +E
Sbjct: 178 ARKAEASGEAADEADE 193
|
| >3iz6_C 40S ribosomal protein S9 (S4P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 195 | Back alignment and structure |
|---|
| >2xzm_D Ribosomal protein S4 containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_D Length = 181 | Back alignment and structure |
|---|
| >2cqj_A BRMS2, U3 small nucleolar ribonucleoprotein protein IMP3 homolog; S4 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| 3iz6_C | 195 | 40S ribosomal protein S9 (S4P); eukaryotic ribosom | 99.93 | |
| 3u5c_J | 197 | 40S ribosomal protein S9-A; translation, ribosome, | 99.91 | |
| 2xzm_D | 181 | Ribosomal protein S4 containing protein; ribosome, | 99.81 | |
| 2cqj_A | 71 | BRMS2, U3 small nucleolar ribonucleoprotein protei | 99.59 | |
| 3j20_D | 180 | 30S ribosomal protein S4P; archaea, archaeal, KINK | 99.58 | |
| 3bbn_D | 201 | Ribosomal protein S4; small ribosomal subunit, spi | 99.13 | |
| 2vqe_D | 209 | 30S ribosomal protein S4; tRNA-binding, rRNA-bindi | 98.9 | |
| 3r8n_D | 205 | 30S ribosomal protein S4; protein biosynthesis, RN | 98.89 | |
| 1c05_A | 159 | Ribosomal protein S4 delta 41; two subdomains, uni | 98.87 | |
| 3j20_E | 243 | 30S ribosomal protein S4E; archaea, archaeal, KINK | 98.27 | |
| 3kbg_A | 213 | 30S ribosomal protein S4E; RPS4E, RS4E_theac, TAR2 | 98.25 | |
| 2k6p_A | 92 | Uncharacterized protein HP_1423; alpha-L motif, RN | 97.87 | |
| 1p9k_A | 79 | ORF, hypothetical protein; alfal motif, RNA-bindin | 97.78 | |
| 1dm9_A | 133 | Hypothetical 15.5 KD protein in MRCA-PCKA intergen | 97.78 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 97.19 | |
| 1vio_A | 243 | Ribosomal small subunit pseudouridine synthase A; | 97.03 | |
| 1ksk_A | 234 | Ribosomal small subunit pseudouridine synthase A; | 96.85 | |
| 3dh3_A | 290 | Ribosomal large subunit pseudouridine synthase F; | 95.8 | |
| 1v9f_A | 325 | Ribosomal large subunit pseudouridine synthase D; | 95.77 | |
| 1fm0_D | 81 | Molybdopterin convertin factor, subunit 1; molybde | 92.9 | |
| 2jan_A | 432 | Tyrosyl-tRNA synthetase; protein biosynthesis, ami | 91.52 | |
| 1h3f_A | 432 | Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA sy | 91.2 | |
| 1jil_A | 420 | Tyrrs, tyrosyl-tRNA synthetase; truncation, based | 91.2 | |
| 2q5w_D | 77 | Molybdopterin converting factor, subunit 1; MOCO, | 91.05 | |
| 2ts1_A | 419 | Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30 | 88.62 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 87.3 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 87.01 | |
| 2g1e_A | 90 | Hypothetical protein TA0895; MOAD, molybdopterin, | 83.84 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 83.19 | |
| 2ktl_A | 164 | Tyrosyl-tRNA synthetase; S4 fold, aminoacyl-tRNA s | 82.09 | |
| 2qjl_A | 99 | URM1, ubiquitin-related modifier 1; ubiquitin-like | 81.51 |
| >3iz6_C 40S ribosomal protein S9 (S4P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
Probab=99.93 E-value=9.1e-28 Score=173.08 Aligned_cols=76 Identities=51% Similarity=0.793 Sum_probs=70.2
Q ss_pred CCccchhhhhhhhcCCeEECCEEeCccceeeecCCCCceeeeeCCCCCCCCcchhhhhhhhhhhccCCCCCCcccC
Q psy7990 1 MCSALFLSTQYWEHQGPGVRKQVVNIPSFVVRLDSQKHIDFSLNSPFGGGGTGRVKRKNLRKAASSATAPTEEDEE 76 (76)
Q Consensus 1 ~~~t~~~ARQ~V~HgHI~Vng~~VniPSy~Vk~~de~~I~~~~~SP~~~~~pgR~krk~~~~~~~~~~~~~~e~~~ 76 (76)
+|+|+.+|||||.||||.|||++|++|||+|+++++.+|+|..+|||+++.|||+|||+++++.+++++++|||||
T Consensus 120 ~a~SR~~ArqlI~~GhV~VNG~~V~~Ps~~V~~gde~~I~~~~~spyv~~~~gr~~rk~~~~~~~~~~~~~~~~~~ 195 (195)
T 3iz6_C 120 MAKSIHHARVLIRQRHIRVGRQIVNIPSFMVRVESEKHIDFSLTSPFGGGPPGRVKRKNQKKASGGGGDGEEEDEE 195 (195)
T ss_dssp CHHHHSCTTSHHHHHSTTTSCCCCCCCCCCCSSSCSSSSCSSSCCCCCCCCCCHHHHHHHHTTTSSSSCCCCCCCC
T ss_pred ccCCHHHHHHHHHcCCEEECCEEeCCCCcCcCCCCEEEEEecCCCCCCCCCchhHHHHHHhhccCCCCCccccccC
Confidence 5789999999999999999999999999999999999999999999999999999999999987776676666664
|
| >3u5c_J 40S ribosomal protein S9-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_C 3o30_E 3o2z_E 3u5g_J 1s1h_D 3jyv_D* | Back alignment and structure |
|---|
| >2xzm_D Ribosomal protein S4 containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_D | Back alignment and structure |
|---|
| >2cqj_A BRMS2, U3 small nucleolar ribonucleoprotein protein IMP3 homolog; S4 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j20_D 30S ribosomal protein S4P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bbn_D Ribosomal protein S4; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >2vqe_D 30S ribosomal protein S4; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.66.1.2 PDB: 1hnw_D* 1hnx_D* 1hnz_D* 1ibk_D* 1fka_D* 1ibm_D 1xmo_D* 1ibl_D* 1xnq_D* 1xnr_D* 1yl4_G 2b64_D* 2b9m_D* 2b9o_D* 2hgi_G 2hgp_G 2hgr_G 2hhh_D* 1xmq_D* 2j02_D* ... | Back alignment and structure |
|---|
| >1c05_A Ribosomal protein S4 delta 41; two subdomains, unique topology, possible helix-turn-helix motif, ribosome; NMR {Geobacillus stearothermophilus} SCOP: d.66.1.2 PDB: 1c06_A 1eg0_A 1qd7_C | Back alignment and structure |
|---|
| >3j20_E 30S ribosomal protein S4E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3kbg_A 30S ribosomal protein S4E; RPS4E, RS4E_theac, TAR28, NESG, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.75A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2k6p_A Uncharacterized protein HP_1423; alpha-L motif, RNA-binding, unknown function; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1p9k_A ORF, hypothetical protein; alfal motif, RNA-binding protein, E.coli, montreal-kingston structural genomics initiative, BSGI; NMR {Escherichia coli} SCOP: d.66.1.6 | Back alignment and structure |
|---|
| >1dm9_A Hypothetical 15.5 KD protein in MRCA-PCKA intergenic region; heat shock proteins, protein-RNA interactions, ribosome, structural genomics; 2.00A {Escherichia coli} SCOP: d.66.1.3 PDB: 3bbu_A | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >1vio_A Ribosomal small subunit pseudouridine synthase A; structural genomics, lyase; 1.59A {Haemophilus influenzae} SCOP: d.265.1.3 d.66.1.5 | Back alignment and structure |
|---|
| >1ksk_A Ribosomal small subunit pseudouridine synthase A; RSUA, lyase; 2.00A {Escherichia coli} SCOP: d.265.1.3 d.66.1.5 PDB: 1ksl_A 1ksv_A* | Back alignment and structure |
|---|
| >3dh3_A Ribosomal large subunit pseudouridine synthase F; protein-RNA complex, S4 domain, alpha/beta protein, isomerase, RNA-binding, rRNA processing; HET: FHU; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1v9f_A Ribosomal large subunit pseudouridine synthase D; RNA binding, lyase; 1.70A {Escherichia coli} SCOP: d.265.1.3 PDB: 2ist_A 1qyu_A 1prz_A | Back alignment and structure |
|---|
| >1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D | Back alignment and structure |
|---|
| >2jan_A Tyrosyl-tRNA synthetase; protein biosynthesis, aminoacyl-tRNA synthetase, tyrrs, ligase, tyrosine, RNA-binding, ATP-binding; 2.9A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1h3f_A Tyrosyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase; HET: TYE; 2.00A {Thermus thermophilus} SCOP: c.26.1.1 d.66.1.4 PDB: 1h3e_A* | Back alignment and structure |
|---|
| >1jil_A Tyrrs, tyrosyl-tRNA synthetase; truncation, based inhibitor design, ligase; HET: 485; 2.20A {Staphylococcus aureus} SCOP: c.26.1.1 PDB: 1jij_A* 1jii_A* 1jik_A* | Back alignment and structure |
|---|
| >2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* | Back alignment and structure |
|---|
| >2ts1_A Tyrosyl-tRNA synthetase; ligase (synthetase); 2.30A {Geobacillus stearothermophilus} SCOP: c.26.1.1 PDB: 3ts1_A* 1tyd_E* 1tya_E* 1tyc_A 1tyb_E* 4ts1_A* 1jh3_A | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A | Back alignment and structure |
|---|
| >2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ktl_A Tyrosyl-tRNA synthetase; S4 fold, aminoacyl-tRNA synthetase, ligase; NMR {Aspergillus nidulans fgsc A4} | Back alignment and structure |
|---|
| >2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| d1c06a_ | 159 | Ribosomal protein S4 {Bacillus stearothermophilus | 99.71 | |
| d2gy9d1 | 204 | Ribosomal protein S4 {Escherichia coli [TaxId: 562 | 99.7 | |
| d2uubd1 | 208 | Ribosomal protein S4 {Thermus thermophilus [TaxId: | 99.64 | |
| d1dm9a_ | 104 | Heat shock protein 15 kD {Escherichia coli [TaxId: | 98.76 | |
| d1vioa2 | 58 | Pseudouridine synthase RsuA N-terminal domain {Hae | 98.61 | |
| d1kska3 | 59 | Pseudouridine synthase RsuA N-terminal domain {Esc | 98.6 | |
| d1p9ka_ | 79 | Hypothetical protein YbcJ {Escherichia coli [TaxId | 98.28 | |
| d1h3fa2 | 81 | Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain | 97.18 | |
| d1jh3a_ | 99 | Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain | 96.98 |
| >d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Alpha-L RNA-binding motif superfamily: Alpha-L RNA-binding motif family: Ribosomal protein S4 domain: Ribosomal protein S4 species: Bacillus stearothermophilus [TaxId: 1422]
Probab=99.71 E-value=1.1e-18 Score=120.25 Aligned_cols=42 Identities=24% Similarity=0.192 Sum_probs=37.8
Q ss_pred CCccchhhhhhhhcCCeEECCEEeCccceeeecCCCCceeeeeC
Q psy7990 1 MCSALFLSTQYWEHQGPGVRKQVVNIPSFVVRLDSQKHIDFSLN 44 (76)
Q Consensus 1 ~~~t~~~ARQ~V~HgHI~Vng~~VniPSy~Vk~~de~~I~~~~~ 44 (76)
+++|+++|||||+||||+|||++||||||+|++|| .|++.+.
T Consensus 62 fa~t~~~arQ~v~Hghi~vNgk~v~iPSy~vk~GD--vIsvkek 103 (159)
T d1c06a_ 62 LARTRRQARQLVTHGHILVDGSRVNIPSYRVKPGQ--TIAVREK 103 (159)
T ss_dssp SSSSHHHHHHHHHTSCEEETTEECCCSSCCCCSSC--EEEECGG
T ss_pred ccCCHHHHHHHHHhcceEccceEEEecceeecCCc--EEeeccc
Confidence 57999999999999999999999999999999998 5666543
|
| >d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2uubd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vioa2 d.66.1.5 (A:0-57) Pseudouridine synthase RsuA N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kska3 d.66.1.5 (A:1-59) Pseudouridine synthase RsuA N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ka_ d.66.1.6 (A:) Hypothetical protein YbcJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h3fa2 d.66.1.4 (A:352-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jh3a_ d.66.1.4 (A:) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|